F338573

General Info

Members Datasets Scaffolds Average Seq Length
226 126 452 59

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100036969|Ga0070674_1000369692
Length 60
Sequence MTRGAGKAPKQITWIICLILYVVALLAHFGVVRGIDANIATWSWIIGFGLLLVAVQVRGL

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
110 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 0
Rhizoplane 0
Rhizosphere 94.69
Stem 0
Stem Tuber 0
Unclassified 41.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100036969 3300005356 Bacteria 3282
2 Ga0065712_10435642 3300005290 Bacteria 638
3 Ga0065715_10346786 3300005293 Unclassified 958
4 Ga0070683_100833700 3300005329 Bacteria 884
5 Ga0070683_101929452 3300005329 Unclassified 567
6 Ga0070670_100159380 3300005331 Bacteria 1955
7 Ga0070670_100514299 3300005331 Bacteria 1066
8 Ga0070677_10007044 3300005333 Plasmid 3741
9 Ga0068869_100907289 3300005334 Bacteria 763
10 Ga0070680_100041881 3300005336 Bacteria 3714
11 Ga0070682_100000035 3300005337 Bacteria 150016
12 Ga0070682_101346455 3300005337 Unclassified 608
13 Ga0068868_100246179 3300005338 Bacteria 1503
14 Ga0070689_100323310 3300005340 Archaea 1289
15 Ga0070687_100028218 3300005343 Bacteria 2720
16 Ga0070692_10000563 3300005345 Bacteria 11607
17 Ga0070692_10144259 3300005345 Bacteria 1351
18 Ga0070669_101949226 3300005353 Unclassified 513
19 Ga0070675_100000004 3300005354 Bacteria 361974
20 Ga0070705_100187027 3300005440 Archaea 1408
21 Ga0070700_100000016 3300005441 Bacteria 147213
22 Ga0070708_100069039 3300005445 Bacteria 3177
23 Ga0070678_101157915 3300005456 Unclassified 716
24 Ga0070678_102092759 3300005456 Unclassified 536
25 Ga0068867_101365096 3300005459 Unclassified 656
26 Ga0068867_101714761 3300005459 Unclassified 589
27 Ga0070706_100102191 3300005467 Bacteria 2665
28 Ga0070706_100354850 3300005467 Unclassified 1367
29 Ga0070706_100464650 3300005467 Bacteria 1177
30 Ga0070706_100702988 3300005467 Bacteria 937
31 Ga0070706_100932002 3300005467 Unclassified 802
32 Ga0070707_100420619 3300005468 Unclassified 1297
33 Ga0070707_100558726 3300005468 Bacteria 1107
34 Ga0070707_100755314 3300005468 Unclassified 936
35 Ga0070698_100188991 3300005471 Unclassified 1997
36 Ga0070698_100210094 3300005471 Unclassified 1881
37 Ga0070699_100056552 3300005518 Bacteria 3397
38 Ga0070699_100700352 3300005518 Bacteria 925
39 Ga0070699_101440547 3300005518 Unclassified 632
40 Ga0070684_100554507 3300005535 Bacteria 1067
41 Ga0070697_100366748 3300005536 Unclassified 1246
42 Ga0070697_101191954 3300005536 Unclassified 678
43 Ga0070697_101386092 3300005536 Unclassified 628
44 Ga0070672_100069667 3300005543 Unclassified 2793
45 Ga0070686_100101263 3300005544 Unclassified 1947
46 Ga0070686_100710536 3300005544 Unclassified 802
47 Ga0070696_100226217 3300005546 Bacteria 1406
48 Ga0070696_100403455 3300005546 Unclassified 1070
