F338405

General Info

Members Datasets Scaffolds Average Seq Length
226 161 452 212

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1000483|JGI25159J45721_10004835
Length 245
Sequence MSAVDRAGIRMSRKCHGPAASGLNLRFLAYASGMYQPPQFKGDSEQAAALMTEHPFASLISVDDAGLPYVTHLPLHLEMRGEQMVLLGHVAKPNPHWRYLQARPQAVATFLGPHAYLSPKVYPDLARVPTWNYLAVHCTVQATLIEDPLAKDRLLKKLIGDHEPPFAQQWRDQGEEFAHKMLAGIVGFELQVTELQCKLKINQHRREAHAAMKTIYAAGNENERALAGWMDRLGMAAGNDTPKEA

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
46 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
47 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
96 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
97 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
98 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
99 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
148 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
149 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
150 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
151 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
152 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
153 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
156 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
157 2738541277 Variovorax sp. GV051 Isolate Unclassified
158 2738541307 Variovorax sp. GV008 Isolate Unclassified
159 2738543013 Variovorax sp. BT01 Isolate Unclassified
160 2738543019 Variovorax sp. GV040 Isolate Unclassified
161 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 0
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 40.27
Nodule 0.44
Rhizoplane 1.77
Rhizosphere 48.23
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000483 3300002987 Bacteria 18314
2 JGI25155J39150_1000169 3300002704 Bacteria 28485
3 JGI25156J39149_1000373 3300002705 Bacteria 28718
4 JGI25154J39366_1000126 3300002738 Bacteria 61290
5 JGI25157J39369_1000138 3300002741 Bacteria 61290
6 JGI25150J39212_1014549 3300002774 Bacteria 1335
7 JGI25159J45721_1003601 3300002987 Bacteria 5413
8 JGI25151J46595_10004540 3300003187 Bacteria 7323
9 JGI25151J46595_10006561 3300003187 Bacteria 5829
10 JGI25160J50197_1000251 3300003354 Bacteria 41224
11 JGI25160J50197_1027250 3300003354 Bacteria 1560
12 JGI25161J50226_1000070 3300003374 Bacteria 89592
13 Ga0055526_1002825 3300003771 Bacteria 11490
14 Ga0055526_1003191 3300003771 Bacteria 10612
15 Ga0055537_1000116 3300003773 Bacteria 60232
16 Ga0055524_1000016 3300003775 Bacteria 244926
17 Ga0055536_1026586 3300003781 Bacteria 1619
18 Ga0055536_1051807 3300003781 Bacteria 898
19 Ga0055534_1001733 3300003784 Bacteria 8251
20 Ga0055528_1000559 3300003790 Bacteria 28284
21 Ga0055530_10000907 3300003791 Bacteria 24319
22 Ga0055540_1000031 3300003792 Bacteria 177859
23 Ga0055531_10001498 3300003794 Bacteria 17152
24 Ga0055531_10001527 3300003794 Bacteria 16954
25 Ga0055543_1000409 3300004625 Bacteria 27012
26 Ga0065165_1004954 3300005262 Bacteria 7834
27 Ga0065165_1010654 3300005262 Bacteria 3940
28 Ga0070658_10621384 3300005327 Bacteria 937
29 Ga0070680_100224411 3300005336 Bacteria 1586
30 Ga0070678_100634047 3300005456 Bacteria 957
