F338408

General Info

Members Datasets Scaffolds Average Seq Length
226 192 82 367

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10000006|JGI25151J46595_10000006417
Length 373
Sequence LAKTVNGHEIIQLFEQFSPKAYAMEGDKIGLQIGTLNKKVSNVMITLDVLENVVDEAIERKVDLIIAHHPPIFRPLKHVATDQPAGRIIEKCIKHDIAVYVAHTNLDVADGGVNDLLAEALELEETSVLVPTYEDPIKQLALYVPEEFEEAIRTALGNAGAGHIGNYSHCAFSNEGTGSFLPSEEAKPFIGESGQLEFVKEVRIETIFPANIEKQVIRDMIKAHPYEEVAYSVHTTDLPPIQKGLGRIGELNEPMTLRDFTQFVKTKLDVNGARFVGDQDAVVKKVAVLGGDGNKYIHQAKRMGADVYVTGDLYFHVAHDAMMLGLNVVDPGHYAEKIMKEGVKAKLQSLCADKKYDVQLFVSESNTNPFQFM

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
4 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
5 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
6 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
7 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
8 2554235283 Bacillus safensis VK Isolate Rhizosphere
9 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
10 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
11 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
12 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
13 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
14 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
15 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
16 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
17 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
18 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
19 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
20 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
21 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
22 2643221735 Bacillus sp. Root920 Isolate Unclassified
23 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
24 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
25 2671180694 Paenibacillus sp. A3 Isolate Unclassified
26 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
27 2684622632 Bacillus cereus 905 Isolate Unclassified
28 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
29 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
30 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
31 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
32 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
33 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
34 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
35 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
36 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
37 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
38 2738541295 Bacillus sp. OK085 Isolate Unclassified
39 2738543010 Bacillus sp. YR335 Isolate Unclassified
40 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
41 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
42 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
43 2811994870 Bacillus sp. JB4 Isolate Unclassified
44 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
45 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
46 2818991441 Niallia circulans 3243 Isolate Rhizosphere
47 2818991459 Paenibacillus sp. 597 Isolate Unclassified
48 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
49 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
50 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
51 2842682962 Bacillus sp. R-72492 Isolate Unclassified
52 2849139964 Bacillus sp. R-71875 Isolate Unclassified
53 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
54 2857472729 Cohnella sp. R-74144 Isolate Unclassified
55 2857581216 Bacillus sp. R-71922 Isolate Unclassified
56 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
57 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
58 2860837431 Bacillus sp. WR11 Isolate Unclassified
59 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
