F338298

General Info

Members Datasets Scaffolds Average Seq Length
225 172 191 235

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000018|Ga0500616_0000018_421524_422330
Length 268
Sequence MPTAKLQKSAPTCRFDPSWLVFLQEPPNEDTCMPANPPLTPAAELVKLNPTRIPNESAEYRRARQALLIEEIELRRHIERVAEQRRGLPPGGRVTKNYQFVGERGPASFADLFGDKQSLVVYSYMFGPQRERPCPMCTSLLSAWDGEARDVDQRTSLVVIARSPIERLVAFKKERGWRNLRLYSDPSQEFSRDYFAITPDGGDTAAFNVFTRRDGEIRHFWAGEMGGETADPGQDPRGAPDLMPLWTILDCVPEGRGTDWYPKLDYDR

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
8 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
9 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
10 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
11 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
12 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
13 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
14 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
15 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
16 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
17 2904699407
18 2906610324
19 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
20 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
21 2909042592 Labrys sp. LIt4 Isolate Nodule
22 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
23 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
24 2922425934
25 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
26 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
27 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
28 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
29 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
30 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
166 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
167 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
168 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
169 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
170 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
171 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
172 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.04
Metatranscriptomes 0
Isolates 13.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 10.22
Rhizoplane 2.22
Rhizosphere 73.78
Stem 0
Stem Tuber 0
Unclassified 7.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000194 3300000546 Bacteria 10234
2 rootH2_10339593 3300003320 Bacteria 1202
3 rootL2_10045747 3300003322 Bacteria 1791
4 JGI25404J52841_10007317 3300003659 Bacteria 2333
5 Ga0065165_1031277 3300005262 Bacteria 1684
6 Ga0065715_10015284 3300005293 Unclassified 1954
7 Ga0065707_10285571 3300005295 Bacteria 1037
8 Ga0070658_10003290 3300005327 Bacteria 13332
9 Ga0070676_10068132 3300005328 Bacteria 2130
10 Ga0070683_100145232 3300005329 Bacteria 2248
11 Ga0070670_100367844 3300005331 Bacteria 1265
12 Ga0070680_100073576 3300005336 Bacteria 2811
13 Ga0068868_100056340 3300005338 Bacteria 3104
14 Ga0068868_100796602 3300005338 Bacteria 852
15 Ga0070660_100400961 3300005339 Bacteria 1134
16 Ga0070673_100056457 3300005364 Bacteria 3098
17 Ga0070659_100081705 3300005366 Bacteria 2581
18 Ga0070713_100146421 3300005436 Bacteria 2097
19 Ga0070710_10005293 3300005437 Bacteria 6118
20 Ga0070711_100095116 3300005439 Bacteria 2155