49 Ga0070693_100980712 3300005547 Unclassified 638
50 Ga0070704_100488605 3300005549 Unclassified 1066
51 Ga0068857_100185545 3300005577 Bacteria 1893
52 Ga0070702_100393166 3300005615 Unclassified 989
53 Ga0070702_100962327 3300005615 Unclassified 673
54 Ga0068852_100939956 3300005616 Unclassified 882
55 Ga0068852_101973181 3300005616 Unclassified 606
56 Ga0068859_102229765 3300005617 Bacteria 604
57 Ga0068864_100000046 3300005618 Bacteria 151661
58 Ga0068861_100816074 3300005719 Bacteria 877
59 Ga0068861_100872920 3300005719 Bacteria 850
60 Ga0068861_101840545 3300005719 Unclassified 601
61 Ga0068870_10061496 3300005840 Bacteria 2019
62 Ga0068870_10392023 3300005840 Bacteria 901
63 Ga0068870_10729324 3300005840 Bacteria 686
64 Ga0068858_100572821 3300005842 Bacteria 1094
65 Ga0068858_101520464 3300005842 Bacteria 660
66 Ga0068858_101664191 3300005842 Unclassified 630
67 Ga0068858_102527298 3300005842 Unclassified 507
68 Ga0068860_100499952 3300005843 Bacteria 1214
69 Ga0068860_102464740 3300005843 Unclassified 540
70 Ga0075368_10132879 3300006042 Bacteria 1035
71 Ga0075364_11104871 3300006051 Unclassified 538
72 Ga0075362_10412438 3300006177 Bacteria 682
73 Ga0075367_10069198 3300006178 Unclassified 2119
74 Ga0075366_10761295 3300006195 Bacteria 602
75 Ga0075370_10228552 3300006353 Bacteria 1101
76 Ga0075428_100094823 3300006844 Bacteria 3253
77 Ga0075428_100125823 3300006844 Bacteria 2789
78 Ga0075428_100416320 3300006844 Unclassified 1440
79 Ga0075428_101300117 3300006844 Bacteria 765
80 Ga0075431_100001385 3300006847 Bacteria 22238
81 Ga0075431_100049567 3300006847 Bacteria 4329
82 Ga0075431_100132948 3300006847 Bacteria 2565
83 Ga0075431_100164912 3300006847 Bacteria 2278
84 Ga0075433_10855420 3300006852 Bacteria 794
85 Ga0075433_11861220 3300006852 Unclassified 517
86 Ga0075434_100063106 3300006871 Bacteria 3688
87 Ga0075434_101432196 3300006871 Bacteria 701
88 Ga0075434_102282923 3300006871 Unclassified 544
89 Ga0075429_100005690 3300006880 Bacteria 10750
90 Ga0075429_100245455 3300006880 Bacteria 1568
91 Ga0075429_100862993 3300006880 Bacteria 792
92 Ga0097620_100000048 3300006931 Bacteria 138664
93 Ga0097620_102231047 3300006931 Bacteria 604
94 Ga0075435_100136689 3300007076 Archaea 2054
95 Ga0075435_100439253 3300007076 Bacteria 1125
96 Ga0075435_100457702 3300007076 Bacteria 1101
97 Ga0099794_10551124 3300007265 Unclassified 609
98 Ga0105244_10029421 3300009036 Bacteria 2936
99 Ga0111539_10000007 3300009094 Bacteria 418059
100 Ga0111539_12142409 3300009094 Bacteria 649
101 Ga0111539_12869839 3300009094 Bacteria 558
102 Ga0105245_10021973 3300009098 Bacteria 5599
103 Ga0105245_10056796 3300009098 Bacteria 3519
104 Ga0105245_10895225 3300009098 Unclassified 929
105 Ga0105245_11925915 3300009098 Unclassified 644
106 Ga0105245_12433698 3300009098 Bacteria 577
107 Ga0105247_10033541 3300009101 Bacteria 3123