60 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
61 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
62 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
63 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
64 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
65 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
66 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
67 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
68 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
69 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
70 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
71 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
72 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
73 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
74 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
75 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
76 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
77 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
78 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
79 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
80 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
81 2919726948 Bacillus pumilus 4489 Isolate Unclassified
82 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
83 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
84 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
85 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
86 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
87 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
88 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
89 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
90 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
91 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
92 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
93 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
94 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
95 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
96 2965761152 Bacillus sp. COPE52 Isolate Unclassified
97 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
98 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
99 2969141011 Bacillus velezensis MH25 Isolate Unclassified
100 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
101 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
102 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
103 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
104 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
105 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
106 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
107 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
108 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
109 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
110 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
111 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
112 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
113 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
114 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
115 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
116 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
117 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
118 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
119 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
120 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
121 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
122 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
123 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
124 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
125 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
126 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
127 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
128 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
129 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
130 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
131 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
132 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
146 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
178 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
179 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
180 8022653035 Bacillus sp. Rc4 Isolate Unclassified
181 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
182 8023438354 Bacillus sp. BH2 Isolate Unclassified
183 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
184 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
185 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
186 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
187 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
188 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
189 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
190 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
191 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
192 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 35.84
Metatranscriptomes 0.44
Isolates 63.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.88
Bulb 0
Endosphere 11.06
Nodule 0.44
Rhizoplane 1.33
Rhizosphere 47.79
Stem 0
Stem Tuber 0
Unclassified 38.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000006 3300003187 Bacteria 419711
2 JGI25151J46595_10006293 3300003187 Bacteria 5994
3 JGI25151J46595_10009728 3300003187 Bacteria 4529
4 JGI25151J46595_10042765 3300003187 Bacteria 1628
5 JGI25151J46595_10047119 3300003187 Bacteria 1503
6 Ga0006562J51391_1001146 3300003578 Bacteria 47560
7 Ga0055538_1000091 3300003751 Bacteria 77577
8 Ga0055541_1000095 3300003841 Bacteria 74451
9 Ga0055541_1002495 3300003841 Bacteria 3659
10 Ga0105244_10004134 3300009036 Bacteria 10108
11 Ga0105244_10083809 3300009036 Bacteria 1575
12 Ga0105246_10001648 3300011119 Bacteria 13310
13 Ga0105246_10010207 3300011119 Bacteria 5800
14 Ga0157371_10002286 3300013102 Bacteria 18467
15 Ga0209784_100135 3300025224 Bacteria 70506
16 Ga0209566_100058 3300025225 Bacteria 201317
17 Ga0209566_100248 3300025225 Bacteria 51716
18 Ga0209566_100418 3300025225 Bacteria 33095
19 Ga0209147_100519 3300025229 Bacteria 22359
20 Ga0209147_105607 3300025229 Bacteria 1853
21 Ga0209437_100771 3300025233 Bacteria 15225
22 Ga0209258_100797 3300025242 Bacteria 18622
23 Ga0209130_1003094 3300025284 Bacteria 7440
24 Ga0209130_1017401 3300025284 Bacteria 1713
25 Ga0209025_1000001 3300025294 Bacteria 1888151
26 Ga0209025_1014394 3300025294 Bacteria 4867
27 Ga0209025_1030187 3300025294 Bacteria 2601
28 Ga0209025_1033931 3300025294 Bacteria 2345
29 Ga0209025_1046228 3300025294 Bacteria 1793
30 Ga0209025_1049807 3300025294 Bacteria 1681
31 Ga0209025_1050163 3300025294 Bacteria 1671
32 Ga0207696_1020592 3300025711 Bacteria 2124
33 Ga0209371_1007732 3300027312 Bacteria 3686
34 Ga0237817_10022 3300030083 Bacteria 62837
35 Ga0268256_1007979 3300030500 Bacteria 3686
36 Ga0307408_100081784 3300031548 Bacteria 2415
37 Ga0307409_100143148 3300031995 Bacteria 2063
38 Ga0395899_0082873 3300037312 Bacteria 2332
39 Ga0395899_0124803 3300037312 Bacteria 1841
40 Ga0395898_0527185 3300037466 Bacteria 1123
41 Ga0237819_00963 3300038705 Bacteria 8756
42 Ga0451577_0070623 3300042876 Unclassified 3114
43 Ga0453683_0008755 3300044673 Bacteria 6785
44 Ga0466965_0092638 3300044683 Bacteria 1539
45 Ga0453684_0000295 3300044712 Bacteria 211570
46 Ga0466957_0109427 3300044842 Bacteria 1751