21 Ga0070678_100444146 3300005456 Bacteria 1135
22 Ga0070681_10138996 3300005458 Unclassified 2359
23 Ga0070681_10151007 3300005458 Bacteria 2249
24 Ga0070681_10187257 3300005458 Bacteria 1990
25 Ga0070699_100168601 3300005518 Bacteria 1940
26 Ga0070679_100044638 3300005530 Bacteria 4415
27 Ga0070684_100030983 3300005535 Bacteria 4550
28 Ga0070684_100537126 3300005535 Bacteria 1084
29 Ga0068853_100031334 3300005539 Bacteria 4498
30 Ga0070665_100001293 3300005548 Bacteria 29949
31 Ga0070665_100011567 3300005548 Bacteria 8923
32 Ga0070665_100018787 3300005548 Bacteria 6930
33 Ga0070665_100382423 3300005548 Bacteria 1415
34 Ga0068855_100048848 3300005563 Bacteria 4992
35 Ga0068855_100481812 3300005563 Bacteria 1350
36 Ga0068856_100269561 3300005614 Bacteria 1718
37 Ga0068852_100158009 3300005616 Bacteria 2114
38 Ga0068859_100149989 3300005617 Bacteria 2407
39 Ga0068866_10300109 3300005718 Unclassified 1003
40 Ga0068863_100178772 3300005841 Bacteria 2037
41 Ga0068863_100291886 3300005841 Unclassified 1581
42 Ga0068858_100159739 3300005842 Bacteria 2122
43 Ga0070717_10046273 3300006028 Bacteria 3560
44 Ga0075365_10219510 3300006038 Bacteria 1333
45 Ga0075365_10551862 3300006038 Bacteria 815
46 Ga0075364_10060263 3300006051 Bacteria 2489
47 Ga0070716_100000056 3300006173 Bacteria 43733
48 Ga0070712_100005996 3300006175 Bacteria 7518
49 Ga0097621_100004075 3300006237 Bacteria 10139
50 Ga0097621_100189181 3300006237 Bacteria 1782
51 Ga0068871_100029160 3300006358 Bacteria 4332
52 Ga0068871_100045043 3300006358 Bacteria 3549
53 Ga0068865_100003802 3300006881 Bacteria 9063
54 Ga0068865_100008780 3300006881 Bacteria 6248
55 Ga0097620_100149984 3300006931 Bacteria 2407
56 Ga0099822_1002963 3300006943 Bacteria 21553
57 Ga0099794_10236956 3300007265 Bacteria 940
58 Ga0105240_10003801 3300009093 Bacteria 23322
59 Ga0105240_10042118 3300009093 Bacteria 5822
60 Ga0105240_10299165 3300009093 Unclassified 1841
61 Ga0105240_10490092 3300009093 Bacteria 1369
62 Ga0105245_10001164 3300009098 Bacteria 23809
63 Ga0105245_10051685 3300009098 Bacteria 3684
64 Ga0105243_10111388 3300009148 Bacteria 2291
65 Ga0105241_10043750 3300009174 Bacteria 3392
66 Ga0105241_10052084 3300009174 Bacteria 3124
67 Ga0105242_10003541 3300009176 Bacteria 12140
68 Ga0105242_10010057 3300009176 Bacteria 7245
69 Ga0105248_10075490 3300009177 Bacteria 3789
70 Ga0105248_10099183 3300009177 Bacteria 3282
71 Ga0105237_10000645 3300009545 Bacteria 48648
72 Ga0105237_10026247 3300009545 Bacteria 5953
73 Ga0105237_10049205 3300009545 Bacteria 4238
74 Ga0105237_10161194 3300009545 Bacteria 2241
75 Ga0105238_10088296 3300009551 Bacteria 3087
76 Ga0105238_10146329 3300009551 Bacteria 2339
77 Ga0105238_10404944 3300009551 Bacteria 1358
78 Ga0105238_11074268 3300009551 Unclassified 827
79 Ga0105249_10504848 3300009553 Unclassified 1255
80 Ga0105249_10571666 3300009553 Bacteria 1183
81 Ga0105239_10000572 3300010375 Bacteria 52626
82 Ga0105239_10024246 3300010375 Bacteria 6682
83 Ga0105239_10398327 3300010375 Bacteria 1558
84 Ga0157374_10009591 3300013296 Bacteria 8313
85 Ga0157378_10147200 3300013297 Bacteria 2192
86 Ga0157378_10773678 3300013297 Bacteria 984
87 Ga0163162_10073403 3300013306 Bacteria 3477
88 Ga0163162_10162161 3300013306 Bacteria 2358