108 Ga0114129_10004140 3300009147 Bacteria 20492
109 Ga0114129_10137508 3300009147 Bacteria 3351
110 Ga0114129_10238635 3300009147 Unclassified 2445
111 Ga0114129_10606817 3300009147 Unclassified 1417
112 Ga0114129_10762122 3300009147 Bacteria 1238
113 Ga0114129_12357940 3300009147 Unclassified 638
114 Ga0114129_13096341 3300009147 Unclassified 544
115 Ga0105243_10782118 3300009148 Unclassified 939
116 Ga0105242_10001216 3300009176 Bacteria 20315
117 Ga0105242_10422591 3300009176 Bacteria 1249
118 Ga0105242_10934989 3300009176 Unclassified 870
119 Ga0105242_11494465 3300009176 Unclassified 706
120 Ga0105249_10961595 3300009553 Bacteria 922
121 Ga0105239_10624857 3300010375 Bacteria 1229
122 Ga0105246_10407474 3300011119 Unclassified 1131
123 Ga0105246_10727914 3300011119 Unclassified 872
124 Ga0157374_10515989 3300013296 Bacteria 1201
125 Ga0157378_10321544 3300013297 Unclassified 1503
126 Ga0157378_11029627 3300013297 Unclassified 858
127 Ga0157378_12281394 3300013297 Bacteria 593
128 Ga0157378_12369070 3300013297 Unclassified 583
129 Ga0163162_10796363 3300013306 Unclassified 1063
130 Ga0163163_10018985 3300014325 Bacteria 6450
131 Ga0163163_10788250 3300014325 Unclassified 1014
132 Ga0163163_11058615 3300014325 Bacteria 874
133 Ga0163163_11420422 3300014325 Unclassified 755
134 Ga0157380_10016766 3300014326 Bacteria 5410
135 Ga0157380_10207224 3300014326 Bacteria 1744
136 Ga0157377_10441237 3300014745 Bacteria 896
137 Ga0157379_11809275 3300014968 Unclassified 600
138 Ga0157376_11695501 3300014969 Unclassified 667
139 Ga0207655_1026824 3300025728 Bacteria 2757
140 Ga0207682_10037396 3300025893 Bacteria 1967
141 Ga0207710_10025217 3300025900 Unclassified 2565
142 Ga0207645_10462300 3300025907 Bacteria 857
143 Ga0207645_10650960 3300025907 Unclassified 716
144 Ga0207643_10069550 3300025908 Bacteria 2024
145 Ga0207684_10070050 3300025910 Bacteria 2980
146 Ga0207684_10351065 3300025910 Unclassified 1270
147 Ga0207684_10430572 3300025910 Bacteria 1133
148 Ga0207684_10595402 3300025910 Unclassified 944
149 Ga0207660_10016758 3300025917 Bacteria 4859
150 Ga0207662_10021754 3300025918 Bacteria 3669
151 Ga0207646_10004242 3300025922 Bacteria 15667
152 Ga0207646_10843941 3300025922 Unclassified 814
153 Ga0207646_11730207 3300025922 Bacteria 536
154 Ga0207650_10062386 3300025925 Unclassified 2785
155 Ga0207659_10000002 3300025926 Bacteria 619441
156 Ga0207687_10002824 3300025927 Bacteria 11778
157 Ga0207687_11486277 3300025927 Bacteria 582
158 Ga0207687_11922252 3300025927 Unclassified 506
159 Ga0207687_11945202 3300025927 Bacteria 502
160 Ga0207686_10237969 3300025934 Bacteria 1323
161 Ga0207686_11113699 3300025934 Bacteria 644
162 Ga0207709_11245551 3300025935 Unclassified 614
163 Ga0207670_10016762 3300025936 Bacteria 4413
164 Ga0207670_10595029 3300025936 Unclassified 908
165 Ga0207669_10688349 3300025937 Unclassified 839
