F338298
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 225 | 172 | 191 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300053153|Ga0500616_0000018|Ga0500616_0000018_421524_422330 |
| Length | 268 |
| Sequence | MPTAKLQKSAPTCRFDPSWLVFLQEPPNEDTCMPANPPLTPAAELVKLNPTRIPNESAEYRRARQALLIEEIELRRHIERVAEQRRGLPPGGRVTKNYQFVGERGPASFADLFGDKQSLVVYSYMFGPQRERPCPMCTSLLSAWDGEARDVDQRTSLVVIARSPIERLVAFKKERGWRNLRLYSDPSQEFSRDYFAITPDGGDTAAFNVFTRRDGEIRHFWAGEMGGETADPGQDPRGAPDLMPLWTILDCVPEGRGTDWYPKLDYDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 7 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 8 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 9 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 10 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 11 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 12 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 13 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 14 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 15 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 16 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 17 | 2904699407 | |||
| 18 | 2906610324 | |||
| 19 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 20 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 21 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 22 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 23 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 24 | 2922425934 | |||
| 25 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 26 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 27 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 28 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 29 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 30 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 31 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 32 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 33 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 126 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 129 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 154 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 155 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 156 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 157 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 160 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 162 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 163 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 164 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 165 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 166 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 167 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 168 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 169 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 170 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 171 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 172 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.04 |
| Metatranscriptomes | 0 |
| Isolates | 13.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.22 |
| Nodule | 10.22 |
| Rhizoplane | 2.22 |
| Rhizosphere | 73.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000194 | 3300000546 | Bacteria | 10234 |
| 2 | rootH2_10339593 | 3300003320 | Bacteria | 1202 |
| 3 | rootL2_10045747 | 3300003322 | Bacteria | 1791 |
| 4 | JGI25404J52841_10007317 | 3300003659 | Bacteria | 2333 |
| 5 | Ga0065165_1031277 | 3300005262 | Bacteria | 1684 |
| 6 | Ga0065715_10015284 | 3300005293 | Unclassified | 1954 |
| 7 | Ga0065707_10285571 | 3300005295 | Bacteria | 1037 |
| 8 | Ga0070658_10003290 | 3300005327 | Bacteria | 13332 |
| 9 | Ga0070676_10068132 | 3300005328 | Bacteria | 2130 |
| 10 | Ga0070683_100145232 | 3300005329 | Bacteria | 2248 |
| 11 | Ga0070670_100367844 | 3300005331 | Bacteria | 1265 |
| 12 | Ga0070680_100073576 | 3300005336 | Bacteria | 2811 |
| 13 | Ga0068868_100056340 | 3300005338 | Bacteria | 3104 |