89 Ga0163162_10686721 3300013306 Bacteria 1146
90 Ga0157372_10064374 3300013307 Bacteria 4114
91 Ga0157372_10065711 3300013307 Bacteria 4074
92 Ga0157372_10665140 3300013307 Bacteria 1213
93 Ga0157375_10042251 3300013308 Bacteria 4411
94 Ga0163163_10336916 3300014325 Bacteria 1563
95 Ga0163163_10438294 3300014325 Unclassified 1366
96 Ga0163163_10505565 3300014325 Bacteria 1270
97 Ga0157376_10001677 3300014969 Bacteria 14711
98 Ga0157376_10859300 3300014969 Bacteria 923
99 Ga0209564_1000164 3300025295 Bacteria 160675
100 Ga0207692_10035414 3300025898 Bacteria 2425
101 Ga0207642_10404068 3300025899 Unclassified 818
102 Ga0207699_10093416 3300025906 Bacteria 1893
103 Ga0207645_10058730 3300025907 Bacteria 2456
104 Ga0207705_10053353 3300025909 Unclassified 2912
105 Ga0207654_10069003 3300025911 Bacteria 2093
106 Ga0207707_10114193 3300025912 Bacteria 2360
107 Ga0207695_10002668 3300025913 Bacteria 26071
108 Ga0207695_10218898 3300025913 Bacteria 1812
109 Ga0207695_10351522 3300025913 Bacteria 1361
110 Ga0207671_10066793 3300025914 Bacteria 2677
111 Ga0207671_10088699 3300025914 Bacteria 2327
112 Ga0207693_10001666 3300025915 Bacteria 19582
113 Ga0207657_10085858 3300025919 Unclassified 2635
114 Ga0207652_10038610 3300025921 Bacteria 4049
115 Ga0207687_10024221 3300025927 Bacteria 4052
116 Ga0207700_10079777 3300025928 Bacteria 2550
117 Ga0207700_10277429 3300025928 Bacteria 1441
118 Ga0207700_10760965 3300025928 Bacteria 866
119 Ga0207690_10049626 3300025932 Bacteria 2799
120 Ga0207686_10023928 3300025934 Bacteria 3532
121 Ga0207686_10064913 3300025934 Bacteria 2326
122 Ga0207704_10025208 3300025938 Bacteria 3241
123 Ga0207704_10186214 3300025938 Unclassified 1505
124 Ga0207665_10000267 3300025939 Bacteria 36262
125 Ga0207711_10156460 3300025941 Unclassified 2060
126 Ga0207689_10349946 3300025942 Bacteria 1228
127 Ga0207661_10111546 3300025944 Bacteria 2314
128 Ga0207667_10034601 3300025949 Bacteria 5424
129 Ga0207651_10051869 3300025960 Bacteria 2794
130 Ga0207658_10281436 3300025986 Bacteria 1426
131 Ga0207677_10053976 3300026023 Bacteria 2739
132 Ga0207703_10219582 3300026035 Bacteria 1699
133 Ga0207639_10042752 3300026041 Bacteria 3398
134 Ga0207639_10075544 3300026041 Bacteria 2650
135 Ga0207641_10156476 3300026088 Bacteria 2068
136 Ga0207641_10222506 3300026088 Unclassified 1751
137 Ga0207648_10063810 3300026089 Bacteria 3210
138 Ga0207676_10267809 3300026095 Bacteria 1546
139 Ga0207683_10240233 3300026121 Bacteria 1652
140 Ga0209588_1009395 3300027671 Bacteria 2923
141 Ga0268266_10000393 3300028379 Bacteria 66214
142 Ga0268266_10238203 3300028379 Bacteria 1678
143 Ga0268266_10824009 3300028379 Bacteria 896
144 Ga0265339_10043272 3300031249 Bacteria 2491
145 Ga0307513_10000013 3300031456 Bacteria 325682
146 Ga0307416_100238202 3300032002 Bacteria 1761
147 Ga0315911_1000011 3300033442 Bacteria 264678
148 Ga0373936_0222951 3300035113 Unclassified 837
149 Ga0495617_000038 3300046452 Bacteria 132535
150 Ga0495603_0279728 3300046455 Unclassified 959
151 Ga0495638_0078888 3300046460 Bacteria 2003
152 Ga0495580_0002984 3300046472 Bacteria 14514
153 Ga0495580_0386283 3300046472 Bacteria 945
154 Ga0495639_0271566 3300046475 Bacteria 841
155 Ga0495594_0060980 3300046499 Bacteria 2087
156 Ga0495596_0033072 3300046500 Bacteria 2059