47 Ga0466959_0007024 3300045049 Bacteria 7870
48 Ga0451576_0000359 3300045051 Bacteria 109461
49 Ga0466967_0000025 3300045976 Bacteria 65709
50 Ga0466967_0193531 3300045976 Bacteria 1923
51 Ga0495637_0026543 3300046520 Bacteria 2598
52 Ga0495622_0009611 3300046557 Bacteria 4472
53 Ga0495589_0048798 3300046794 Bacteria 2095
54 Ga0495660_0011994 3300046810 Bacteria 5027
55 Ga0495681_0074992 3300047470 Bacteria 1524
56 Ga0496110_0001645 3300048913 Bacteria 16401
57 Ga0496112_0190921 3300048915 Bacteria 2010
58 Ga0496116_0001047 3300048919 Bacteria 33684
59 Ga0496116_0006764 3300048919 Bacteria 10318
60 Ga0496116_0006815 3300048919 Bacteria 10272
61 Ga0496116_0051390 3300048919 Bacteria 2738
62 Ga0496117_0005237 3300048920 Bacteria 13763
63 Ga0496117_0022573 3300048920 Bacteria 5044
64 Ga0496119_0001346 3300048922 Bacteria 30073
65 Ga0496119_0013102 3300048922 Bacteria 6644
66 Ga0496120_0000844 3300048923 Bacteria 43532
67 Ga0496120_0008726 3300048923 Bacteria 7296
68 Ga0496120_0010719 3300048923 Bacteria 6360
69 Ga0496121_0057103 3300048924 Bacteria 3237
70 Ga0496121_0117232 3300048924 Bacteria 2018
71 Ga0496121_0195411 3300048924 Bacteria 1446
72 Ga0496121_0215325 3300048924 Bacteria 1357
73 Ga0496122_0008235 3300048925 Bacteria 11318
74 Ga0496122_0035869 3300048925 Bacteria 4024
75 Ga0496122_0074250 3300048925 Bacteria 2407
76 Ga0496123_0107566 3300048926 Bacteria 1604
77 Ga0496124_0000358 3300048927 Bacteria 83124
78 Ga0496125_0002304 3300048928 Bacteria 25187
79 Ga0496125_0020646 3300048928 Bacteria 6177
80 Ga0496126_0002566 3300048929 Bacteria 24293
81 Ga0496126_0003808 3300048929 Bacteria 18708
82 Ga0496126_0004000 3300048929 Bacteria 17985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0070623 Ga0451577_0070623_593_1603 328
2 3300044673 Ga0453683_0008755 Ga0453683_0008755_4650_5660 328
3 3300044712 Ga0453684_0000295 Ga0453684_0000295_58707_59717 328
4 3300045051 Ga0451576_0000359 Ga0451576_0000359_58726_59736 328
5 3300037466 Ga0395898_0527185 Ga0395898_0527185_89_1078 329
6 3300003187 JGI25151J46595_10006293 JGI25151J46595_100062933 350
7 3300003187 JGI25151J46595_10009728 JGI25151J46595_100097283 350
8 3300011119 Ga0105246_10001648 Ga0105246_1000164813 350
9 3300044842 Ga0466957_0109427 Ga0466957_0109427_430_1482 350
10 3300025242 Ga0209258_100797 Ga0209258_10079714 358
11 3300025294 Ga0209025_1050163 Ga0209025_10501631 358
12 3300046520 Ga0495637_0026543 Ga0495637_0026543_207_1289 360
13 3300046810 Ga0495660_0011994 Ga0495660_0011994_3089_4171 360
14 3300047470 Ga0495681_0074992 Ga0495681_0074992_157_1239 360
15 3300044683 Ga0466965_0092638 Ga0466965_0092638_435_1520 361
16 3300003841 Ga0055541_1000095 Ga0055541_100009539 365
17 3300025225 Ga0209566_100058 Ga0209566_10005888 365
18 iso_pu_bacteria 2585428059 2587737773 365
19 iso_pu_bacteria 2643221676 2644423141 365
20 iso_pu_bacteria 2818991459 2819670565 365
21 iso_pu_bacteria 2857453340 2857459328 365
22 iso_pu_bacteria 2889049205 2889052026 365
23 iso_pu_bacteria 2904755435 2904760053 365
24 iso_pu_bacteria 2919425241 2919427119 365
25 iso_pu_bacteria 2971410472 2971417330 365
26 iso_pu_bacteria 8056533031 8056540036 365
27 3300031548 Ga0307408_100081784 Ga0307408_1000817842 366
28 3300031995 Ga0307409_100143148 Ga0307409_1001431481 366
29 iso_pu_bacteria 2512564039 2512734999 367
30 iso_pu_bacteria 2524023129 2524186606 367
31 iso_pu_bacteria 2548877040 2550902470 367
32 iso_pu_bacteria 2563366752 2563926947 367
33 iso_pu_bacteria 2571042143 2571530852 367
34 iso_pu_bacteria 2571042588 2573040789 367
35 iso_pu_bacteria 2576861424 2578338045 367
36 iso_pu_bacteria 2579778775 2580934198 367
37 iso_pu_bacteria 2593339198 2595316427 367
38 iso_pu_bacteria 2600255286 2601639152 367
39 iso_pu_bacteria 2619619294 2621276427 367