| 14 | Ga0068868_100796602 | 3300005338 | Bacteria | 852 |
| 15 | Ga0070660_100400961 | 3300005339 | Bacteria | 1134 |
| 16 | Ga0070673_100056457 | 3300005364 | Bacteria | 3098 |
| 17 | Ga0070659_100081705 | 3300005366 | Bacteria | 2581 |
| 18 | Ga0070713_100146421 | 3300005436 | Bacteria | 2097 |
| 19 | Ga0070710_10005293 | 3300005437 | Bacteria | 6118 |
| 20 | Ga0070711_100095116 | 3300005439 | Bacteria | 2155 |
| 21 | Ga0070678_100444146 | 3300005456 | Bacteria | 1135 |
| 22 | Ga0070681_10138996 | 3300005458 | Unclassified | 2359 |
| 23 | Ga0070681_10151007 | 3300005458 | Bacteria | 2249 |
| 24 | Ga0070681_10187257 | 3300005458 | Bacteria | 1990 |
| 25 | Ga0070699_100168601 | 3300005518 | Bacteria | 1940 |
| 26 | Ga0070679_100044638 | 3300005530 | Bacteria | 4415 |
| 27 | Ga0070684_100030983 | 3300005535 | Bacteria | 4550 |
| 28 | Ga0070684_100537126 | 3300005535 | Bacteria | 1084 |
| 29 | Ga0068853_100031334 | 3300005539 | Bacteria | 4498 |
| 30 | Ga0070665_100001293 | 3300005548 | Bacteria | 29949 |
| 31 | Ga0070665_100011567 | 3300005548 | Bacteria | 8923 |
| 32 | Ga0070665_100018787 | 3300005548 | Bacteria | 6930 |
| 33 | Ga0070665_100382423 | 3300005548 | Bacteria | 1415 |
| 34 | Ga0068855_100048848 | 3300005563 | Bacteria | 4992 |
| 35 | Ga0068855_100481812 | 3300005563 | Bacteria | 1350 |
| 36 | Ga0068856_100269561 | 3300005614 | Bacteria | 1718 |
| 37 | Ga0068852_100158009 | 3300005616 | Bacteria | 2114 |
| 38 | Ga0068859_100149989 | 3300005617 | Bacteria | 2407 |
| 39 | Ga0068866_10300109 | 3300005718 | Unclassified | 1003 |
| 40 | Ga0068863_100178772 | 3300005841 | Bacteria | 2037 |
| 41 | Ga0068863_100291886 | 3300005841 | Unclassified | 1581 |
| 42 | Ga0068858_100159739 | 3300005842 | Bacteria | 2122 |
| 43 | Ga0070717_10046273 | 3300006028 | Bacteria | 3560 |
| 44 | Ga0075365_10219510 | 3300006038 | Bacteria | 1333 |
| 45 | Ga0075365_10551862 | 3300006038 | Bacteria | 815 |
| 46 | Ga0075364_10060263 | 3300006051 | Bacteria | 2489 |
| 47 | Ga0070716_100000056 | 3300006173 | Bacteria | 43733 |
| 48 | Ga0070712_100005996 | 3300006175 | Bacteria | 7518 |
| 49 | Ga0097621_100004075 | 3300006237 | Bacteria | 10139 |
| 50 | Ga0097621_100189181 | 3300006237 | Bacteria | 1782 |
| 51 | Ga0068871_100029160 | 3300006358 | Bacteria | 4332 |
| 52 | Ga0068871_100045043 | 3300006358 | Bacteria | 3549 |
| 53 | Ga0068865_100003802 | 3300006881 | Bacteria | 9063 |
| 54 | Ga0068865_100008780 | 3300006881 | Bacteria | 6248 |
| 55 | Ga0097620_100149984 | 3300006931 | Bacteria | 2407 |
| 56 | Ga0099822_1002963 | 3300006943 | Bacteria | 21553 |
| 57 | Ga0099794_10236956 | 3300007265 | Bacteria | 940 |
| 58 | Ga0105240_10003801 | 3300009093 | Bacteria | 23322 |
| 59 | Ga0105240_10042118 | 3300009093 | Bacteria | 5822 |
| 60 | Ga0105240_10299165 | 3300009093 | Unclassified | 1841 |
| 61 | Ga0105240_10490092 | 3300009093 | Bacteria | 1369 |
| 62 | Ga0105245_10001164 | 3300009098 | Bacteria | 23809 |
| 63 | Ga0105245_10051685 | 3300009098 | Bacteria | 3684 |
| 64 | Ga0105243_10111388 | 3300009148 | Bacteria | 2291 |
| 65 | Ga0105241_10043750 | 3300009174 | Bacteria | 3392 |
| 66 | Ga0105241_10052084 | 3300009174 | Bacteria | 3124 |
| 67 | Ga0105242_10003541 | 3300009176 | Bacteria | 12140 |
| 68 | Ga0105242_10010057 | 3300009176 | Bacteria | 7245 |
| 69 | Ga0105248_10075490 | 3300009177 | Bacteria | 3789 |
| 70 | Ga0105248_10099183 | 3300009177 | Bacteria | 3282 |
| 71 | Ga0105237_10000645 | 3300009545 | Bacteria | 48648 |
| 72 | Ga0105237_10026247 | 3300009545 | Bacteria | 5953 |
| 73 | Ga0105237_10049205 | 3300009545 | Bacteria | 4238 |
| 74 | Ga0105237_10161194 | 3300009545 | Bacteria | 2241 |
| 75 | Ga0105238_10088296 | 3300009551 | Bacteria | 3087 |
| 76 | Ga0105238_10146329 | 3300009551 | Bacteria | 2339 |
| 77 | Ga0105238_10404944 | 3300009551 | Bacteria | 1358 |
| 78 | Ga0105238_11074268 | 3300009551 | Unclassified | 827 |
| 79 | Ga0105249_10504848 | 3300009553 | Unclassified | 1255 |
| 80 | Ga0105249_10571666 | 3300009553 | Bacteria | 1183 |