31 Ga0070707_100197590 3300005468 Bacteria 1961
32 Ga0070679_100014425 3300005530 Bacteria 7589
33 Ga0070679_100174100 3300005530 Bacteria 2125
34 Ga0068855_100009342 3300005563 Bacteria 11841
35 Ga0068855_100209038 3300005563 Bacteria 2194
36 Ga0075365_10013860 3300006038 Bacteria 4835
37 Ga0075365_10034808 3300006038 Bacteria 3254
38 Ga0075363_100102200 3300006048 Bacteria 1587
39 Ga0075364_10134679 3300006051 Bacteria 1659
40 Ga0075362_10053681 3300006177 Bacteria 1809
41 Ga0075362_10179224 3300006177 Bacteria 1026
42 Ga0075367_10030898 3300006178 Bacteria 3074
43 Ga0075366_10039013 3300006195 Bacteria 2805
44 Ga0075366_10443730 3300006195 Bacteria 800
45 Ga0075370_10237478 3300006353 Bacteria 1079
46 Ga0075370_10336498 3300006353 Bacteria 900
47 Ga0099826_10054865 3300006948 Bacteria 2643
48 Ga0105240_10008437 3300009093 Bacteria 14738
49 Ga0105245_10010056 3300009098 Bacteria 8242
50 Ga0105245_10844106 3300009098 Bacteria 956
51 Ga0114129_10639177 3300009147 Bacteria 1374
52 Ga0105241_10091212 3300009174 Bacteria 2404
53 Ga0105238_10407542 3300009551 Unclassified 1353
54 Ga0157347_1007449 3300012502 Bacteria 1094
55 Ga0157378_10123375 3300013297 Bacteria 2390
56 Ga0157376_10034272 3300014969 Bacteria 4098
57 Ga0157376_10795623 3300014969 Bacteria 958
58 Ga0209435_100001 3300025206 Bacteria 1424171
59 Ga0207425_1003150 3300025245 Bacteria 5405
60 Ga0209646_1000001 3300025246 Bacteria 3092932
61 Ga0209026_1000003 3300025250 Bacteria 1060571
62 Ga0209759_1000001 3300025256 Bacteria 2799452
63 Ga0209565_1000004 3300025263 Bacteria 983150
64 Ga0209565_1005646 3300025263 Bacteria 3615
65 Ga0209673_1000221 3300025273 Bacteria 112739
66 Ga0209130_1000166 3300025284 Bacteria 96473
67 Ga0209130_1000379 3300025284 Bacteria 49962
68 Ga0209675_1000338 3300025291 Bacteria 40966
69 Ga0209676_1000007 3300025292 Bacteria 1029371
70 Ga0209676_1007255 3300025292 Bacteria 5257
71 Ga0209025_1003185 3300025294 Bacteria 15925
72 Ga0209025_1011133 3300025294 Bacteria 5985
73 Ga0209564_1001086 3300025295 Bacteria 32517
74 Ga0209564_1001790 3300025295 Bacteria 19874
75 Ga0209564_1009139 3300025295 Bacteria 4767
76 Ga0209758_1018541 3300025297 Bacteria 3403
77 Ga0209758_1031587 3300025297 Bacteria 2169
78 Ga0209050_1000003 3300025298 Bacteria 1609245
79 Ga0209050_1008845 3300025298 Bacteria 5279
80 Ga0209256_1000001 3300025299 Bacteria 2166974
81 Ga0209256_1017281 3300025299 Bacteria 2406
82 Ga0209256_1044863 3300025299 Bacteria 1102
83 Ga0209256_1064527 3300025299 Bacteria 842
84 Ga0207426_1000025 3300025302 Bacteria 532921
85 Ga0207426_1003486 3300025302 Bacteria 8494
86 Ga0209051_1000003 3300025303 Bacteria 1609245
87 Ga0209051_1000078 3300025303 Bacteria 201965
88 Ga0209257_1000012 3300025304 Bacteria 1111138
89 Ga0209257_1000018 3300025304 Bacteria 836016
90 Ga0209257_1010591 3300025304 Bacteria 4631
91 Ga0207705_10394580 3300025909 Bacteria 1070
92 Ga0207654_10091846 3300025911 Bacteria 1852
93 Ga0207695_10033392 3300025913 Bacteria 5613
94 Ga0207657_10108305 3300025919 Bacteria 2297
95 Ga0207652_10218645 3300025921 Unclassified 1716
96 Ga0207694_10283796 3300025924 Bacteria 1360
97 Ga0207690_10239835 3300025932 Bacteria 1396