157 Ga0495606_0083584 3300046507 Bacteria 1979
158 Ga0495620_0000016 3300046515 Bacteria 153638
159 Ga0495632_0009319 3300046519 Bacteria 5927
160 Ga0495648_0002741 3300046524 Bacteria 15912
161 Ga0495648_0023290 3300046524 Bacteria 4245
162 Ga0495648_0088111 3300046524 Bacteria 1745
163 Ga0495642_0019294 3300046528 Bacteria 2672
164 Ga0495645_0070657 3300046543 Bacteria 2519
165 Ga0495656_0294185 3300046615 Unclassified 831
166 Ga0495611_0000036 3300046648 Bacteria 102447
167 Ga0495599_0172933 3300046678 Bacteria 1332
168 Ga0495624_0437110 3300046690 Bacteria 784
169 Ga0495683_0017525 3300047323 Bacteria 3712
170 Ga0495687_009275 3300047443 Bacteria 5520
171 Ga0495673_0000291 3300047469 Bacteria 67241
172 Ga0495686_0020790 3300047472 Bacteria 4373
173 Ga0496102_0163460 3300048905 Bacteria 2094
174 Ga0496104_0232065 3300048907 Bacteria 1757
175 Ga0496107_0143791 3300048910 Bacteria 1763
176 Ga0496121_0249159 3300048924 Bacteria 1233
177 Ga0496122_0070654 3300048925 Bacteria 2492
178 Ga0496126_0009826 3300048929 Bacteria 10129
179 Ga0496126_0015795 3300048929 Bacteria 7584
180 Ga0496126_0136325 3300048929 Bacteria 2117
181 Ga0501036_0215064 3300049572 Bacteria 1615
182 Ga0501047_0003609 3300049581 Bacteria 14583
183 nmdc:mga00v17_54394_c1 3300050491 Bacteria 2441
184 nmdc:mga0yw44_208410_c1 3300050492 Bacteria 1292
185 Ga0500583_0144468 3300053092 Bacteria 1183
186 Ga0500591_113879 3300053115 Bacteria 1127
187 Ga0500577_0000483 3300053142 Bacteria 10273
188 Ga0500616_0000018 3300053153 Bacteria 610976
189 Ga0500633_0060052 3300053160 Bacteria 1335
190 Ga0500639_080223 3300053163 Bacteria 1645
191 Ga0500645_083581 3300053730 Bacteria 910

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046475 Ga0495639_0271566 Ga0495639_0271566_69_668 199
2 3300048924 Ga0496121_0249159 Ga0496121_0249159_515_1210 207
3 3300046528 Ga0495642_0019294 Ga0495642_0019294_1532_2233 210
4 3300048905 Ga0496102_0163460 Ga0496102_0163460_1157_1852 214
5 3300048910 Ga0496107_0143791 Ga0496107_0143791_1018_1713 214
6 3300048929 Ga0496126_0136325 Ga0496126_0136325_212_907 214
7 3300046507 Ga0495606_0083584 Ga0495606_0083584_841_1563 222
8 3300047443 Ga0495687_009275 Ga0495687_009275_1448_2170 222
9 3300003322 rootL2_10045747 rootL2_100457472 226
10 iso_pu_bacteria 2513237096 2513660108 227
11 iso_pu_bacteria 2513237137 2513858285 227
12 iso_pu_bacteria 2513237145 2513922082 227
13 iso_pu_bacteria 2517572143 2517893826 227
14 iso_pu_bacteria 2524023228 2524537775 227
15 iso_pu_bacteria 2667528175 2671122819 227
16 iso_pu_bacteria 2728368998 2728747941 227
17 iso_pu_bacteria 2791355197 2793072541 227
18 iso_pu_bacteria 2885374607 2885381584 227
19 iso_pu_bacteria 2903748898 2903751614 227
20 iso_pu_bacteria 2904578770 2904581725 227
21 iso_pu_bacteria 2904690495 2904691601 227
22 iso_pu_bacteria 2904699407 2904705097 227
23 iso_pu_bacteria 2906610324 2906610706 227
24 iso_pu_bacteria 2908739725 2908744225 227
25 iso_pu_bacteria 2908756301 2908761866 227
26 iso_pu_bacteria 2919119836 2919123391 227
27 iso_pu_bacteria 2919171160 2919175518 227
28 iso_pu_bacteria 2922425934 2922428612 227
29 iso_pu_bacteria 2935630451 2935634586 227
30 iso_pu_bacteria 2941507105 2941509072 227
31 iso_pu_bacteria 2941515067 2941516901 227
