F338179

General Info

Members Datasets Scaffolds Average Seq Length
225 137 450 197

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0427710|Ga0496114_0427710_287_865
Length 192
Sequence VTDSAAGPWLVVGLGNPGPEYAGNRHNVGFMVADLLAERIGGRFKSHKSRSQVVEGRLSGERVVLAKPMSFMNVSGGPVTALRDFYKADVGRIVVVHDELDIDYGALRLKKGGGDNGHNGLKSITKSLGPDYHRVRFGVGRPPGRMDVAAFVLRDFSGTERKELGYFVDRAADAVESLIADGLERAQGTYNS

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
62 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
65 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
66 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
67 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
68 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 2506783011 Frankia datiscae Dg1 Isolate Nodule
133 2671180195 Frankia sp. CcI49 Isolate Nodule
134 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
135 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
136 2773857922 Frankia sp. CcI49 Isolate Nodule
137 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0.89
Isolates 2.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.78
Rhizoplane 0.89
Rhizosphere 91.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0427710 3300048917 Bacteria 1173
2 Ga0070683_100049871 3300005329 Bacteria 3873
3 Ga0070709_10017975 3300005434 Bacteria 4063
4 Ga0070714_100065136 3300005435 Bacteria 3138
5 Ga0070714_100159613 3300005435 Bacteria 2039
6 Ga0070714_100298087 3300005435 Bacteria 1502
7 Ga0070714_100430899 3300005435 Bacteria 1250
8 Ga0070713_100011626 3300005436 Bacteria 6421
9 Ga0070713_100195413 3300005436 Bacteria 1825
10 Ga0070713_100303068 3300005436 Bacteria 1471
11 Ga0070710_10001356 3300005437 Bacteria 11552
12 Ga0070711_100049446 3300005439 Bacteria 2880
13 Ga0070708_100017090 3300005445 Bacteria 6041
14 Ga0070708_100022169 3300005445 Bacteria 5383
15 Ga0070681_10175771 3300005458 Bacteria 2063
16 Ga0070706_100000814 3300005467 Bacteria 34562
17 Ga0070706_100021543 3300005467 Bacteria 5935
18 Ga0070706_100021931 3300005467 Bacteria 5881
19 Ga0070706_100044939 3300005467 Bacteria 4079
20 Ga0070706_100096702 3300005467 Bacteria 2741
21 Ga0070706_100331743 3300005467 Bacteria 1418
22 Ga0070707_100000520 3300005468 Bacteria 38416
23 Ga0070707_100001187 3300005468 Bacteria 25634
24 Ga0070707_100008346 3300005468 Bacteria 9617
25 Ga0070707_100015117 3300005468 Bacteria 7244
26 Ga0070707_101051380 3300005468 Bacteria 780
27 Ga0070698_100003500 3300005471 Bacteria 17274
28 Ga0070698_100010209 3300005471 Bacteria 10029
29 Ga0070698_100027314 3300005471 Bacteria 5938
30 Ga0070698_100098586 3300005471 Bacteria 2896
31 Ga0070698_100111243 3300005471 Bacteria 2704
32 Ga0070698_100182672 3300005471 Bacteria 2035
33 Ga0070699_100243127 3300005518 Bacteria 1607
34 Ga0070699_100787413 3300005518 Bacteria 870
35 Ga0070697_100016037 3300005536 Bacteria 5892
36 Ga0068852_101079050 3300005616 Bacteria 823
37 Ga0070717_10044442 3300006028 Bacteria 3627
38 Ga0070717_10123048 3300006028 Bacteria 2224
39 Ga0070717_10195453 3300006028 Bacteria 1769