| 81 | Ga0105239_10000572 | 3300010375 | Bacteria | 52626 |
| 82 | Ga0105239_10024246 | 3300010375 | Bacteria | 6682 |
| 83 | Ga0105239_10398327 | 3300010375 | Bacteria | 1558 |
| 84 | Ga0157374_10009591 | 3300013296 | Bacteria | 8313 |
| 85 | Ga0157378_10147200 | 3300013297 | Bacteria | 2192 |
| 86 | Ga0157378_10773678 | 3300013297 | Bacteria | 984 |
| 87 | Ga0163162_10073403 | 3300013306 | Bacteria | 3477 |
| 88 | Ga0163162_10162161 | 3300013306 | Bacteria | 2358 |
| 89 | Ga0163162_10686721 | 3300013306 | Bacteria | 1146 |
| 90 | Ga0157372_10064374 | 3300013307 | Bacteria | 4114 |
| 91 | Ga0157372_10065711 | 3300013307 | Bacteria | 4074 |
| 92 | Ga0157372_10665140 | 3300013307 | Bacteria | 1213 |
| 93 | Ga0157375_10042251 | 3300013308 | Bacteria | 4411 |
| 94 | Ga0163163_10336916 | 3300014325 | Bacteria | 1563 |
| 95 | Ga0163163_10438294 | 3300014325 | Unclassified | 1366 |
| 96 | Ga0163163_10505565 | 3300014325 | Bacteria | 1270 |
| 97 | Ga0157376_10001677 | 3300014969 | Bacteria | 14711 |
| 98 | Ga0157376_10859300 | 3300014969 | Bacteria | 923 |
| 99 | Ga0209564_1000164 | 3300025295 | Bacteria | 160675 |
| 100 | Ga0207692_10035414 | 3300025898 | Bacteria | 2425 |
| 101 | Ga0207642_10404068 | 3300025899 | Unclassified | 818 |
| 102 | Ga0207699_10093416 | 3300025906 | Bacteria | 1893 |
| 103 | Ga0207645_10058730 | 3300025907 | Bacteria | 2456 |
| 104 | Ga0207705_10053353 | 3300025909 | Unclassified | 2912 |
| 105 | Ga0207654_10069003 | 3300025911 | Bacteria | 2093 |
| 106 | Ga0207707_10114193 | 3300025912 | Bacteria | 2360 |
| 107 | Ga0207695_10002668 | 3300025913 | Bacteria | 26071 |
| 108 | Ga0207695_10218898 | 3300025913 | Bacteria | 1812 |
| 109 | Ga0207695_10351522 | 3300025913 | Bacteria | 1361 |
| 110 | Ga0207671_10066793 | 3300025914 | Bacteria | 2677 |
| 111 | Ga0207671_10088699 | 3300025914 | Bacteria | 2327 |
| 112 | Ga0207693_10001666 | 3300025915 | Bacteria | 19582 |
| 113 | Ga0207657_10085858 | 3300025919 | Unclassified | 2635 |
| 114 | Ga0207652_10038610 | 3300025921 | Bacteria | 4049 |
| 115 | Ga0207687_10024221 | 3300025927 | Bacteria | 4052 |
| 116 | Ga0207700_10079777 | 3300025928 | Bacteria | 2550 |
| 117 | Ga0207700_10277429 | 3300025928 | Bacteria | 1441 |
| 118 | Ga0207700_10760965 | 3300025928 | Bacteria | 866 |
| 119 | Ga0207690_10049626 | 3300025932 | Bacteria | 2799 |
| 120 | Ga0207686_10023928 | 3300025934 | Bacteria | 3532 |
| 121 | Ga0207686_10064913 | 3300025934 | Bacteria | 2326 |
| 122 | Ga0207704_10025208 | 3300025938 | Bacteria | 3241 |
| 123 | Ga0207704_10186214 | 3300025938 | Unclassified | 1505 |
| 124 | Ga0207665_10000267 | 3300025939 | Bacteria | 36262 |
| 125 | Ga0207711_10156460 | 3300025941 | Unclassified | 2060 |
| 126 | Ga0207689_10349946 | 3300025942 | Bacteria | 1228 |
| 127 | Ga0207661_10111546 | 3300025944 | Bacteria | 2314 |
| 128 | Ga0207667_10034601 | 3300025949 | Bacteria | 5424 |
| 129 | Ga0207651_10051869 | 3300025960 | Bacteria | 2794 |
| 130 | Ga0207658_10281436 | 3300025986 | Bacteria | 1426 |
| 131 | Ga0207677_10053976 | 3300026023 | Bacteria | 2739 |
| 132 | Ga0207703_10219582 | 3300026035 | Bacteria | 1699 |
| 133 | Ga0207639_10042752 | 3300026041 | Bacteria | 3398 |
| 134 | Ga0207639_10075544 | 3300026041 | Bacteria | 2650 |
| 135 | Ga0207641_10156476 | 3300026088 | Bacteria | 2068 |
| 136 | Ga0207641_10222506 | 3300026088 | Unclassified | 1751 |
| 137 | Ga0207648_10063810 | 3300026089 | Bacteria | 3210 |
| 138 | Ga0207676_10267809 | 3300026095 | Bacteria | 1546 |
| 139 | Ga0207683_10240233 | 3300026121 | Bacteria | 1652 |
| 140 | Ga0209588_1009395 | 3300027671 | Bacteria | 2923 |
| 141 | Ga0268266_10000393 | 3300028379 | Bacteria | 66214 |
| 142 | Ga0268266_10238203 | 3300028379 | Bacteria | 1678 |
| 143 | Ga0268266_10824009 | 3300028379 | Bacteria | 896 |
| 144 | Ga0265339_10043272 | 3300031249 | Bacteria | 2491 |
| 145 | Ga0307513_10000013 | 3300031456 | Bacteria | 325682 |
| 146 | Ga0307416_100238202 | 3300032002 | Bacteria | 1761 |