40 iso_pu_bacteria 2643221543 2643737977 367
41 iso_pu_bacteria 2671180694 2673817028 367
42 iso_pu_bacteria 2721755693 2723605017 367
43 iso_pu_bacteria 2728368933 2728534196 367
44 iso_pu_bacteria 2728369359 2730135662 367
45 iso_pu_bacteria 2738541295 2738813896 367
46 iso_pu_bacteria 2751185905 2753810937 367
47 iso_pu_bacteria 2802428803 2802437332 367
48 iso_pu_bacteria 2818991441 2819569297 367
49 iso_pu_bacteria 2821111986 2821114728 367
50 iso_pu_bacteria 2857472729 2857473431 367
51 iso_pu_bacteria 2864733723 2864735332 367
52 iso_pu_bacteria 2864997549 2864999983 367
53 iso_pu_bacteria 2881636855 2881640972 367
54 iso_pu_bacteria 2885526491 2885527915 367
55 iso_pu_bacteria 2889042446 2889046887 367
56 iso_pu_bacteria 2889276214 2889280929 367
57 iso_pu_bacteria 2889295896 2889296098 367
58 iso_pu_bacteria 2904162308 2904163141 367
59 iso_pu_bacteria 2904490793 2904493791 367
60 iso_pu_bacteria 2904595352 2904598290 367
61 iso_pu_bacteria 2907202186 2907205822 367
62 iso_pu_bacteria 2919160200 2919162871 367
63 iso_pu_bacteria 2919414237 2919417177 367
64 iso_pu_bacteria 2929206907 2929210631 367
65 iso_pu_bacteria 2931384279 2931390334 367
66 iso_pu_bacteria 2936361878 2936367396 367
67 iso_pu_bacteria 2938649242 2938650238 367
68 iso_pu_bacteria 2939679117 2939679647 367
69 iso_pu_bacteria 2939702853 2939704683 367
70 iso_pu_bacteria 2945991243 2945997442 367
71 iso_pu_bacteria 2946053406 2946053653 367
72 iso_pu_bacteria 2968558590 2968564097 367
73 iso_pu_bacteria 2971403814 2971407291 367
74 iso_pu_bacteria 2971511577 2971512649 367
75 iso_pu_bacteria 2977254563 2977256568 367
76 iso_pu_bacteria 2980125574 2980125851 367
77 iso_pu_bacteria 2980176882 2980177640 367
78 iso_pu_bacteria 2981284811 2981287841 367
79 iso_pu_bacteria 2981289755 2981292447 367
80 iso_pu_bacteria 2981980479 2981983460 367
81 iso_pu_bacteria 2981985349 2981988503 367
82 iso_pu_bacteria 2984527788 2984530370 367
83 iso_pu_bacteria 2984532647 2984536478 367
84 iso_pu_bacteria 2988225383 2988228881 367
85 iso_pu_bacteria 2996632988 2996636025 367
86 iso_pu_bacteria 2996706504 2996710677 367
87 iso_pu_bacteria 3001892409 3001897763 367
88 iso_pu_bacteria 3006978542 3006981856 367
89 iso_pu_bacteria 648028048 648171085 367
90 iso_pu_bacteria 8002317523 8002321988 367
91 iso_pu_bacteria 8046991243 8046997561 367
92 iso_pu_bacteria 8054465665 8054470252 367
93 iso_pu_bacteria 8054795415 8054804790 367
94 iso_pu_bacteria 8055632911 8055635175 367
95 iso_pu_bacteria 8057473075 8057477162 367
96 iso_pu_bacteria 8057632132 8057635460 367
97 iso_pu_bacteria 8057733483 8057737583 367
98 iso_pu_bacteria 2671180330 2672337005 368
99 iso_pu_bacteria 2738543010 2739230127 368
100 iso_pu_bacteria 2816332186 2816862571 368
101 iso_pu_bacteria 2842682962 2842684512 368
102 iso_pu_bacteria 2849139964 2849142534 368
103 iso_pu_bacteria 2857581216 2857585713 368
104 iso_pu_bacteria 2857604169 2857606340 368
105 iso_pu_bacteria 2857609550 2857610776 368
106 iso_pu_bacteria 3006826541 3006831586 368
107 iso_pu_bacteria 3006973921 3006975955 368
108 iso_pu_bacteria 3006984091 3006984531 368
109 iso_pu_bacteria 3006988479 3006988949 368
110 3300025225 Ga0209566_100248 Ga0209566_10024836 369
111 3300048913 Ga0496110_0001645 Ga0496110_0001645_2005_3114 369
112 iso_pu_bacteria 2511231119 2511700308 369
113 iso_pu_bacteria 2540341094 2540607451 369
114 iso_pu_bacteria 2545555800 2545556990 369
115 iso_pu_bacteria 2551306519 2553393339 369
116 iso_pu_bacteria 2554235283 2555467698 369
117 iso_pu_bacteria 2576861599 2578931246 369
118 iso_pu_bacteria 2630968484 2631985405 369
119 iso_pu_bacteria 2643221735 2644740863 369
120 iso_pu_bacteria 2648501850 2651531814 369
121 iso_pu_bacteria 2671180844 2674418880 369
122 iso_pu_bacteria 2684622632 2685152263 369