40 Ga0070717_10357722 3300006028 Bacteria 1306
41 Ga0070717_11051699 3300006028 Bacteria 741
42 Ga0070715_10054890 3300006163 Bacteria 1727
43 Ga0070716_100001723 3300006173 Bacteria 9863
44 Ga0070712_100092552 3300006175 Bacteria 2217
45 Ga0070712_100185816 3300006175 Bacteria 1623
46 Ga0075433_10445418 3300006852 Bacteria 1142
47 Ga0075436_100154969 3300006914 Bacteria 1613
48 Ga0099796_10386617 3300010159 Bacteria 611
49 Ga0157369_10025297 3300013105 Bacteria 6590
50 Ga0157369_10447347 3300013105 Bacteria 1338
51 Ga0157369_10827287 3300013105 Bacteria 951
52 Ga0163163_10150301 3300014325 Bacteria 2373
53 Ga0206353_10799261 3300020082 Bacteria 2299
54 Ga0213874_10018624 3300021377 Bacteria 1879
55 Ga0213875_10000469 3300021388 Bacteria 34620
56 Ga0213875_10003294 3300021388 Bacteria 9241
57 Ga0207692_10261490 3300025898 Bacteria 1041
58 Ga0207685_10254165 3300025905 Bacteria 851
59 Ga0207699_10004403 3300025906 Bacteria 6736
60 Ga0207705_10016579 3300025909 Bacteria 5279
61 Ga0207684_10000749 3300025910 Bacteria 37966
62 Ga0207684_10003280 3300025910 Bacteria 15871
63 Ga0207684_10014941 3300025910 Bacteria 6683
64 Ga0207684_10189384 3300025910 Bacteria 1774
65 Ga0207684_10272007 3300025910 Bacteria 1462
66 Ga0207684_10343093 3300025910 Bacteria 1286
67 Ga0207707_10329175 3300025912 Bacteria 1318
68 Ga0207693_10020413 3300025915 Bacteria 5270
69 Ga0207693_10045506 3300025915 Bacteria 3449
70 Ga0207693_10235507 3300025915 Bacteria 1438
71 Ga0207693_10528399 3300025915 Bacteria 920
72 Ga0207663_10213014 3300025916 Bacteria 1401
73 Ga0207646_10000845 3300025922 Bacteria 39634
74 Ga0207646_10001741 3300025922 Bacteria 26484
75 Ga0207646_10007079 3300025922 Bacteria 11471
76 Ga0207646_10209996 3300025922 Bacteria 1758
77 Ga0207646_10296656 3300025922 Bacteria 1460
78 Ga0207646_10321538 3300025922 Bacteria 1398
79 Ga0207700_10001652 3300025928 Bacteria 12682
80 Ga0207700_10059336 3300025928 Bacteria 2893
81 Ga0207700_10060881 3300025928 Bacteria 2861
82 Ga0207700_10112704 3300025928 Bacteria 2191
83 Ga0207700_10238396 3300025928 Bacteria 1549
84 Ga0207664_10000341 3300025929 Bacteria 34367
85 Ga0207664_10001818 3300025929 Bacteria 14064
86 Ga0207664_10083752 3300025929 Bacteria 2600
87 Ga0207664_10179710 3300025929 Bacteria 1816
88 Ga0207665_10002727 3300025939 Bacteria 11848
89 Ga0207665_10005574 3300025939 Bacteria 8393
90 Ga0207661_10104199 3300025944 Bacteria 2388
91 Ga0207679_10963833 3300025945 Bacteria 781
92 Ga0265337_1000015 3300028556 Bacteria 80871
93 Ga0265319_1000939 3300028563 Bacteria 18253
94 Ga0265334_10001423 3300028573 Bacteria 11505
95 Ga0265318_10012798 3300028577 Bacteria 3559
96 Ga0265323_10012686 3300028653 Bacteria 3371
97 Ga0265336_10020586 3300028666 Bacteria 2115
98 Ga0265338_10001226 3300028800 Bacteria 42364
99 Ga0265338_10001255 3300028800 Bacteria 41829
100 Ga0265338_10020401 3300028800 Bacteria 6971
101 Ga0265324_10002955 3300029957 Bacteria 8319
102 Ga0265763_1001091 3300030763 Bacteria 1856
103 Ga0265320_10026277 3300031240 Bacteria 3049