32 iso_pu_bacteria 2941523033 2941525004 227
33 iso_pu_bacteria 3005474847 3005478742 227
34 iso_pu_bacteria 8006933436 8006942601 227
35 iso_pu_bacteria 8006964411 8006964732 227
36 iso_pu_bacteria 8006973647 8006982329 227
37 iso_pu_bacteria 8019555841 8019558372 227
38 iso_pu_bacteria 8019565922 8019566922 227
39 3300047323 Ga0495683_0017525 Ga0495683_0017525_1697_2419 228
40 iso_pu_bacteria 2765235802 2765466748 228
41 3300006051 Ga0075364_10060263 Ga0075364_100602632 230
42 3300026041 Ga0207639_10042752 Ga0207639_100427522 230
43 3300048925 Ga0496122_0070654 Ga0496122_0070654_769_1467 230
44 3300050491 nmdc:mga00v17_54394_c1 nmdc:mga00v17_54394_c1_1036_1734 230
45 3300050492 nmdc:mga0yw44_208410_c1 nmdc:mga0yw44_208410_c1_12_710 230
46 iso_pu_bacteria 2511231027 2511392517 230
47 iso_pu_bacteria 2842871566 2842874383 230
48 iso_pu_bacteria 2895395659 2895396804 230
49 iso_pu_bacteria 2909042592 2909048388 230
50 3300003659 JGI25404J52841_10007317 JGI25404J52841_100073172 231
51 3300006038 Ga0075365_10219510 Ga0075365_102195101 231
52 3300006943 Ga0099822_1002963 Ga0099822_100296311 231
53 3300009553 Ga0105249_10571666 Ga0105249_105716662 231
54 3300025295 Ga0209564_1000164 Ga0209564_1000164145 231
55 3300032002 Ga0307416_100238202 Ga0307416_1002382022 231
56 3300033442 Ga0315911_1000011 Ga0315911_100001112 231
57 3300046524 Ga0495648_0023290 Ga0495648_0023290_3315_4016 231
58 3300048929 Ga0496126_0009826 Ga0496126_0009826_178_879 231
59 3300053142 Ga0500577_0000483 Ga0500577_0000483_7008_7709 231
60 3300053730 Ga0500645_083581 Ga0500645_083581_129_830 231
61 3300005262 Ga0065165_1031277 Ga0065165_10312772 232
62 3300005327 Ga0070658_10003290 Ga0070658_100032902 232
63 3300005336 Ga0070680_100073576 Ga0070680_1000735763 232
64 3300005339 Ga0070660_100400961 Ga0070660_1004009612 232
65 3300005458 Ga0070681_10138996 Ga0070681_101389962 232
66 3300005530 Ga0070679_100044638 Ga0070679_1000446386 232
67 3300005535 Ga0070684_100537126 Ga0070684_1005371262 232
68 3300005563 Ga0068855_100048848 Ga0068855_1000488484 232
69 3300005614 Ga0068856_100269561 Ga0068856_1002695611 232
70 3300005841 Ga0068863_100291886 Ga0068863_1002918861 232
71 3300007265 Ga0099794_10236956 Ga0099794_102369562 232
72 3300009093 Ga0105240_10042118 Ga0105240_100421183 232
73 3300009545 Ga0105237_10026247 Ga0105237_100262473 232
74 3300010375 Ga0105239_10024246 Ga0105239_100242462 232
75 3300013297 Ga0157378_10773678 Ga0157378_107736782 232
76 3300013307 Ga0157372_10064374 Ga0157372_100643742 232
77 3300014325 Ga0163163_10438294 Ga0163163_104382942 232
78 3300014325 Ga0163163_10505565 Ga0163163_105055652 232
79 3300025909 Ga0207705_10053353 Ga0207705_100533532 232
80 3300025914 Ga0207671_10066793 Ga0207671_100667933 232
81 3300025919 Ga0207657_10085858 Ga0207657_100858582 232
82 3300025921 Ga0207652_10038610 Ga0207652_100386106 232
83 3300025949 Ga0207667_10034601 Ga0207667_100346014 232
84 3300026088 Ga0207641_10222506 Ga0207641_102225062 232
85 3300027671 Ga0209588_1009395 Ga0209588_10093952 232
86 3300046524 Ga0495648_0088111 Ga0495648_0088111_790_1515 232
87 3300046452 Ga0495617_000038 Ga0495617_000038_65566_66273 233
88 3300046515 Ga0495620_0000016 Ga0495620_0000016_86687_87394 233
89 3300046519 Ga0495632_0009319 Ga0495632_0009319_3544_4251 233