| 147 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 148 | Ga0373936_0222951 | 3300035113 | Unclassified | 837 |
| 149 | Ga0495617_000038 | 3300046452 | Bacteria | 132535 |
| 150 | Ga0495603_0279728 | 3300046455 | Unclassified | 959 |
| 151 | Ga0495638_0078888 | 3300046460 | Bacteria | 2003 |
| 152 | Ga0495580_0002984 | 3300046472 | Bacteria | 14514 |
| 153 | Ga0495580_0386283 | 3300046472 | Bacteria | 945 |
| 154 | Ga0495639_0271566 | 3300046475 | Bacteria | 841 |
| 155 | Ga0495594_0060980 | 3300046499 | Bacteria | 2087 |
| 156 | Ga0495596_0033072 | 3300046500 | Bacteria | 2059 |
| 157 | Ga0495606_0083584 | 3300046507 | Bacteria | 1979 |
| 158 | Ga0495620_0000016 | 3300046515 | Bacteria | 153638 |
| 159 | Ga0495632_0009319 | 3300046519 | Bacteria | 5927 |
| 160 | Ga0495648_0002741 | 3300046524 | Bacteria | 15912 |
| 161 | Ga0495648_0023290 | 3300046524 | Bacteria | 4245 |
| 162 | Ga0495648_0088111 | 3300046524 | Bacteria | 1745 |
| 163 | Ga0495642_0019294 | 3300046528 | Bacteria | 2672 |
| 164 | Ga0495645_0070657 | 3300046543 | Bacteria | 2519 |
| 165 | Ga0495656_0294185 | 3300046615 | Unclassified | 831 |
| 166 | Ga0495611_0000036 | 3300046648 | Bacteria | 102447 |
| 167 | Ga0495599_0172933 | 3300046678 | Bacteria | 1332 |
| 168 | Ga0495624_0437110 | 3300046690 | Bacteria | 784 |
| 169 | Ga0495683_0017525 | 3300047323 | Bacteria | 3712 |
| 170 | Ga0495687_009275 | 3300047443 | Bacteria | 5520 |
| 171 | Ga0495673_0000291 | 3300047469 | Bacteria | 67241 |
| 172 | Ga0495686_0020790 | 3300047472 | Bacteria | 4373 |
| 173 | Ga0496102_0163460 | 3300048905 | Bacteria | 2094 |
| 174 | Ga0496104_0232065 | 3300048907 | Bacteria | 1757 |
| 175 | Ga0496107_0143791 | 3300048910 | Bacteria | 1763 |
| 176 | Ga0496121_0249159 | 3300048924 | Bacteria | 1233 |
| 177 | Ga0496122_0070654 | 3300048925 | Bacteria | 2492 |
| 178 | Ga0496126_0009826 | 3300048929 | Bacteria | 10129 |
| 179 | Ga0496126_0015795 | 3300048929 | Bacteria | 7584 |
| 180 | Ga0496126_0136325 | 3300048929 | Bacteria | 2117 |
| 181 | Ga0501036_0215064 | 3300049572 | Bacteria | 1615 |
| 182 | Ga0501047_0003609 | 3300049581 | Bacteria | 14583 |
| 183 | nmdc:mga00v17_54394_c1 | 3300050491 | Bacteria | 2441 |
| 184 | nmdc:mga0yw44_208410_c1 | 3300050492 | Bacteria | 1292 |
| 185 | Ga0500583_0144468 | 3300053092 | Bacteria | 1183 |
| 186 | Ga0500591_113879 | 3300053115 | Bacteria | 1127 |
| 187 | Ga0500577_0000483 | 3300053142 | Bacteria | 10273 |
| 188 | Ga0500616_0000018 | 3300053153 | Bacteria | 610976 |
| 189 | Ga0500633_0060052 | 3300053160 | Bacteria | 1335 |
| 190 | Ga0500639_080223 | 3300053163 | Bacteria | 1645 |
| 191 | Ga0500645_083581 | 3300053730 | Bacteria | 910 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046475 | Ga0495639_0271566 | Ga0495639_0271566_69_668 | 199 |
| 2 | 3300048924 | Ga0496121_0249159 | Ga0496121_0249159_515_1210 | 207 |
| 3 | 3300046528 | Ga0495642_0019294 | Ga0495642_0019294_1532_2233 | 210 |
| 4 | 3300048905 | Ga0496102_0163460 | Ga0496102_0163460_1157_1852 | 214 |
| 5 | 3300048910 | Ga0496107_0143791 | Ga0496107_0143791_1018_1713 | 214 |
| 6 | 3300048929 | Ga0496126_0136325 | Ga0496126_0136325_212_907 | 214 |
| 7 | 3300046507 | Ga0495606_0083584 | Ga0495606_0083584_841_1563 | 222 |
| 8 | 3300047443 | Ga0495687_009275 | Ga0495687_009275_1448_2170 | 222 |
| 9 | 3300003322 | rootL2_10045747 | rootL2_100457472 | 226 |
| 10 | iso_pu_bacteria | 2513237096 | 2513660108 | 227 |
| 11 | iso_pu_bacteria | 2513237137 | 2513858285 | 227 |
| 12 | iso_pu_bacteria | 2513237145 | 2513922082 | 227 |
| 13 | iso_pu_bacteria | 2517572143 | 2517893826 | 227 |
| 14 | iso_pu_bacteria | 2524023228 | 2524537775 | 227 |
| 15 | iso_pu_bacteria | 2667528175 | 2671122819 | 227 |
| 16 | iso_pu_bacteria | 2728368998 | 2728747941 | 227 |
| 17 | iso_pu_bacteria | 2791355197 | 2793072541 | 227 |
| 18 | iso_pu_bacteria | 2885374607 | 2885381584 | 227 |
| 19 | iso_pu_bacteria | 2903748898 | 2903751614 | 227 |
| 20 | iso_pu_bacteria | 2904578770 | 2904581725 | 227 |
| 21 | iso_pu_bacteria | 2904690495 | 2904691601 | 227 |