104 Ga0265325_10005094 3300031241 Bacteria 8176
105 Ga0265339_10023719 3300031249 Bacteria 3545
106 Ga0265316_10016644 3300031344 Bacteria 6373
107 Ga0307513_10015477 3300031456 Bacteria 9246
108 Ga0265313_10009648 3300031595 Bacteria 6235
109 Ga0265314_10033932 3300031711 Bacteria 3734
110 Ga0307413_10483010 3300031824 Bacteria 991
111 Ga0307411_10043346 3300032005 Bacteria 2878
112 Ga0307507_10020898 3300033179 Bacteria 7310
113 Ga0373934_0049057 3300035086 Bacteria 1671
114 Ga0373923_0081119 3300035111 Bacteria 1407
115 Ga0373923_0116800 3300035111 Bacteria 1189
116 Ga0373936_0085693 3300035113 Bacteria 1316
117 Ga0373953_0001933 3300035117 Bacteria 6155
118 Ga0373954_0153897 3300035118 Bacteria 1124
119 Ga0373956_0019946 3300035119 Bacteria 2847
120 Ga0373956_0322620 3300035119 Bacteria 736
121 Ga0373957_0039530 3300035120 Bacteria 1769
122 Ga0373943_0204881 3300035170 Bacteria 1093
123 Ga0373946_0015684 3300035171 Bacteria 2877
124 Ga0373955_0140140 3300035172 Bacteria 1417
125 Ga0373924_0002828 3300035410 Bacteria 5875
126 Ga0373935_0001375 3300035692 Bacteria 13453
127 Ga0373935_0171440 3300035692 Bacteria 1484
128 Ga0373935_0327396 3300035692 Bacteria 1088
129 Ga0373947_0000009 3300035725 Bacteria 172751
130 Ga0373947_0018773 3300035725 Bacteria 3983
131 Ga0373947_0065465 3300035725 Bacteria 2217
132 Ga0373937_0378403 3300036401 Bacteria 1342
133 Ga0373937_0573746 3300036401 Bacteria 1071
134 Ga0373937_0685993 3300036401 Bacteria 970
135 Ga0373925_0000605 3300037068 Bacteria 34184
136 Ga0373925_0004122 3300037068 Bacteria 11032
137 Ga0395900_0141850 3300037418 Bacteria 2460
138 Ga0395898_0060961 3300037466 Bacteria 3665
139 Ga0436364_0806695 3300037853 Bacteria 3392
140 Ga0436364_1326281 3300037853 Bacteria 1058
141 Ga0436364_1351374 3300037853 Bacteria 1481
142 Ga0436364_1518594 3300037853 Bacteria 37293
143 Ga0395901_0038946 3300038443 Bacteria 4917
144 Ga0436363_0359696 3300039450 Bacteria 957
145 Ga0436363_0376026 3300039450 Bacteria 2325
146 Ga0451853_3244085 3300041512 Bacteria 826
147 Ga0439449_0051886 3300042007 Bacteria 1517
148 Ga0466967_0600208 3300045976 Bacteria 1086
149 Ga0495629_0015515 3300046459 Bacteria 5469
150 Ga0495641_0012707 3300046461 Bacteria 4687
151 Ga0495651_0033739 3300046462 Bacteria 3991
152 Ga0495651_0068348 3300046462 Bacteria 2708
153 Ga0495653_0138091 3300046463 Bacteria 1717
154 Ga0495639_0172733 3300046475 Bacteria 1049
155 Ga0495662_0048631 3300046476 Bacteria 2047
156 Ga0495664_0006060 3300046477 Bacteria 6668
157 Ga0495664_0041228 3300046477 Bacteria 2731
158 Ga0495664_0082249 3300046477 Bacteria 1931
159 Ga0495664_0421736 3300046477 Bacteria 800
160 Ga0495618_0016748 3300046514 Bacteria 4489
161 Ga0495628_0010723 3300046516 Bacteria 7762
162 Ga0495628_0062657 3300046516 Bacteria 2914
163 Ga0495628_0080164 3300046516 Bacteria 2538
164 Ga0495628_0084753 3300046516 Bacteria 2459
165 Ga0495630_0066685 3300046517 Bacteria 2705
166 Ga0495652_0014925 3300046529 Bacteria 6961
167 Ga0495652_0030355 3300046529 Bacteria 4741
168 Ga0495652_0606755 3300046529 Bacteria 746