98 Ga0207667_10382772 3300025949 Bacteria 1433
99 Ga0207667_10552113 3300025949 Bacteria 1165
100 Ga0207702_10182471 3300026078 Bacteria 1934
101 Ga0207698_10577347 3300026142 Bacteria 1105
102 Ga0209983_1010035 3300027665 Bacteria 1935
103 Ga0209971_1035068 3300027682 Bacteria 1206
104 Ga0209813_10014003 3300027866 Bacteria 2152
105 Ga0307511_10000499 3300030521 Bacteria 42317
106 Ga0265330_10000108 3300031235 Bacteria 69468
107 Ga0265332_10000072 3300031238 Bacteria 86029
108 Ga0265325_10003531 3300031241 Bacteria 10163
109 Ga0265340_10053200 3300031247 Bacteria 1955
110 Ga0265327_10021015 3300031251 Bacteria 3953
111 Ga0307513_10000010 3300031456 Bacteria 360812
112 Ga0307513_10000584 3300031456 Bacteria 52307
113 Ga0307513_10120821 3300031456 Bacteria 2588
114 Ga0307513_10584488 3300031456 Bacteria 827
115 Ga0307408_100013886 3300031548 Bacteria 5347
116 Ga0307408_100178534 3300031548 Bacteria 1701
117 Ga0307408_100580294 3300031548 Bacteria 993
118 Ga0265314_10000874 3300031711 Bacteria 35850
119 Ga0265342_10022947 3300031712 Bacteria 3958
120 Ga0307516_10005829 3300031730 Bacteria 14591
121 Ga0307412_10119125 3300031911 Bacteria 1898
122 Ga0307412_10625480 3300031911 Bacteria 915
123 Ga0307416_100100533 3300032002 Bacteria 2515
124 Ga0307411_10030475 3300032005 Bacteria 3307
125 Ga0307507_10074673 3300033179 Bacteria 3039
126 Ga0395899_0014959 3300037312 Bacteria 5919
127 Ga0395899_0033764 3300037312 Bacteria 3842
128 Ga0395899_0327690 3300037312 Bacteria 1030
129 Ga0395900_0024242 3300037418 Bacteria 6211
130 Ga0395900_0062638 3300037418 Bacteria 3823
131 Ga0395900_0096965 3300037418 Bacteria 3030
132 Ga0395898_0004576 3300037466 Bacteria 15095
133 Ga0395898_0016584 3300037466 Bacteria 7531
134 Ga0395898_0026917 3300037466 Bacteria 5778
135 Ga0395905_0005874 3300037471 Bacteria 12457
136 Ga0395905_0014669 3300037471 Bacteria 7475
137 Ga0395905_0023478 3300037471 Bacteria 5826
138 Ga0395905_0044706 3300037471 Bacteria 4155
139 Ga0395905_0046458 3300037471 Bacteria 4071
140 Ga0395905_0210308 3300037471 Bacteria 1822
141 Ga0395905_0294352 3300037471 Bacteria 1510
142 Ga0395905_0363529 3300037471 Bacteria 1340
143 Ga0395901_0010197 3300038443 Bacteria 9519
144 Ga0395901_0053870 3300038443 Bacteria 4180
145 Ga0395901_0058894 3300038443 Bacteria 3996
146 Ga0451800_0859687 3300041459 Bacteria 1066
147 Ga0451807_0774231 3300041486 Bacteria 1151
148 Ga0439449_0006564 3300042007 Bacteria 4444
149 Ga0439462_0026667 3300042015 Bacteria 1523
150 Ga0450897_006037 3300042128 Bacteria 1070
151 Ga0450903_032874 3300042138 Bacteria 780
152 Ga0451577_0023269 3300042876 Bacteria 5651
153 Ga0453683_0000669 3300044673 Bacteria 36646
154 Ga0466966_0142617 3300044684 Bacteria 1463
155 Ga0466961_0135042 3300044693 Bacteria 1546
156 Ga0466961_0322186 3300044693 Bacteria 942
157 Ga0453684_0654889 3300044712 Bacteria 1146
158 Ga0466968_0309485 3300044735 Bacteria 761
159 Ga0466970_0222857 3300044765 Bacteria 1053
160 Ga0466957_0658937 3300044842 Bacteria 736
161 Ga0466959_0085310 3300045049 Bacteria 2273
162 Ga0451576_0006184 3300045051 Bacteria 14745
163 Ga0451576_0281519 3300045051 Bacteria 1739