166 Ga0207691_10083533 3300025940 Unclassified 2867
167 Ga0207689_10102961 3300025942 Bacteria 2346
168 Ga0207661_10946280 3300025944 Unclassified 793
169 Ga0207712_10571853 3300025961 Bacteria 974
170 Ga0207677_10113121 3300026023 Unclassified 2026
171 Ga0207677_10626163 3300026023 Bacteria 947
172 Ga0207677_11950425 3300026023 Unclassified 546
173 Ga0207703_11312232 3300026035 Unclassified 696
174 Ga0207703_11411400 3300026035 Bacteria 670
175 Ga0207703_11891005 3300026035 Unclassified 573
176 Ga0207708_10000005 3300026075 Bacteria 284735
177 Ga0207648_10738569 3300026089 Unclassified 914
178 Ga0207648_11099817 3300026089 Bacteria 745
179 Ga0207676_11989412 3300026095 Unclassified 580
180 Ga0207674_10062753 3300026116 Bacteria 3753
181 Ga0207675_100846099 3300026118 Bacteria 930
182 Ga0207683_10678394 3300026121 Unclassified 955
183 Ga0207683_11947024 3300026121 Unclassified 536
184 Ga0207698_11162452 3300026142 Unclassified 785
185 Ga0207698_11335077 3300026142 Unclassified 732
186 Ga0209813_10088522 3300027866 Bacteria 1035
187 Ga0207428_10000008 3300027907 Bacteria 423201
188 Ga0268265_10913227 3300028380 Unclassified 863
189 Ga0268265_11339028 3300028380 Unclassified 717
190 Ga0307513_10000028 3300031456 Bacteria 193264
191 Ga0373929_0190308 3300035085 Unclassified 570
192 Ga0373940_0157488 3300035088 Unclassified 727
193 Ga0373941_0024987 3300035115 Bacteria 1721
194 Ga0451839_1461408 3300041496 Bacteria 568
195 Ga0439446_0209668 3300042156 Unclassified 660
196 Ga0451577_0108863 3300042876 Bacteria 2477
197 Ga0453683_0941585 3300044673 Bacteria 572
198 Ga0453684_0082370 3300044712 Bacteria 4008
199 Ga0495620_0001189 3300046515 Bacteria 15934
200 Ga0495620_0128811 3300046515 Unclassified 994
201 Ga0495631_0480330 3300046518 Unclassified 529
202 nmdc:mga0k408_275367_c1 3300050493 Bacteria 1004
203 nmdc:mga04h51_83098_c1 3300050495 Bacteria 1140
204 nmdc:mga07m45_317830_c1 3300050496 Bacteria 905
205 nmdc:mga05p37_181743_c1 3300050507 Unclassified 2558
206 nmdc:mga05p37_1983483_c1 3300050507 Unclassified 551
207 nmdc:mga05p37_2181681_c1 3300050507 Unclassified 515
208 nmdc:mga05p37_409543_c2 3300050507 Unclassified 1051
209 nmdc:mga05p37_430773_c1 3300050507 Bacteria 1532
210 nmdc:mga05p37_8104_c1 3300050507 Bacteria 12416
211 nmdc:mga09592_251645_c1 3300050508 Bacteria 1531
212 nmdc:mga09592_411680_c1 3300050508 Unclassified 1168
213 nmdc:mga09592_5816_c1 3300050508 Bacteria 10056
214 nmdc:mga0qj67_400345_c1 3300050509 Unclassified 1108
215 nmdc:mga06r32_1389815_c1 3300050510 Bacteria 644
216 nmdc:mga06r32_14927_c1 3300050510 Bacteria 7051
217 nmdc:mga06r32_17698_c1 3300050510 Bacteria 6510
218 nmdc:mga06r32_468874_c1 3300050510 Bacteria 1238
219 nmdc:mga08y16_13_c2 3300050511 Bacteria 418063
220 nmdc:mga08y16_1844996_c1 3300050511 Bacteria 557
221 nmdc:mga0n895_261799_c1 3300050512 Bacteria 1755