169 Ga0495665_0023956 3300046531 Bacteria 3279
170 Ga0495586_0005477 3300046535 Bacteria 6789
171 Ga0495586_0062221 3300046535 Bacteria 2032
172 Ga0495587_0021135 3300046536 Bacteria 4013
173 Ga0495645_0093906 3300046543 Bacteria 2140
174 Ga0495645_0220782 3300046543 Bacteria 1275
175 Ga0495667_0099574 3300046559 Bacteria 1881
176 Ga0495667_0457428 3300046559 Bacteria 801
177 Ga0495634_0031265 3300046642 Bacteria 3667
178 Ga0495634_0037358 3300046642 Bacteria 3318
179 Ga0495634_0086701 3300046642 Bacteria 2039
180 Ga0495635_0087744 3300046663 Bacteria 2128
181 Ga0495657_0024103 3300046675 Bacteria 4338
182 Ga0495599_0040739 3300046678 Bacteria 2916
183 Ga0495599_0055018 3300046678 Bacteria 2492
184 Ga0495599_0058740 3300046678 Bacteria 2406
185 Ga0495623_0056663 3300046679 Bacteria 2466
186 Ga0495646_0065486 3300046680 Bacteria 2151
187 Ga0495658_0075128 3300046683 Bacteria 1971
188 Ga0495613_0081764 3300046689 Bacteria 2346
189 Ga0495624_0013429 3300046690 Bacteria 5586
190 Ga0495600_0019842 3300046809 Bacteria 4296
191 Ga0495600_0053912 3300046809 Bacteria 2626
192 Ga0495581_0005758 3300047315 Bacteria 7182
193 Ga0495674_0085976 3300047319 Bacteria 2693
194 Ga0495674_0126690 3300047319 Bacteria 2153
195 Ga0495674_0285406 3300047319 Bacteria 1351
196 Ga0495676_0206745 3300047321 Bacteria 1361
197 Ga0495680_0036103 3300047322 Bacteria 3972
198 Ga0495675_0006616 3300047444 Bacteria 7094
199 Ga0495675_0109860 3300047444 Bacteria 1722
200 Ga0495684_0040464 3300047471 Bacteria 3573
201 Ga0495593_0000893 3300047673 Bacteria 17338
202 Ga0495602_0099824 3300048088 Bacteria 2385
203 Ga0495614_0020796 3300048089 Bacteria 2836
204 Ga0496115_0267326 3300048918 Bacteria 1405
205 Ga0496126_0270993 3300048929 Bacteria 1409
206 Ga0501036_0986279 3300049572 Bacteria 690
207 Ga0501038_0065560 3300049574 Bacteria 3094
208 Ga0501038_0325839 3300049574 Bacteria 1201
209 Ga0501047_0199537 3300049581 Bacteria 1862
210 Ga0501073_0613326 3300049589 Bacteria 751
211 nmdc:mga0n895_102491_c1 3300050512 Bacteria 2873
212 nmdc:mga0rr50_100993_c1 3300050513 Bacteria 2267
213 nmdc:mga0rr50_132329_c1 3300050513 Bacteria 1998
214 nmdc:mga08x19_163061_c1 3300050514 Bacteria 1515
215 Ga0495601_0003983 3300053077 Bacteria 8503
216 Ga0495601_0474793 3300053077 Bacteria 808
217 Ga0495612_0035236 3300053078 Bacteria 2028
218 Ga0495595_0004765 3300053084 Bacteria 5460
219 Ga0495619_0004481 3300053085 Bacteria 8919
220 2506865296 2506783011 Bacteria 5323186
221 2671837353 2671180195 Bacteria 9757215
222 2689995258 2687453743 Bacteria 8361025
223 2753074484 2751185734 Bacteria 8863695
224 2774855509 2773857922 Bacteria 9757215
225 2870728941 2870721527 Bacteria 9689237
226 Ga0496114_0427710
227 Ga0070683_100049871
228 Ga0070709_10017975
229 Ga0070714_100065136
230 Ga0070714_100159613
231 Ga0070714_100298087
232 Ga0070714_100430899
233 Ga0070713_100011626
234 Ga0070713_100195413
235 Ga0070713_100303068
236 Ga0070710_10001356
237 Ga0070711_100049446
238 Ga0070708_100017090
239 Ga0070708_100022169
240 Ga0070681_10175771