164 Ga0466958_0291571 3300045836 Bacteria 1047
165 Ga0495627_006544 3300046453 Bacteria 4557
166 Ga0495627_020149 3300046453 Bacteria 2226
167 Ga0495651_0132784 3300046462 Bacteria 1816
168 Ga0495620_0005179 3300046515 Bacteria 7293
169 Ga0495637_0024128 3300046520 Bacteria 2752
170 Ga0495663_0034080 3300046525 Bacteria 1523
171 Ga0495642_0312975 3300046528 Bacteria 688
172 Ga0495625_0212059 3300046660 Bacteria 1272
173 Ga0495588_0025811 3300046674 Bacteria 2930
174 Ga0495669_0315736 3300046684 Bacteria 754
175 Ga0495670_0181422 3300046691 Bacteria 1112
176 Ga0495671_0004403 3300046692 Bacteria 8435
177 Ga0495685_022170 3300047447 Bacteria 2186
178 Ga0495615_0020580 3300048090 Bacteria 1480
179 Ga0496101_0019579 3300048904 Bacteria 4623
180 Ga0496114_0116418 3300048917 Bacteria 2294
181 Ga0496122_0016119 3300048925 Bacteria 7099
182 Ga0501034_0048981 3300049571 Bacteria 4264
183 Ga0501036_0282727 3300049572 Bacteria 1388
184 Ga0501038_0342223 3300049574 Bacteria 1166
185 Ga0501043_0463688 3300049579 Bacteria 950
186 Ga0501046_0177219 3300049580 Bacteria 1596
187 Ga0501046_0238904 3300049580 Bacteria 1340
188 Ga0501047_0163993 3300049581 Bacteria 2093
189 Ga0501047_0375652 3300049581 Bacteria 1256
190 Ga0501048_0368140 3300049582 Bacteria 1026
191 Ga0501073_0104975 3300049589 Bacteria 1961
192 Ga0501080_0223498 3300049742 Bacteria 1722
193 Ga0501044_0557471 3300049823 Bacteria 1042
194 nmdc:mga03683_29762_c1 3300050489 Bacteria 2180
195 nmdc:mga0yw44_329749_c1 3300050492 Bacteria 1026
196 nmdc:mga0k408_130314_c1 3300050493 Bacteria 1493
197 nmdc:mga0k408_252377_c1 3300050493 Bacteria 1053
198 nmdc:mga0k408_282718_c1 3300050493 Bacteria 990
199 nmdc:mga0k408_54040_c1 3300050493 Bacteria 2328
200 nmdc:mga06z11_179648_c1 3300050494 Bacteria 1220
201 nmdc:mga06z11_70332_c1 3300050494 Bacteria 1850
202 nmdc:mga04h51_51436_c1 3300050495 Bacteria 1384
203 nmdc:mga07m45_165856_c1 3300050496 Bacteria 1283
204 Ga0500610_0000519 3300053079 Bacteria 11857
205 Ga0500610_0000524 3300053079 Bacteria 11812
206 Ga0500644_0003055 3300053088 Bacteria 4150
207 Ga0500644_0005365 3300053088 Bacteria 3235
208 Ga0500651_0000931 3300053093 Bacteria 14354
209 Ga0500566_0142345 3300053094 Bacteria 1271
210 Ga0500650_0004733 3300053098 Bacteria 4969
211 Ga0500593_000277 3300053117 Bacteria 20914
212 Ga0500593_000637 3300053117 Bacteria 13500
213 Ga0500607_000025 3300053121 Bacteria 95473
214 Ga0500604_0031216 3300053151 Bacteria 1563
215 Ga0500627_0006055 3300053158 Bacteria 4079
216 Ga0500634_0000599 3300053161 Bacteria 12040
217 Ga0500638_022550 3300053162 Bacteria 2984
218 Ga0500645_000665 3300053730 Bacteria 21566
219 Ga0500645_000750 3300053730 Bacteria 19868
220 Ga0500661_009305 3300055283 Bacteria 1801
221 2511243802 2511231002 Bacteria 5042903
222 2738717825 2738541277 Bacteria 7458140
223 2738879446 2738541307 Bacteria 8606193
224 2739250438 2738543013 Bacteria 5618633
225 2739278511 2738543019 Bacteria 7459457
226 2919704952 2919704043 Bacteria 5560311
227 JGI25159J45721_1000483
228 JGI25155J39150_1000169
229 JGI25156J39149_1000373
230 JGI25154J39366_1000126
231 JGI25157J39369_1000138
232 JGI25150J39212_1014549
233 JGI25159J45721_1003601
234 JGI25151J46595_10004540
235 JGI25151J46595_10006561
236 JGI25160J50197_1000251
237 JGI25160J50197_1027250
238 JGI25161J50226_1000070
239 Ga0055526_1002825
240 Ga0055526_1003191
241 Ga0055537_1000116
242 Ga0055524_1000016
243 Ga0055536_1026586
244 Ga0055536_1051807
245 Ga0055534_1001733
246 Ga0055528_1000559
247 Ga0055530_10000907
248 Ga0055540_1000031
249 Ga0055531_10001498
250 Ga0055531_10001527
251 Ga0055543_1000409
252 Ga0065165_1004954
253 Ga0065165_1010654
254 Ga0070658_10621384
255 Ga0070680_100224411
256 Ga0070678_100634047
257 Ga0070707_100197590
258 Ga0070679_100014425
259 Ga0070679_100174100
260 Ga0068855_100009342
261 Ga0068855_100209038
262 Ga0075365_10013860
263 Ga0075365_10034808
264 Ga0075363_100102200
265 Ga0075364_10134679
266 Ga0075362_10053681
267 Ga0075362_10179224
268 Ga0075367_10030898
269 Ga0075366_10039013
270 Ga0075366_10443730
271 Ga0075370_10237478
272 Ga0075370_10336498
273 Ga0099826_10054865
274 Ga0105240_10008437
275 Ga0105245_10010056
276 Ga0105245_10844106
277 Ga0114129_10639177
278 Ga0105241_10091212
279 Ga0105238_10407542
280 Ga0157347_1007449
281 Ga0157378_10123375
282 Ga0157376_10034272
283 Ga0157376_10795623
284 Ga0209435_100001
285 Ga0207425_1003150
286 Ga0209646_1000001
287 Ga0209026_1000003
288 Ga0209759_1000001
289 Ga0209565_1000004
290 Ga0209565_1005646
291 Ga0209673_1000221
292 Ga0209130_1000166
293 Ga0209130_1000379
294 Ga0209675_1000338
295 Ga0209676_1000007
296 Ga0209676_1007255
297 Ga0209025_1003185
298 Ga0209025_1011133
299 Ga0209564_1001086
300 Ga0209564_1001790
301 Ga0209564_1009139
302 Ga0209758_1018541
303 Ga0209758_1031587
304 Ga0209050_1000003
305 Ga0209050_1008845
306 Ga0209256_1000001
307 Ga0209256_1017281
308 Ga0209256_1044863
309 Ga0209256_1064527
310 Ga0207426_1000025
311 Ga0207426_1003486
312 Ga0209051_1000003
313 Ga0209051_1000078
314 Ga0209257_1000012
315 Ga0209257_1000018
316 Ga0209257_1010591
317 Ga0207705_10394580
318 Ga0207654_10091846
319 Ga0207695_10033392
320 Ga0207657_10108305
321 Ga0207652_10218645
322 Ga0207694_10283796
323 Ga0207690_10239835
324 Ga0207667_10382772
325 Ga0207667_10552113
326 Ga0207702_10182471
327 Ga0207698_10577347
328 Ga0209983_1010035
329 Ga0209971_1035068
330 Ga0209813_10014003
331 Ga0307511_10000499
332 Ga0265330_10000108
333 Ga0265332_10000072
334 Ga0265325_10003531
335 Ga0265340_10053200
336 Ga0265327_10021015
337 Ga0307513_10000010
338 Ga0307513_10000584
339 Ga0307513_10120821
340 Ga0307513_10584488
341 Ga0307408_100013886
342 Ga0307408_100178534
343 Ga0307408_100580294
344 Ga0265314_10000874
345 Ga0265342_10022947
346 Ga0307516_10005829
347 Ga0307412_10119125
348 Ga0307412_10625480
349 Ga0307416_100100533
350 Ga0307411_10030475
351 Ga0307507_10074673
352 Ga0395899_0014959
353 Ga0395899_0033764
354 Ga0395899_0327690
355 Ga0395900_0024242
356 Ga0395900_0062638
357 Ga0395900_0096965
358 Ga0395898_0004576
359 Ga0395898_0016584
360 Ga0395898_0026917
361 Ga0395905_0005874
362 Ga0395905_0014669
363 Ga0395905_0023478
364 Ga0395905_0044706
365 Ga0395905_0046458
366 Ga0395905_0210308
367 Ga0395905_0294352
368 Ga0395905_0363529
369 Ga0395901_0010197
370 Ga0395901_0053870
371 Ga0395901_0058894
372 Ga0451800_0859687
373 Ga0451807_0774231
374 Ga0439449_0006564
375 Ga0439462_0026667
376 Ga0450897_006037
377 Ga0450903_032874
378 Ga0451577_0023269
379 Ga0453683_0000669
380 Ga0466966_0142617
381 Ga0466961_0135042
382 Ga0466961_0322186
383 Ga0453684_0654889
384 Ga0466968_0309485
385 Ga0466970_0222857
386 Ga0466957_0658937
387 Ga0466959_0085310
388 Ga0451576_0006184
389 Ga0451576_0281519
390 Ga0466958_0291571
391 Ga0495627_006544
392 Ga0495627_020149
393 Ga0495651_0132784
394 Ga0495620_0005179
395 Ga0495637_0024128
396 Ga0495663_0034080
397 Ga0495642_0312975
398 Ga0495625_0212059
399 Ga0495588_0025811
400 Ga0495669_0315736
401 Ga0495670_0181422
402 Ga0495671_0004403
403 Ga0495685_022170
404 Ga0495615_0020580
405 Ga0496101_0019579
406 Ga0496114_0116418
407 Ga0496122_0016119
408 Ga0501034_0048981
409 Ga0501036_0282727
410 Ga0501038_0342223
411 Ga0501043_0463688
412 Ga0501046_0177219
413 Ga0501046_0238904
414 Ga0501047_0163993
415 Ga0501047_0375652
416 Ga0501048_0368140
417 Ga0501073_0104975
418 Ga0501080_0223498
419 Ga0501044_0557471
420 nmdc:mga03683_29762_c1
421 nmdc:mga0yw44_329749_c1
422 nmdc:mga0k408_130314_c1
423 nmdc:mga0k408_252377_c1
424 nmdc:mga0k408_282718_c1
425 nmdc:mga0k408_54040_c1
426 nmdc:mga06z11_179648_c1
427 nmdc:mga06z11_70332_c1
428 nmdc:mga04h51_51436_c1
429 nmdc:mga07m45_165856_c1
430 Ga0500610_0000519
431 Ga0500610_0000524
432 Ga0500644_0003055
433 Ga0500644_0005365
434 Ga0500651_0000931
435 Ga0500566_0142345
436 Ga0500650_0004733
437 Ga0500593_000277
438 Ga0500593_000637
439 Ga0500607_000025
440 Ga0500604_0031216
441 Ga0500627_0006055
442 Ga0500634_0000599
443 Ga0500638_022550
444 Ga0500645_000665
445 Ga0500645_000750
446 Ga0500661_009305
447 2511243802
448 2738717825
449 2738879446
450 2739250438
451 2739278511
452 2919704952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04299

FMN_bind_2

Putative FMN-binding domain

34

194

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ol5-assembly1.cif.gz_A crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8944 14 202
2ol5-assembly1.cif.gz_A crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8852 14 202
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8494 13 201
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8411 13 201
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.7895 6 170
ID Description Score Start End Superfamily
2ol5A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8817 14 199 2.30.110.10
2ol5A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.863 14 199 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8212 13 170 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8025 13 170 2.30.110.10
2arzB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7821 17 168 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A353Y5F7-F1-model_v4 FMN-binding negative transcriptional regulator 0.9615 29 207
AF-A0A353Y5F7-F1-model_v4 FMN-binding negative transcriptional regulator 0.9461 29 207
AF-A0A2M6V0C4-F1-model_v4 Transcriptional regulator 0.9429 5 208
AF-A0A4Q5UJE8-F1-model_v4 deleted 0.9407 5 176
AF-A0A2M6V0C4-F1-model_v4 Transcriptional regulator 0.9384 5 208

Map