123 iso_pu_bacteria 2684623153 2686997520 369
124 iso_pu_bacteria 2687453109 2687498827 369
125 iso_pu_bacteria 2695420354 2695628286 369
126 iso_pu_bacteria 2695420987 2698320899 369
127 iso_pu_bacteria 2703719227 2705996203 369
128 iso_pu_bacteria 2716884898 2717916011 369
129 iso_pu_bacteria 2718218445 2721507423 369
130 iso_pu_bacteria 2808606399 2809055863 369
131 iso_pu_bacteria 2811994870 2812316715 369
132 iso_pu_bacteria 2816332295 2817480799 369
133 iso_pu_bacteria 2818991468 2819723775 369
134 iso_pu_bacteria 2823526263 2823528697 369
135 iso_pu_bacteria 2860837431 2860840144 369
136 iso_pu_bacteria 2877768649 2877771192 369
137 iso_pu_bacteria 2880169592 2880172056 369
138 iso_pu_bacteria 2897109615 2897112269 369
139 iso_pu_bacteria 2904560550 2904562146 369
140 iso_pu_bacteria 2908665501 2908668101 369
141 iso_pu_bacteria 2919093281 2919095869 369
142 iso_pu_bacteria 2919726948 2919728411 369
143 iso_pu_bacteria 2929233124 2929237964 369
144 iso_pu_bacteria 2947426588 2947431049 369
145 iso_pu_bacteria 2954773129 2954773784 369
146 iso_pu_bacteria 2956897341 2956902075 369
147 iso_pu_bacteria 2962290636 2962293422 369
148 iso_pu_bacteria 2964375228 2964378256 369
149 iso_pu_bacteria 2965761152 2965765578 369
150 iso_pu_bacteria 2969136845 2969139430 369
151 iso_pu_bacteria 2969141011 2969143639 369
152 iso_pu_bacteria 2969765954 2969767399 369
153 iso_pu_bacteria 2969770375 2969773288 369
154 iso_pu_bacteria 2971893375 2971895838 369
155 iso_pu_bacteria 2979083700 2979087951 369
156 iso_pu_bacteria 2980492589 2980495185 369
157 iso_pu_bacteria 3006858327 3006861158 369
158 iso_pu_bacteria 3006879489 3006881650 369
159 iso_pu_bacteria 8022630665 8022631933 369
160 iso_pu_bacteria 8022653035 8022654311 369
161 iso_pu_bacteria 8022948649 8022949860 369
162 iso_pu_bacteria 8023438354 8023443111 369
163 iso_pu_bacteria 8051952484 8051955235 369
164 iso_pu_bacteria 8052174270 8052176115 369
165 iso_pu_bacteria 2980182181 2980184385 370
166 3300003751 Ga0055538_1000091 Ga0055538_100009164 371
167 3300003841 Ga0055541_1002495 Ga0055541_10024953 371
168 3300009036 Ga0105244_10004134 Ga0105244_100041348 371
169 3300009036 Ga0105244_10083809 Ga0105244_100838091 371
170 3300011119 Ga0105246_10010207 Ga0105246_100102074 371
171 3300025224 Ga0209784_100135 Ga0209784_10013512 371
172 3300025225 Ga0209566_100418 Ga0209566_10041832 371
173 3300025233 Ga0209437_100771 Ga0209437_1007718 371
174 3300025294 Ga0209025_1014394 Ga0209025_10143943 371
175 3300027312 Ga0209371_1007732 Ga0209371_10077323 371
176 3300030500 Ga0268256_1007979 Ga0268256_10079792 371
177 3300037312 Ga0395899_0082873 Ga0395899_0082873_740_1855 371
178 3300037312 Ga0395899_0124803 Ga0395899_0124803_195_1310 371
179 3300045049 Ga0466959_0007024 Ga0466959_0007024_316_1431 371
180 3300045976 Ga0466967_0193531 Ga0466967_0193531_137_1252 371
181 3300046557 Ga0495622_0009611 Ga0495622_0009611_606_1721 371
182 3300046794 Ga0495589_0048798 Ga0495589_0048798_367_1482 371
183 3300048919 Ga0496116_0001047 Ga0496116_0001047_9785_10900 371
184 3300048919 Ga0496116_0006764 Ga0496116_0006764_4562_5677 371
185 3300048919 Ga0496116_0006815 Ga0496116_0006815_8492_9607 371
186 3300048919 Ga0496116_0051390 Ga0496116_0051390_1243_2358 371
187 3300048920 Ga0496117_0005237 Ga0496117_0005237_6681_7796 371
188 3300048920 Ga0496117_0022573 Ga0496117_0022573_57_1172 371
189 3300048922 Ga0496119_0001346 Ga0496119_0001346_21752_22867 371
190 3300048922 Ga0496119_0013102 Ga0496119_0013102_2122_3237 371
191 3300048923 Ga0496120_0000844 Ga0496120_0000844_34277_35392 371
192 3300048923 Ga0496120_0008726 Ga0496120_0008726_1415_2530 371
193 3300048923 Ga0496120_0010719 Ga0496120_0010719_18_1133 371
194 3300048924 Ga0496121_0057103 Ga0496121_0057103_1947_3062 371