| 22 | iso_pu_bacteria | 2904699407 | 2904705097 | 227 |
| 23 | iso_pu_bacteria | 2906610324 | 2906610706 | 227 |
| 24 | iso_pu_bacteria | 2908739725 | 2908744225 | 227 |
| 25 | iso_pu_bacteria | 2908756301 | 2908761866 | 227 |
| 26 | iso_pu_bacteria | 2919119836 | 2919123391 | 227 |
| 27 | iso_pu_bacteria | 2919171160 | 2919175518 | 227 |
| 28 | iso_pu_bacteria | 2922425934 | 2922428612 | 227 |
| 29 | iso_pu_bacteria | 2935630451 | 2935634586 | 227 |
| 30 | iso_pu_bacteria | 2941507105 | 2941509072 | 227 |
| 31 | iso_pu_bacteria | 2941515067 | 2941516901 | 227 |
| 32 | iso_pu_bacteria | 2941523033 | 2941525004 | 227 |
| 33 | iso_pu_bacteria | 3005474847 | 3005478742 | 227 |
| 34 | iso_pu_bacteria | 8006933436 | 8006942601 | 227 |
| 35 | iso_pu_bacteria | 8006964411 | 8006964732 | 227 |
| 36 | iso_pu_bacteria | 8006973647 | 8006982329 | 227 |
| 37 | iso_pu_bacteria | 8019555841 | 8019558372 | 227 |
| 38 | iso_pu_bacteria | 8019565922 | 8019566922 | 227 |
| 39 | 3300047323 | Ga0495683_0017525 | Ga0495683_0017525_1697_2419 | 228 |
| 40 | iso_pu_bacteria | 2765235802 | 2765466748 | 228 |
| 41 | 3300006051 | Ga0075364_10060263 | Ga0075364_100602632 | 230 |
| 42 | 3300026041 | Ga0207639_10042752 | Ga0207639_100427522 | 230 |
| 43 | 3300048925 | Ga0496122_0070654 | Ga0496122_0070654_769_1467 | 230 |
| 44 | 3300050491 | nmdc:mga00v17_54394_c1 | nmdc:mga00v17_54394_c1_1036_1734 | 230 |
| 45 | 3300050492 | nmdc:mga0yw44_208410_c1 | nmdc:mga0yw44_208410_c1_12_710 | 230 |
| 46 | iso_pu_bacteria | 2511231027 | 2511392517 | 230 |
| 47 | iso_pu_bacteria | 2842871566 | 2842874383 | 230 |
| 48 | iso_pu_bacteria | 2895395659 | 2895396804 | 230 |
| 49 | iso_pu_bacteria | 2909042592 | 2909048388 | 230 |
| 50 | 3300003659 | JGI25404J52841_10007317 | JGI25404J52841_100073172 | 231 |
| 51 | 3300006038 | Ga0075365_10219510 | Ga0075365_102195101 | 231 |
| 52 | 3300006943 | Ga0099822_1002963 | Ga0099822_100296311 | 231 |
| 53 | 3300009553 | Ga0105249_10571666 | Ga0105249_105716662 | 231 |
| 54 | 3300025295 | Ga0209564_1000164 | Ga0209564_1000164145 | 231 |
| 55 | 3300032002 | Ga0307416_100238202 | Ga0307416_1002382022 | 231 |
| 56 | 3300033442 | Ga0315911_1000011 | Ga0315911_100001112 | 231 |
| 57 | 3300046524 | Ga0495648_0023290 | Ga0495648_0023290_3315_4016 | 231 |
| 58 | 3300048929 | Ga0496126_0009826 | Ga0496126_0009826_178_879 | 231 |
| 59 | 3300053142 | Ga0500577_0000483 | Ga0500577_0000483_7008_7709 | 231 |
| 60 | 3300053730 | Ga0500645_083581 | Ga0500645_083581_129_830 | 231 |
| 61 | 3300005262 | Ga0065165_1031277 | Ga0065165_10312772 | 232 |
| 62 | 3300005327 | Ga0070658_10003290 | Ga0070658_100032902 | 232 |
| 63 | 3300005336 | Ga0070680_100073576 | Ga0070680_1000735763 | 232 |
| 64 | 3300005339 | Ga0070660_100400961 | Ga0070660_1004009612 | 232 |
| 65 | 3300005458 | Ga0070681_10138996 | Ga0070681_101389962 | 232 |
| 66 | 3300005530 | Ga0070679_100044638 | Ga0070679_1000446386 | 232 |
| 67 | 3300005535 | Ga0070684_100537126 | Ga0070684_1005371262 | 232 |
| 68 | 3300005563 | Ga0068855_100048848 | Ga0068855_1000488484 | 232 |
| 69 | 3300005614 | Ga0068856_100269561 | Ga0068856_1002695611 | 232 |
| 70 | 3300005841 | Ga0068863_100291886 | Ga0068863_1002918861 | 232 |
| 71 | 3300007265 | Ga0099794_10236956 | Ga0099794_102369562 | 232 |
| 72 | 3300009093 | Ga0105240_10042118 | Ga0105240_100421183 | 232 |
| 73 | 3300009545 | Ga0105237_10026247 | Ga0105237_100262473 | 232 |
| 74 | 3300010375 | Ga0105239_10024246 | Ga0105239_100242462 | 232 |
| 75 | 3300013297 | Ga0157378_10773678 | Ga0157378_107736782 | 232 |
| 76 | 3300013307 | Ga0157372_10064374 | Ga0157372_100643742 | 232 |
| 77 | 3300014325 | Ga0163163_10438294 | Ga0163163_104382942 | 232 |
| 78 | 3300014325 | Ga0163163_10505565 | Ga0163163_105055652 | 232 |
| 79 | 3300025909 | Ga0207705_10053353 | Ga0207705_100533532 | 232 |
| 80 | 3300025914 | Ga0207671_10066793 | Ga0207671_100667933 | 232 |
| 81 | 3300025919 | Ga0207657_10085858 | Ga0207657_100858582 | 232 |