90 3300046524 Ga0495648_0002741 Ga0495648_0002741_12868_13575 233
91 3300046648 Ga0495611_0000036 Ga0495611_0000036_87219_87926 233
92 3300047469 Ga0495673_0000291 Ga0495673_0000291_37983_38690 233
93 3300047472 Ga0495686_0020790 Ga0495686_0020790_2012_2719 233
94 3300049572 Ga0501036_0215064 Ga0501036_0215064_133_846 233
95 3300049581 Ga0501047_0003609 Ga0501047_0003609_8706_9419 233
96 3300053160 Ga0500633_0060052 Ga0500633_0060052_226_933 233
97 3300005338 Ga0068868_100796602 Ga0068868_1007966021 234
98 3300005548 Ga0070665_100001293 Ga0070665_10000129324 234
99 3300005548 Ga0070665_100011567 Ga0070665_1000115672 234
100 3300005617 Ga0068859_100149989 Ga0068859_1001499892 234
101 3300006931 Ga0097620_100149984 Ga0097620_1001499842 234
102 3300009093 Ga0105240_10003801 Ga0105240_100038014 234
103 3300009093 Ga0105240_10490092 Ga0105240_104900922 234
104 3300009174 Ga0105241_10043750 Ga0105241_100437502 234
105 3300009545 Ga0105237_10000645 Ga0105237_100006451 234
106 3300009545 Ga0105237_10049205 Ga0105237_100492053 234
107 3300009545 Ga0105237_10161194 Ga0105237_101611942 234
108 3300009551 Ga0105238_10088296 Ga0105238_100882961 234
109 3300009551 Ga0105238_10404944 Ga0105238_104049442 234
110 3300010375 Ga0105239_10000572 Ga0105239_1000057212 234
111 3300013306 Ga0163162_10686721 Ga0163162_106867212 234
112 3300025911 Ga0207654_10069003 Ga0207654_100690032 234
113 3300025913 Ga0207695_10002668 Ga0207695_100026681 234
114 3300025913 Ga0207695_10351522 Ga0207695_103515222 234
115 3300025914 Ga0207671_10088699 Ga0207671_100886994 234
116 3300025928 Ga0207700_10277429 Ga0207700_102774292 234
117 3300025986 Ga0207658_10281436 Ga0207658_102814362 234
118 3300026041 Ga0207639_10075544 Ga0207639_100755443 234
119 3300028379 Ga0268266_10000393 Ga0268266_1000039335 234
120 3300028379 Ga0268266_10238203 Ga0268266_102382032 234
121 3300046455 Ga0495603_0279728 Ga0495603_0279728_184_888 234
122 3300046460 Ga0495638_0078888 Ga0495638_0078888_1263_1973 234
123 3300046499 Ga0495594_0060980 Ga0495594_0060980_412_1116 234
124 3300053092 Ga0500583_0144468 Ga0500583_0144468_317_1027 234
125 3300053115 Ga0500591_113879 Ga0500591_113879_155_865 234
126 3300053153 Ga0500616_0000018 Ga0500616_0000018_421524_422330 234
127 3300053163 Ga0500639_080223 Ga0500639_080223_491_1201 234
128 3300003320 rootH2_10339593 rootH2_103395932 235
129 3300005293 Ga0065715_10015284 Ga0065715_100152843 235
130 3300005329 Ga0070683_100145232 Ga0070683_1001452322 235
131 3300005436 Ga0070713_100146421 Ga0070713_1001464212 235
132 3300005437 Ga0070710_10005293 Ga0070710_100052934 235
133 3300005439 Ga0070711_100095116 Ga0070711_1000951163 235
134 3300005458 Ga0070681_10187257 Ga0070681_101872574 235
135 3300005535 Ga0070684_100030983 Ga0070684_1000309834 235
136 3300005539 Ga0068853_100031334 Ga0068853_1000313342 235
137 3300005563 Ga0068855_100481812 Ga0068855_1004818122 235
138 3300005616 Ga0068852_100158009 Ga0068852_1001580092 235
139 3300006173 Ga0070716_100000056 Ga0070716_10000005612 235
140 3300006175 Ga0070712_100005996 Ga0070712_1000059967 235
141 3300009093 Ga0105240_10299165 Ga0105240_102991651 235
142 3300009174 Ga0105241_10052084 Ga0105241_100520843 235
143 3300009551 Ga0105238_10146329 Ga0105238_101463292 235