195 3300048924 Ga0496121_0117232 Ga0496121_0117232_603_1718 371
196 3300048924 Ga0496121_0195411 Ga0496121_0195411_165_1280 371
197 3300048924 Ga0496121_0215325 Ga0496121_0215325_77_1192 371
198 3300048925 Ga0496122_0008235 Ga0496122_0008235_9301_10416 371
199 3300048925 Ga0496122_0035869 Ga0496122_0035869_828_1943 371
200 3300048925 Ga0496122_0074250 Ga0496122_0074250_69_1184 371
201 3300048926 Ga0496123_0107566 Ga0496123_0107566_262_1377 371
202 3300048927 Ga0496124_0000358 Ga0496124_0000358_26315_27430 371
203 3300048928 Ga0496125_0002304 Ga0496125_0002304_3394_4509 371
204 3300048928 Ga0496125_0020646 Ga0496125_0020646_401_1516 371
205 3300048929 Ga0496126_0002566 Ga0496126_0002566_15431_16546 371
206 3300048929 Ga0496126_0003808 Ga0496126_0003808_7780_8895 371
207 3300048929 Ga0496126_0004000 Ga0496126_0004000_4821_5936 371
208 3300013102 Ga0157371_10002286 Ga0157371_1000228610 372
209 3300048915 Ga0496112_0190921 Ga0496112_0190921_396_1514 372
210 3300003187 JGI25151J46595_10000006 JGI25151J46595_10000006417 373
211 3300003187 JGI25151J46595_10042765 JGI25151J46595_100427651 373
212 3300003187 JGI25151J46595_10047119 JGI25151J46595_100471192 373
213 3300003578 Ga0006562J51391_1001146 Ga0006562J51391_100114639 373
214 3300025229 Ga0209147_100519 Ga0209147_10051917 373
215 3300025229 Ga0209147_105607 Ga0209147_1056071 373
216 3300025284 Ga0209130_1003094 Ga0209130_10030944 373
217 3300025284 Ga0209130_1017401 Ga0209130_10174012 373
218 3300025294 Ga0209025_1000001 Ga0209025_1000001580 373
219 3300025294 Ga0209025_1030187 Ga0209025_10301873 373
220 3300025294 Ga0209025_1033931 Ga0209025_10339313 373
221 3300025294 Ga0209025_1046228 Ga0209025_10462281 373
222 3300025294 Ga0209025_1049807 Ga0209025_10498072 373
223 3300025711 Ga0207696_1020592 Ga0207696_10205922 373
224 3300030083 Ga0237817_10022 Ga0237817_100226 373
225 3300038705 Ga0237819_00963 Ga0237819_00963_5996_7117 373
226 3300045976 Ga0466967_0000025 Ga0466967_0000025_4122_5243 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01784

DUF34_NIF3

Duf34/NIF3 (NGG1p interacting factor 3)

9

355

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fyw-assembly1.cif.gz_A crystal structure of a conserved protein of unknown function from streptococcus pneumoniae 0.9368 3 373
2fyw-assembly1.cif.gz_A crystal structure of a conserved protein of unknown function from streptococcus pneumoniae 0.9334 3 373
2gx8-assembly1.cif.gz_C-2 the crystal structure of bacillus cereus protein related to nif3 0.928 2 373
2gx8-assembly1.cif.gz_C-2 the crystal structure of bacillus cereus protein related to nif3 0.9255 2 373
2gx8-assembly1.cif.gz_B the crystal structure of bacillus cereus protein related to nif3 0.8769 2 373
ID Description Score Start End Superfamily
af_Q54BW8_1_102_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9617 138 238 3.30.70.120
af_Q2FY14_1_121_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.955 5 125 3.40.1390.30
af_P9WFM1_132_234_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9545 136 236 3.30.70.120
af_Q58337_3_98_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.9542 8 103 3.40.1390.30
af_Q4V7D6_21_147_3.40.1390.30 Alpha Beta;3-Layer(aba) Sandwich;Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1;NIF3 (NGG1p interacting factor 3)-like 0.9481 4 122 3.40.1390.30
ID Description Score Start End GO Terms
AF-A0A6G2CK87-F1-model_v4 deleted 0.9755 3 133
AF-A0A0G1ZQ96-F1-model_v4 Uncharacterized protein 0.9713 136 236
AF-A0A1F6EWS2-F1-model_v4 NGG1p interacting factor NIF3 0.97 138 237
AF-G6EQ57-F1-model_v4 deleted 0.9688 7 103
AF-A0A847KK77-F1-model_v4 NGG1p interacting factor NIF3 0.9686 138 236

Feature Viewer

pLDDT pTM Quality
94.07 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map