| 82 | 3300025921 | Ga0207652_10038610 | Ga0207652_100386106 | 232 |
| 83 | 3300025949 | Ga0207667_10034601 | Ga0207667_100346014 | 232 |
| 84 | 3300026088 | Ga0207641_10222506 | Ga0207641_102225062 | 232 |
| 85 | 3300027671 | Ga0209588_1009395 | Ga0209588_10093952 | 232 |
| 86 | 3300046524 | Ga0495648_0088111 | Ga0495648_0088111_790_1515 | 232 |
| 87 | 3300046452 | Ga0495617_000038 | Ga0495617_000038_65566_66273 | 233 |
| 88 | 3300046515 | Ga0495620_0000016 | Ga0495620_0000016_86687_87394 | 233 |
| 89 | 3300046519 | Ga0495632_0009319 | Ga0495632_0009319_3544_4251 | 233 |
| 90 | 3300046524 | Ga0495648_0002741 | Ga0495648_0002741_12868_13575 | 233 |
| 91 | 3300046648 | Ga0495611_0000036 | Ga0495611_0000036_87219_87926 | 233 |
| 92 | 3300047469 | Ga0495673_0000291 | Ga0495673_0000291_37983_38690 | 233 |
| 93 | 3300047472 | Ga0495686_0020790 | Ga0495686_0020790_2012_2719 | 233 |
| 94 | 3300049572 | Ga0501036_0215064 | Ga0501036_0215064_133_846 | 233 |
| 95 | 3300049581 | Ga0501047_0003609 | Ga0501047_0003609_8706_9419 | 233 |
| 96 | 3300053160 | Ga0500633_0060052 | Ga0500633_0060052_226_933 | 233 |
| 97 | 3300005338 | Ga0068868_100796602 | Ga0068868_1007966021 | 234 |
| 98 | 3300005548 | Ga0070665_100001293 | Ga0070665_10000129324 | 234 |
| 99 | 3300005548 | Ga0070665_100011567 | Ga0070665_1000115672 | 234 |
| 100 | 3300005617 | Ga0068859_100149989 | Ga0068859_1001499892 | 234 |
| 101 | 3300006931 | Ga0097620_100149984 | Ga0097620_1001499842 | 234 |
| 102 | 3300009093 | Ga0105240_10003801 | Ga0105240_100038014 | 234 |
| 103 | 3300009093 | Ga0105240_10490092 | Ga0105240_104900922 | 234 |
| 104 | 3300009174 | Ga0105241_10043750 | Ga0105241_100437502 | 234 |
| 105 | 3300009545 | Ga0105237_10000645 | Ga0105237_100006451 | 234 |
| 106 | 3300009545 | Ga0105237_10049205 | Ga0105237_100492053 | 234 |
| 107 | 3300009545 | Ga0105237_10161194 | Ga0105237_101611942 | 234 |
| 108 | 3300009551 | Ga0105238_10088296 | Ga0105238_100882961 | 234 |
| 109 | 3300009551 | Ga0105238_10404944 | Ga0105238_104049442 | 234 |
| 110 | 3300010375 | Ga0105239_10000572 | Ga0105239_1000057212 | 234 |
| 111 | 3300013306 | Ga0163162_10686721 | Ga0163162_106867212 | 234 |
| 112 | 3300025911 | Ga0207654_10069003 | Ga0207654_100690032 | 234 |
| 113 | 3300025913 | Ga0207695_10002668 | Ga0207695_100026681 | 234 |
| 114 | 3300025913 | Ga0207695_10351522 | Ga0207695_103515222 | 234 |
| 115 | 3300025914 | Ga0207671_10088699 | Ga0207671_100886994 | 234 |
| 116 | 3300025928 | Ga0207700_10277429 | Ga0207700_102774292 | 234 |
| 117 | 3300025986 | Ga0207658_10281436 | Ga0207658_102814362 | 234 |
| 118 | 3300026041 | Ga0207639_10075544 | Ga0207639_100755443 | 234 |
| 119 | 3300028379 | Ga0268266_10000393 | Ga0268266_1000039335 | 234 |
| 120 | 3300028379 | Ga0268266_10238203 | Ga0268266_102382032 | 234 |
| 121 | 3300046455 | Ga0495603_0279728 | Ga0495603_0279728_184_888 | 234 |
| 122 | 3300046460 | Ga0495638_0078888 | Ga0495638_0078888_1263_1973 | 234 |
| 123 | 3300046499 | Ga0495594_0060980 | Ga0495594_0060980_412_1116 | 234 |
| 124 | 3300053092 | Ga0500583_0144468 | Ga0500583_0144468_317_1027 | 234 |
| 125 | 3300053115 | Ga0500591_113879 | Ga0500591_113879_155_865 | 234 |
| 126 | 3300053153 | Ga0500616_0000018 | Ga0500616_0000018_421524_422330 | 234 |
| 127 | 3300053163 | Ga0500639_080223 | Ga0500639_080223_491_1201 | 234 |
| 128 | 3300003320 | rootH2_10339593 | rootH2_103395932 | 235 |
| 129 | 3300005293 | Ga0065715_10015284 | Ga0065715_100152843 | 235 |
| 130 | 3300005329 | Ga0070683_100145232 | Ga0070683_1001452322 | 235 |
| 131 | 3300005436 | Ga0070713_100146421 | Ga0070713_1001464212 | 235 |
| 132 | 3300005437 | Ga0070710_10005293 | Ga0070710_100052934 | 235 |
| 133 | 3300005439 | Ga0070711_100095116 | Ga0070711_1000951163 | 235 |
| 134 | 3300005458 | Ga0070681_10187257 | Ga0070681_101872574 | 235 |
| 135 | 3300005535 | Ga0070684_100030983 | Ga0070684_1000309834 | 235 |
| 136 | 3300005539 | Ga0068853_100031334 | Ga0068853_1000313342 | 235 |
| 137 | 3300005563 | Ga0068855_100481812 | Ga0068855_1004818122 | 235 |