241 Ga0070706_100000814
242 Ga0070706_100021543
243 Ga0070706_100021931
244 Ga0070706_100044939
245 Ga0070706_100096702
246 Ga0070706_100331743
247 Ga0070707_100000520
248 Ga0070707_100001187
249 Ga0070707_100008346
250 Ga0070707_100015117
251 Ga0070707_101051380
252 Ga0070698_100003500
253 Ga0070698_100010209
254 Ga0070698_100027314
255 Ga0070698_100098586
256 Ga0070698_100111243
257 Ga0070698_100182672
258 Ga0070699_100243127
259 Ga0070699_100787413
260 Ga0070697_100016037
261 Ga0068852_101079050
262 Ga0070717_10044442
263 Ga0070717_10123048
264 Ga0070717_10195453
265 Ga0070717_10357722
266 Ga0070717_11051699
267 Ga0070715_10054890
268 Ga0070716_100001723
269 Ga0070712_100092552
270 Ga0070712_100185816
271 Ga0075433_10445418
272 Ga0075436_100154969
273 Ga0099796_10386617
274 Ga0157369_10025297
275 Ga0157369_10447347
276 Ga0157369_10827287
277 Ga0163163_10150301
278 Ga0206353_10799261
279 Ga0213874_10018624
280 Ga0213875_10000469
281 Ga0213875_10003294
282 Ga0207692_10261490
283 Ga0207685_10254165
284 Ga0207699_10004403
285 Ga0207705_10016579
286 Ga0207684_10000749
287 Ga0207684_10003280
288 Ga0207684_10014941
289 Ga0207684_10189384
290 Ga0207684_10272007
291 Ga0207684_10343093
292 Ga0207707_10329175
293 Ga0207693_10020413
294 Ga0207693_10045506
295 Ga0207693_10235507
296 Ga0207693_10528399
297 Ga0207663_10213014
298 Ga0207646_10000845
299 Ga0207646_10001741
300 Ga0207646_10007079
301 Ga0207646_10209996
302 Ga0207646_10296656
303 Ga0207646_10321538
304 Ga0207700_10001652
305 Ga0207700_10059336
306 Ga0207700_10060881
307 Ga0207700_10112704
308 Ga0207700_10238396
309 Ga0207664_10000341
310 Ga0207664_10001818
311 Ga0207664_10083752
312 Ga0207664_10179710
313 Ga0207665_10002727
314 Ga0207665_10005574
315 Ga0207661_10104199
316 Ga0207679_10963833
317 Ga0265337_1000015
318 Ga0265319_1000939
319 Ga0265334_10001423
320 Ga0265318_10012798
321 Ga0265323_10012686
322 Ga0265336_10020586
323 Ga0265338_10001226
324 Ga0265338_10001255
325 Ga0265338_10020401
326 Ga0265324_10002955
327 Ga0265763_1001091
328 Ga0265320_10026277
329 Ga0265325_10005094
330 Ga0265339_10023719
331 Ga0265316_10016644
332 Ga0307513_10015477
333 Ga0265313_10009648
334 Ga0265314_10033932
335 Ga0307413_10483010
336 Ga0307411_10043346
337 Ga0307507_10020898
338 Ga0373934_0049057
339 Ga0373923_0081119
340 Ga0373923_0116800
341 Ga0373936_0085693
342 Ga0373953_0001933
343 Ga0373954_0153897
344 Ga0373956_0019946
345 Ga0373956_0322620
346 Ga0373957_0039530
347 Ga0373943_0204881
348 Ga0373946_0015684
349 Ga0373955_0140140
350 Ga0373924_0002828
351 Ga0373935_0001375
352 Ga0373935_0171440
353 Ga0373935_0327396
354 Ga0373947_0000009
355 Ga0373947_0018773
356 Ga0373947_0065465
357 Ga0373937_0378403
358 Ga0373937_0573746
359 Ga0373937_0685993
360 Ga0373925_0000605
361 Ga0373925_0004122
362 Ga0395900_0141850
363 Ga0395898_0060961
364 Ga0436364_0806695
365 Ga0436364_1326281
366 Ga0436364_1351374
367 Ga0436364_1518594
368 Ga0395901_0038946
369 Ga0436363_0359696
370 Ga0436363_0376026
371 Ga0451853_3244085
372 Ga0439449_0051886
373 Ga0466967_0600208
374 Ga0495629_0015515
375 Ga0495641_0012707
376 Ga0495651_0033739
377 Ga0495651_0068348
378 Ga0495653_0138091
379 Ga0495639_0172733
380 Ga0495662_0048631
381 Ga0495664_0006060
382 Ga0495664_0041228
383 Ga0495664_0082249
384 Ga0495664_0421736
385 Ga0495618_0016748
386 Ga0495628_0010723
387 Ga0495628_0062657
388 Ga0495628_0080164
389 Ga0495628_0084753
390 Ga0495630_0066685
391 Ga0495652_0014925
392 Ga0495652_0030355
393 Ga0495652_0606755
394 Ga0495665_0023956
395 Ga0495586_0005477
396 Ga0495586_0062221
397 Ga0495587_0021135
398 Ga0495645_0093906
399 Ga0495645_0220782
400 Ga0495667_0099574
401 Ga0495667_0457428
402 Ga0495634_0031265
403 Ga0495634_0037358
404 Ga0495634_0086701
405 Ga0495635_0087744
406 Ga0495657_0024103
407 Ga0495599_0040739
408 Ga0495599_0055018
409 Ga0495599_0058740
410 Ga0495623_0056663
411 Ga0495646_0065486
412 Ga0495658_0075128
413 Ga0495613_0081764
414 Ga0495624_0013429
415 Ga0495600_0019842
416 Ga0495600_0053912
417 Ga0495581_0005758
418 Ga0495674_0085976
419 Ga0495674_0126690
420 Ga0495674_0285406
421 Ga0495676_0206745
422 Ga0495680_0036103
423 Ga0495675_0006616
424 Ga0495675_0109860
425 Ga0495684_0040464
426 Ga0495593_0000893
427 Ga0495602_0099824
428 Ga0495614_0020796
429 Ga0496115_0267326
430 Ga0496126_0270993
431 Ga0501036_0986279
432 Ga0501038_0065560
433 Ga0501038_0325839
434 Ga0501047_0199537
435 Ga0501073_0613326
436 nmdc:mga0n895_102491_c1
437 nmdc:mga0rr50_100993_c1
438 nmdc:mga0rr50_132329_c1
439 nmdc:mga08x19_163061_c1
440 Ga0495601_0003983
441 Ga0495601_0474793
442 Ga0495612_0035236
443 Ga0495595_0004765
444 Ga0495619_0004481
445 2506865296
446 2671837353
447 2689995258
448 2753074484
449 2774855509
450 2870728941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

10

191

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9626 4 189
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9611 5 177
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9559 4 180
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9521 4 189
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.9454 6 189
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9498 64 188 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9438 6 189 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.936 5 188 3.40.50.1470
af_Q86Y79_27_209_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9354 4 182 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9296 5 189 3.40.50.1470
ID Description Score Start End GO Terms
AF-D6Y8B0-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9846 3 189 GO:0004045
GO:0005737
GO:0006412
AF-A0A7V9EM47-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9811 1 189 GO:0004045
GO:0005737
GO:0006412
AF-A0A7J9VX40-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9808 4 189 GO:0004045
GO:0005737
GO:0006412
AF-A0A1Q9TJ95-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9792 2 189 GO:0004045
GO:0005737
GO:0006412
AF-A0A4R4QPQ6-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9784 4 189 GO:0004045
GO:0005737
GO:0006412

Map