222 nmdc:mga0n895_740782_c1 3300050512 Bacteria 976
223 nmdc:mga0n895_843125_c1 3300050512 Bacteria 905
224 nmdc:mga0rr50_288083_c1 3300050513 Bacteria 1372
225 nmdc:mga0rr50_874934_c1 3300050513 Unclassified 766
226 nmdc:mga0a205_1299598_c1 3300050515 Bacteria 575
227 Ga0070674_100036969
228 Ga0065712_10435642
229 Ga0065715_10346786
230 Ga0070683_100833700
231 Ga0070683_101929452
232 Ga0070670_100159380
233 Ga0070670_100514299
234 Ga0070677_10007044
235 Ga0068869_100907289
236 Ga0070680_100041881
237 Ga0070682_100000035
238 Ga0070682_101346455
239 Ga0068868_100246179
240 Ga0070689_100323310
241 Ga0070687_100028218
242 Ga0070692_10000563
243 Ga0070692_10144259
244 Ga0070669_101949226
245 Ga0070675_100000004
246 Ga0070705_100187027
247 Ga0070700_100000016
248 Ga0070708_100069039
249 Ga0070678_101157915
250 Ga0070678_102092759
251 Ga0068867_101365096
252 Ga0068867_101714761
253 Ga0070706_100102191
254 Ga0070706_100354850
255 Ga0070706_100464650
256 Ga0070706_100702988
257 Ga0070706_100932002
258 Ga0070707_100420619
259 Ga0070707_100558726
260 Ga0070707_100755314
261 Ga0070698_100188991
262 Ga0070698_100210094
263 Ga0070699_100056552
264 Ga0070699_100700352
265 Ga0070699_101440547
266 Ga0070684_100554507
267 Ga0070697_100366748
268 Ga0070697_101191954
269 Ga0070697_101386092
270 Ga0070672_100069667
271 Ga0070686_100101263
272 Ga0070686_100710536
273 Ga0070696_100226217
274 Ga0070696_100403455
275 Ga0070693_100980712
276 Ga0070704_100488605
277 Ga0068857_100185545
278 Ga0070702_100393166
279 Ga0070702_100962327
280 Ga0068852_100939956
281 Ga0068852_101973181
282 Ga0068859_102229765
283 Ga0068864_100000046
284 Ga0068861_100816074
285 Ga0068861_100872920
286 Ga0068861_101840545
287 Ga0068870_10061496
288 Ga0068870_10392023
289 Ga0068870_10729324
290 Ga0068858_100572821
291 Ga0068858_101520464
292 Ga0068858_101664191
293 Ga0068858_102527298
294 Ga0068860_100499952
295 Ga0068860_102464740
296 Ga0075368_10132879
297 Ga0075364_11104871
298 Ga0075362_10412438
299 Ga0075367_10069198
300 Ga0075366_10761295
301 Ga0075370_10228552
302 Ga0075428_100094823
303 Ga0075428_100125823
304 Ga0075428_100416320
305 Ga0075428_101300117
306 Ga0075431_100001385
307 Ga0075431_100049567
308 Ga0075431_100132948
309 Ga0075431_100164912
310 Ga0075433_10855420
311 Ga0075433_11861220
312 Ga0075434_100063106
313 Ga0075434_101432196
314 Ga0075434_102282923
315 Ga0075429_100005690
316 Ga0075429_100245455
317 Ga0075429_100862993
318 Ga0097620_100000048
319 Ga0097620_102231047
320 Ga0075435_100136689
321 Ga0075435_100439253
322 Ga0075435_100457702
323 Ga0099794_10551124
324 Ga0105244_10029421
325 Ga0111539_10000007
326 Ga0111539_12142409
327 Ga0111539_12869839
328 Ga0105245_10021973
329 Ga0105245_10056796
330 Ga0105245_10895225
331 Ga0105245_11925915
332 Ga0105245_12433698
333 Ga0105247_10033541
334 Ga0114129_10004140
335 Ga0114129_10137508