| 138 | 3300005616 | Ga0068852_100158009 | Ga0068852_1001580092 | 235 |
| 139 | 3300006173 | Ga0070716_100000056 | Ga0070716_10000005612 | 235 |
| 140 | 3300006175 | Ga0070712_100005996 | Ga0070712_1000059967 | 235 |
| 141 | 3300009093 | Ga0105240_10299165 | Ga0105240_102991651 | 235 |
| 142 | 3300009174 | Ga0105241_10052084 | Ga0105241_100520843 | 235 |
| 143 | 3300009551 | Ga0105238_10146329 | Ga0105238_101463292 | 235 |
| 144 | 3300009553 | Ga0105249_10504848 | Ga0105249_105048482 | 235 |
| 145 | 3300013307 | Ga0157372_10065711 | Ga0157372_100657112 | 235 |
| 146 | 3300013307 | Ga0157372_10665140 | Ga0157372_106651402 | 235 |
| 147 | 3300013308 | Ga0157375_10042251 | Ga0157375_100422511 | 235 |
| 148 | 3300025898 | Ga0207692_10035414 | Ga0207692_100354143 | 235 |
| 149 | 3300025906 | Ga0207699_10093416 | Ga0207699_100934162 | 235 |
| 150 | 3300025913 | Ga0207695_10218898 | Ga0207695_102188982 | 235 |
| 151 | 3300025915 | Ga0207693_10001666 | Ga0207693_100016667 | 235 |
| 152 | 3300025928 | Ga0207700_10760965 | Ga0207700_107609651 | 235 |
| 153 | 3300025939 | Ga0207665_10000267 | Ga0207665_1000026718 | 235 |
| 154 | 3300025944 | Ga0207661_10111546 | Ga0207661_101115462 | 235 |
| 155 | 3300031249 | Ga0265339_10043272 | Ga0265339_100432723 | 235 |
| 156 | 3300031456 | Ga0307513_10000013 | Ga0307513_10000013297 | 235 |
| 157 | 3300046472 | Ga0495580_0002984 | Ga0495580_0002984_1120_1827 | 235 |
| 158 | 3300046472 | Ga0495580_0386283 | Ga0495580_0386283_227_934 | 235 |
| 159 | 3300046543 | Ga0495645_0070657 | Ga0495645_0070657_1522_2229 | 235 |
| 160 | 3300046678 | Ga0495599_0172933 | Ga0495599_0172933_281_988 | 235 |
| 161 | 3300046690 | Ga0495624_0437110 | Ga0495624_0437110_27_734 | 235 |
| 162 | 3300005295 | Ga0065707_10285571 | Ga0065707_102855712 | 236 |
| 163 | 3300005328 | Ga0070676_10068132 | Ga0070676_100681323 | 236 |
| 164 | 3300005331 | Ga0070670_100367844 | Ga0070670_1003678442 | 236 |
| 165 | 3300005338 | Ga0068868_100056340 | Ga0068868_1000563403 | 236 |
| 166 | 3300005364 | Ga0070673_100056457 | Ga0070673_1000564574 | 236 |
| 167 | 3300005366 | Ga0070659_100081705 | Ga0070659_1000817053 | 236 |
| 168 | 3300005456 | Ga0070678_100444146 | Ga0070678_1004441461 | 236 |
| 169 | 3300005458 | Ga0070681_10151007 | Ga0070681_101510073 | 236 |
| 170 | 3300005518 | Ga0070699_100168601 | Ga0070699_1001686013 | 236 |
| 171 | 3300005548 | Ga0070665_100018787 | Ga0070665_1000187874 | 236 |
| 172 | 3300005548 | Ga0070665_100382423 | Ga0070665_1003824232 | 236 |
| 173 | 3300005718 | Ga0068866_10300109 | Ga0068866_103001091 | 236 |
| 174 | 3300005841 | Ga0068863_100178772 | Ga0068863_1001787722 | 236 |
| 175 | 3300005842 | Ga0068858_100159739 | Ga0068858_1001597392 | 236 |
| 176 | 3300006028 | Ga0070717_10046273 | Ga0070717_100462733 | 236 |
| 177 | 3300006038 | Ga0075365_10551862 | Ga0075365_105518621 | 236 |
| 178 | 3300006237 | Ga0097621_100004075 | Ga0097621_1000040756 | 236 |
| 179 | 3300006237 | Ga0097621_100189181 | Ga0097621_1001891812 | 236 |
| 180 | 3300006358 | Ga0068871_100029160 | Ga0068871_1000291604 | 236 |
| 181 | 3300006358 | Ga0068871_100045043 | Ga0068871_1000450433 | 236 |
| 182 | 3300006881 | Ga0068865_100003802 | Ga0068865_1000038028 | 236 |
| 183 | 3300006881 | Ga0068865_100008780 | Ga0068865_1000087806 | 236 |
| 184 | 3300009098 | Ga0105245_10001164 | Ga0105245_1000116418 | 236 |
| 185 | 3300009098 | Ga0105245_10051685 | Ga0105245_100516851 | 236 |
| 186 | 3300009148 | Ga0105243_10111388 | Ga0105243_101113882 | 236 |
| 187 | 3300009176 | Ga0105242_10003541 | Ga0105242_1000354111 | 236 |
| 188 | 3300009176 | Ga0105242_10010057 | Ga0105242_100100573 | 236 |
| 189 | 3300009177 | Ga0105248_10075490 | Ga0105248_100754904 | 236 |
| 190 | 3300009177 | Ga0105248_10099183 | Ga0105248_100991832 | 236 |
| 191 | 3300009551 | Ga0105238_11074268 | Ga0105238_110742682 | 236 |
| 192 | 3300010375 | Ga0105239_10398327 | Ga0105239_103983272 | 236 |
| 193 | 3300013296 | Ga0157374_10009591 | Ga0157374_100095914 | 236 |