144 3300009553 Ga0105249_10504848 Ga0105249_105048482 235
145 3300013307 Ga0157372_10065711 Ga0157372_100657112 235
146 3300013307 Ga0157372_10665140 Ga0157372_106651402 235
147 3300013308 Ga0157375_10042251 Ga0157375_100422511 235
148 3300025898 Ga0207692_10035414 Ga0207692_100354143 235
149 3300025906 Ga0207699_10093416 Ga0207699_100934162 235
150 3300025913 Ga0207695_10218898 Ga0207695_102188982 235
151 3300025915 Ga0207693_10001666 Ga0207693_100016667 235
152 3300025928 Ga0207700_10760965 Ga0207700_107609651 235
153 3300025939 Ga0207665_10000267 Ga0207665_1000026718 235
154 3300025944 Ga0207661_10111546 Ga0207661_101115462 235
155 3300031249 Ga0265339_10043272 Ga0265339_100432723 235
156 3300031456 Ga0307513_10000013 Ga0307513_10000013297 235
157 3300046472 Ga0495580_0002984 Ga0495580_0002984_1120_1827 235
158 3300046472 Ga0495580_0386283 Ga0495580_0386283_227_934 235
159 3300046543 Ga0495645_0070657 Ga0495645_0070657_1522_2229 235
160 3300046678 Ga0495599_0172933 Ga0495599_0172933_281_988 235
161 3300046690 Ga0495624_0437110 Ga0495624_0437110_27_734 235
162 3300005295 Ga0065707_10285571 Ga0065707_102855712 236
163 3300005328 Ga0070676_10068132 Ga0070676_100681323 236
164 3300005331 Ga0070670_100367844 Ga0070670_1003678442 236
165 3300005338 Ga0068868_100056340 Ga0068868_1000563403 236
166 3300005364 Ga0070673_100056457 Ga0070673_1000564574 236
167 3300005366 Ga0070659_100081705 Ga0070659_1000817053 236
168 3300005456 Ga0070678_100444146 Ga0070678_1004441461 236
169 3300005458 Ga0070681_10151007 Ga0070681_101510073 236
170 3300005518 Ga0070699_100168601 Ga0070699_1001686013 236
171 3300005548 Ga0070665_100018787 Ga0070665_1000187874 236
172 3300005548 Ga0070665_100382423 Ga0070665_1003824232 236
173 3300005718 Ga0068866_10300109 Ga0068866_103001091 236
174 3300005841 Ga0068863_100178772 Ga0068863_1001787722 236
175 3300005842 Ga0068858_100159739 Ga0068858_1001597392 236
176 3300006028 Ga0070717_10046273 Ga0070717_100462733 236
177 3300006038 Ga0075365_10551862 Ga0075365_105518621 236
178 3300006237 Ga0097621_100004075 Ga0097621_1000040756 236
179 3300006237 Ga0097621_100189181 Ga0097621_1001891812 236
180 3300006358 Ga0068871_100029160 Ga0068871_1000291604 236
181 3300006358 Ga0068871_100045043 Ga0068871_1000450433 236
182 3300006881 Ga0068865_100003802 Ga0068865_1000038028 236
183 3300006881 Ga0068865_100008780 Ga0068865_1000087806 236
184 3300009098 Ga0105245_10001164 Ga0105245_1000116418 236
185 3300009098 Ga0105245_10051685 Ga0105245_100516851 236
186 3300009148 Ga0105243_10111388 Ga0105243_101113882 236
187 3300009176 Ga0105242_10003541 Ga0105242_1000354111 236
188 3300009176 Ga0105242_10010057 Ga0105242_100100573 236
189 3300009177 Ga0105248_10075490 Ga0105248_100754904 236
190 3300009177 Ga0105248_10099183 Ga0105248_100991832 236
191 3300009551 Ga0105238_11074268 Ga0105238_110742682 236
192 3300010375 Ga0105239_10398327 Ga0105239_103983272 236
193 3300013296 Ga0157374_10009591 Ga0157374_100095914 236
194 3300013297 Ga0157378_10147200 Ga0157378_101472002 236
195 3300013306 Ga0163162_10073403 Ga0163162_100734033 236
196 3300013306 Ga0163162_10162161 Ga0163162_101621612 236
197 3300014325 Ga0163163_10336916 Ga0163163_103369162 236
198 3300014969 Ga0157376_10001677 Ga0157376_1000167718 236
199 3300014969 Ga0157376_10859300 Ga0157376_108593001 236
200 3300025899 Ga0207642_10404068 Ga0207642_104040681 236
201 3300025907 Ga0207645_10058730 Ga0207645_100587302 236
202 3300025912 Ga0207707_10114193 Ga0207707_101141934 236
203 3300025927 Ga0207687_10024221 Ga0207687_100242213 236
204 3300025928 Ga0207700_10079777 Ga0207700_100797771 236
205 3300025932 Ga0207690_10049626 Ga0207690_100496264 236
206 3300025934 Ga0207686_10023928 Ga0207686_100239283 236
207 3300025934 Ga0207686_10064913 Ga0207686_100649134 236
208 3300025938 Ga0207704_10025208 Ga0207704_100252084 236
209 3300025938 Ga0207704_10186214 Ga0207704_101862142 236
210 3300025941 Ga0207711_10156460 Ga0207711_101564601 236
211 3300025942 Ga0207689_10349946 Ga0207689_103499462 236
212 3300025960 Ga0207651_10051869 Ga0207651_100518692 236
213 3300026023 Ga0207677_10053976 Ga0207677_100539763 236
214 3300026035 Ga0207703_10219582 Ga0207703_102195822 236
215 3300026088 Ga0207641_10156476 Ga0207641_101564762 236
216 3300026089 Ga0207648_10063810 Ga0207648_100638102 236
217 3300026095 Ga0207676_10267809 Ga0207676_102678092 236
218 3300026121 Ga0207683_10240233 Ga0207683_102402332 236
219 3300028379 Ga0268266_10824009 Ga0268266_108240091 236
220 3300035113 Ga0373936_0222951 Ga0373936_0222951_49_774 236
221 3300046615 Ga0495656_0294185 Ga0495656_0294185_11_763 236
222 3300048907 Ga0496104_0232065 Ga0496104_0232065_943_1683 236
223 3300048929 Ga0496126_0015795 Ga0496126_0015795_501_1211 236
224 3300046500 Ga0495596_0033072 Ga0495596_0033072_274_996 238
225 3300000546 LJNas_1000194 LJNas_10001945 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

50

267

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a4v-assembly1.cif.gz_A crystal structure of a truncated mutant of yeast nuclear thiol peroxidase 0.776 63 196
4hqs-assembly1.cif.gz_A crystal structure of the pneumoccocal exposed lipoprotein thioredoxin sp_0659 (etrx1) from streptococcus pneumoniae strain tigr4 0.754 71 196
3p7x-assembly1.cif.gz_A crystal structure of an atypical two-cysteine peroxiredoxin (saouhsc_01822) from staphylococcus aureus nctc8325 0.7396 63 196
2e2m-assembly1.cif.gz_F crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfinic acid form) 0.7347 63 191
2e2m-assembly1.cif.gz_H crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfinic acid form) 0.7328 63 196
ID Description Score Start End Superfamily
af_O94561_50_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8042 71 196 3.40.30.10
3gzrB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.791 178 195 3.10.450.50
4hqsA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.754 71 196 3.40.30.10
af_Q8IJD0_13_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7473 73 195 3.40.30.10
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7459 72 168 3.40.30.10
ID Description Score Start End GO Terms
AF-C4B471-F1-model_v4 deleted 0.9598 13 211
AF-C4B471-F1-model_v4 deleted 0.9237 13 211
AF-A0A7W8K612-F1-model_v4 Putative dithiol-disulfide oxidoreductase (DUF899 family) 0.914 14 227
AF-A0A4R2X5K9-F1-model_v4 deleted 0.8995 12 222
AF-A0A3N5MK97-F1-model_v4 DUF899 domain-containing protein 0.8954 97 215

Feature Viewer

pLDDT pTM Quality
87.59 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map