336 Ga0114129_10238635
337 Ga0114129_10606817
338 Ga0114129_10762122
339 Ga0114129_12357940
340 Ga0114129_13096341
341 Ga0105243_10782118
342 Ga0105242_10001216
343 Ga0105242_10422591
344 Ga0105242_10934989
345 Ga0105242_11494465
346 Ga0105249_10961595
347 Ga0105239_10624857
348 Ga0105246_10407474
349 Ga0105246_10727914
350 Ga0157374_10515989
351 Ga0157378_10321544
352 Ga0157378_11029627
353 Ga0157378_12281394
354 Ga0157378_12369070
355 Ga0163162_10796363
356 Ga0163163_10018985
357 Ga0163163_10788250
358 Ga0163163_11058615
359 Ga0163163_11420422
360 Ga0157380_10016766
361 Ga0157380_10207224
362 Ga0157377_10441237
363 Ga0157379_11809275
364 Ga0157376_11695501
365 Ga0207655_1026824
366 Ga0207682_10037396
367 Ga0207710_10025217
368 Ga0207645_10462300
369 Ga0207645_10650960
370 Ga0207643_10069550
371 Ga0207684_10070050
372 Ga0207684_10351065
373 Ga0207684_10430572
374 Ga0207684_10595402
375 Ga0207660_10016758
376 Ga0207662_10021754
377 Ga0207646_10004242
378 Ga0207646_10843941
379 Ga0207646_11730207
380 Ga0207650_10062386
381 Ga0207659_10000002
382 Ga0207687_10002824
383 Ga0207687_11486277
384 Ga0207687_11922252
385 Ga0207687_11945202
386 Ga0207686_10237969
387 Ga0207686_11113699
388 Ga0207709_11245551
389 Ga0207670_10016762
390 Ga0207670_10595029
391 Ga0207669_10688349
392 Ga0207691_10083533
393 Ga0207689_10102961
394 Ga0207661_10946280
395 Ga0207712_10571853
396 Ga0207677_10113121
397 Ga0207677_10626163
398 Ga0207677_11950425
399 Ga0207703_11312232
400 Ga0207703_11411400
401 Ga0207703_11891005
402 Ga0207708_10000005
403 Ga0207648_10738569
404 Ga0207648_11099817
405 Ga0207676_11989412
406 Ga0207674_10062753
407 Ga0207675_100846099
408 Ga0207683_10678394
409 Ga0207683_11947024
410 Ga0207698_11162452
411 Ga0207698_11335077
412 Ga0209813_10088522
413 Ga0207428_10000008
414 Ga0268265_10913227
415 Ga0268265_11339028
416 Ga0307513_10000028
417 Ga0373929_0190308
418 Ga0373940_0157488
419 Ga0373941_0024987
420 Ga0451839_1461408
421 Ga0439446_0209668
422 Ga0451577_0108863
423 Ga0453683_0941585
424 Ga0453684_0082370
425 Ga0495620_0001189
426 Ga0495620_0128811
427 Ga0495631_0480330
428 nmdc:mga0k408_275367_c1
429 nmdc:mga04h51_83098_c1
430 nmdc:mga07m45_317830_c1
431 nmdc:mga05p37_181743_c1
432 nmdc:mga05p37_1983483_c1
433 nmdc:mga05p37_2181681_c1
434 nmdc:mga05p37_409543_c2
435 nmdc:mga05p37_430773_c1
436 nmdc:mga05p37_8104_c1
437 nmdc:mga09592_251645_c1
438 nmdc:mga09592_411680_c1
439 nmdc:mga09592_5816_c1
440 nmdc:mga0qj67_400345_c1
441 nmdc:mga06r32_1389815_c1
442 nmdc:mga06r32_14927_c1
443 nmdc:mga06r32_17698_c1
444 nmdc:mga06r32_468874_c1
445 nmdc:mga08y16_13_c2
446 nmdc:mga08y16_1844996_c1
447 nmdc:mga0n895_261799_c1
448 nmdc:mga0n895_740782_c1
449 nmdc:mga0n895_843125_c1
450 nmdc:mga0rr50_288083_c1
451 nmdc:mga0rr50_874934_c1
452 nmdc:mga0a205_1299598_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map