| 194 | 3300013297 | Ga0157378_10147200 | Ga0157378_101472002 | 236 |
| 195 | 3300013306 | Ga0163162_10073403 | Ga0163162_100734033 | 236 |
| 196 | 3300013306 | Ga0163162_10162161 | Ga0163162_101621612 | 236 |
| 197 | 3300014325 | Ga0163163_10336916 | Ga0163163_103369162 | 236 |
| 198 | 3300014969 | Ga0157376_10001677 | Ga0157376_1000167718 | 236 |
| 199 | 3300014969 | Ga0157376_10859300 | Ga0157376_108593001 | 236 |
| 200 | 3300025899 | Ga0207642_10404068 | Ga0207642_104040681 | 236 |
| 201 | 3300025907 | Ga0207645_10058730 | Ga0207645_100587302 | 236 |
| 202 | 3300025912 | Ga0207707_10114193 | Ga0207707_101141934 | 236 |
| 203 | 3300025927 | Ga0207687_10024221 | Ga0207687_100242213 | 236 |
| 204 | 3300025928 | Ga0207700_10079777 | Ga0207700_100797771 | 236 |
| 205 | 3300025932 | Ga0207690_10049626 | Ga0207690_100496264 | 236 |
| 206 | 3300025934 | Ga0207686_10023928 | Ga0207686_100239283 | 236 |
| 207 | 3300025934 | Ga0207686_10064913 | Ga0207686_100649134 | 236 |
| 208 | 3300025938 | Ga0207704_10025208 | Ga0207704_100252084 | 236 |
| 209 | 3300025938 | Ga0207704_10186214 | Ga0207704_101862142 | 236 |
| 210 | 3300025941 | Ga0207711_10156460 | Ga0207711_101564601 | 236 |
| 211 | 3300025942 | Ga0207689_10349946 | Ga0207689_103499462 | 236 |
| 212 | 3300025960 | Ga0207651_10051869 | Ga0207651_100518692 | 236 |
| 213 | 3300026023 | Ga0207677_10053976 | Ga0207677_100539763 | 236 |
| 214 | 3300026035 | Ga0207703_10219582 | Ga0207703_102195822 | 236 |
| 215 | 3300026088 | Ga0207641_10156476 | Ga0207641_101564762 | 236 |
| 216 | 3300026089 | Ga0207648_10063810 | Ga0207648_100638102 | 236 |
| 217 | 3300026095 | Ga0207676_10267809 | Ga0207676_102678092 | 236 |
| 218 | 3300026121 | Ga0207683_10240233 | Ga0207683_102402332 | 236 |
| 219 | 3300028379 | Ga0268266_10824009 | Ga0268266_108240091 | 236 |
| 220 | 3300035113 | Ga0373936_0222951 | Ga0373936_0222951_49_774 | 236 |
| 221 | 3300046615 | Ga0495656_0294185 | Ga0495656_0294185_11_763 | 236 |
| 222 | 3300048907 | Ga0496104_0232065 | Ga0496104_0232065_943_1683 | 236 |
| 223 | 3300048929 | Ga0496126_0015795 | Ga0496126_0015795_501_1211 | 236 |
| 224 | 3300046500 | Ga0495596_0033072 | Ga0495596_0033072_274_996 | 238 |
| 225 | 3300000546 | LJNas_1000194 | LJNas_10001945 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a4v-assembly1.cif.gz_A | crystal structure of a truncated mutant of yeast nuclear thiol peroxidase | 0.776 | 63 | 196 |
| 4hqs-assembly1.cif.gz_A | crystal structure of the pneumoccocal exposed lipoprotein thioredoxin sp_0659 (etrx1) from streptococcus pneumoniae strain tigr4 | 0.754 | 71 | 196 |
| 3p7x-assembly1.cif.gz_A | crystal structure of an atypical two-cysteine peroxiredoxin (saouhsc_01822) from staphylococcus aureus nctc8325 | 0.7396 | 63 | 196 |
| 2e2m-assembly1.cif.gz_F | crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfinic acid form) | 0.7347 | 63 | 191 |
| 2e2m-assembly1.cif.gz_H | crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfinic acid form) | 0.7328 | 63 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O94561_50_193_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8042 | 71 | 196 | 3.40.30.10 |
| 3gzrB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.791 | 178 | 195 | 3.10.450.50 |
| 4hqsA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.754 | 71 | 196 | 3.40.30.10 |
| af_Q8IJD0_13_158_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7473 | 73 | 195 | 3.40.30.10 |
| af_Q9D1A0_27_140_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7459 | 72 | 168 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C4B471-F1-model_v4 | deleted | 0.9598 | 13 | 211 |
|
| AF-C4B471-F1-model_v4 | deleted | 0.9237 | 13 | 211 |
|
| AF-A0A7W8K612-F1-model_v4 | Putative dithiol-disulfide oxidoreductase (DUF899 family) | 0.914 | 14 | 227 |
|
| AF-A0A4R2X5K9-F1-model_v4 | deleted | 0.8995 | 12 | 222 |
|
| AF-A0A3N5MK97-F1-model_v4 | DUF899 domain-containing protein | 0.8954 | 97 | 215 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar