F337630

General Info

Members Datasets Scaffolds Average Seq Length
225 195 450 250

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10005574|Ga0075368_100055743
Length 267
Sequence MSPLPVTRASLRPHSILHTHTMDTAEFVEILDREGRLLAAAAELAGSDAKVPTCPDWQVRDLLRHTGMVHRWATAFVAEQHASYHPDGGLPDLDGAELLTWFREGHRQLVDTLASAAPDVRCWHFLPAPSPLAFWARRQAHETTVHRIDAESAGGGTPGEIAPAFAEDGIDELLSGFHARSRSRVRSEEPRVLRVRATDADGAVWTVRLSQEPPAAVRGASGDADCEVAGSAAQLYLALWNRLPFPRVTGDASVATLWREKSAVTWS

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
94 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
102 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
103 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
165 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
166 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
169 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
170 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
171 2643221647 Streptomyces sp. Root369 Isolate Unclassified
172 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
173 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
174 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
175 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
176 2808606448 Streptomyces sp. 193411 Isolate Unclassified
177 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
178 2867428634 Streptomyces sp. RP5T Isolate Unclassified
179 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
180 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
181 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
182 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
183 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
184 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
185 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
186 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
187 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
188 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
189 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
190 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
191 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
192 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
193 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
194 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
195 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.11
Metatranscriptomes 0.44
Isolates 12.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0
Rhizoplane 4.44
Rhizosphere 79.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10005574 3300006042 Bacteria 4339
2 JGI24737J22298_10025970 3300001990 Bacteria 1850
3 rootH1_10019164 3300003316 Bacteria 6011
4 rootH2_10133313 3300003320 Bacteria 4933
5 rootL2_10156713 3300003322 Bacteria 2009
6 Ga0070676_10320040 3300005328 Bacteria 1058
7 Ga0068869_100057317 3300005334 Bacteria 2843
8 Ga0070680_100126069 3300005336 Bacteria 2139
9 Ga0070682_100071610 3300005337 Bacteria 2219
10 Ga0070689_100498522 3300005340 Bacteria 1043
11 Ga0070671_100049727 3300005355 Bacteria 3487
12 Ga0070673_100202567 3300005364 Bacteria 1710
13 Ga0070688_100209495 3300005365 Bacteria 1368
14 Ga0070709_10071315 3300005434 Bacteria 2242
15 Ga0070713_100020964 3300005436 Bacteria 5018
16 Ga0070710_10028157 3300005437 Bacteria 3003
17 Ga0070711_100232876 3300005439 Bacteria 1437
18 Ga0070662_100244630 3300005457 Bacteria 1440
19 Ga0070679_100089054 3300005530 Bacteria 3073
20 Ga0068853_100452600 3300005539 Bacteria 1207
21 Ga0070693_100013253 3300005547 Bacteria 4196
22 Ga0068855_100298363 3300005563 Bacteria 1785
23 Ga0068856_100003836 3300005614 Bacteria 15082
24 Ga0070702_100067463 3300005615 Bacteria 2102
25 Ga0068859_100145405 3300005617 Bacteria 2445
26 Ga0068864_100271864 3300005618 Bacteria 1579
27 Ga0068851_10046145 3300005834 Bacteria 2203
28 Ga0068870_10023904 3300005840 Bacteria 3019
29 Ga0068863_100091444 3300005841 Bacteria 2885
30 Ga0068858_100212171 3300005842 Bacteria 1832
31 Ga0081455_10047380 3300005937 Bacteria 3723
32 Ga0070717_10113698 3300006028 Bacteria 2311
33 Ga0070712_100148503 3300006175 Bacteria 1797
34 Ga0075367_10038660 3300006178 Bacteria 2778
35 Ga0097621_100106795 3300006237 Bacteria 2362
36 Ga0075431_100530947 3300006847 Bacteria 1165
37 Ga0075434_100591795 3300006871 Bacteria 1128
38 Ga0075429_100131340 3300006880 Bacteria 2190
39 Ga0075436_100102968 3300006914 Bacteria 1989
40 Ga0097620_100145404 3300006931 Bacteria 2445
41 Ga0075435_100005760 3300007076 Bacteria 8699
42 Ga0105251_10018864 3300009011 Bacteria 3657
43 Ga0105251_10093330 3300009011 Bacteria 1381
44 Ga0105240_10144545 3300009093 Bacteria 2839
45 Ga0105245_10015246 3300009098 Bacteria 6696
46 Ga0105241_10018557 3300009174 Bacteria 5117
47 Ga0105238_10276798 3300009551 Bacteria 1659
48 Ga0105239_10967418 3300010375 Bacteria 978
49 Ga0105246_10002493 3300011119 Bacteria 11129
50 Ga0157373_10391293 3300013100 Bacteria 995
51 Ga0157371_10293518 3300013102 Bacteria 1176
52 Ga0157370_10362886 3300013104 Bacteria 1335
53 Ga0157374_10137433 3300013296 Bacteria 2370
54 Ga0157375_10076645 3300013308 Bacteria 3371
55 Ga0157379_10314141 3300014968 Bacteria 1430
56 Ga0182007_10004115 3300015262 Bacteria 6675
57 Ga0182005_1052813 3300015265 Bacteria 1107
58 Ga0183367_1003 3300015688 Bacteria 814276
59 Ga0206353_11467127 3300020082 Bacteria 3001
60 Ga0209758_1001840 3300025297 Bacteria 23288
61 Ga0207656_10125767 3300025321 Bacteria 1197
62 Ga0207692_10013232 3300025898 Bacteria 3574
63 Ga0207643_10000491 3300025908 Bacteria 25290
64 Ga0207705_10055348 3300025909 Bacteria 2860
65 Ga0207654_10024757 3300025911 Bacteria 3231
66 Ga0207707_10076764 3300025912 Bacteria 2915
67 Ga0207660_10449198 3300025917 Bacteria 1042
68 Ga0207657_10193778 3300025919 Bacteria 1638
69 Ga0207649_10056409 3300025920 Bacteria 2453
70 Ga0207652_10540996 3300025921 Bacteria 1047
71 Ga0207650_10271106 3300025925 Bacteria 1379
72 Ga0207659_10016614 3300025926 Bacteria 4794
73 Ga0207687_10032493 3300025927 Bacteria 3535
74 Ga0207700_10002949 3300025928 Bacteria 9815
75 Ga0207644_10352433 3300025931 Bacteria 1195
76 Ga0207690_10351109 3300025932 Bacteria 1166
77 Ga0207689_10117537 3300025942 Bacteria 2186
78 Ga0207667_10259124 3300025949 Bacteria 1778
79 Ga0207640_10591449 3300025981 Bacteria 938
80 Ga0207703_10380132 3300026035 Bacteria 1306
81 Ga0207678_10000882 3300026067 Bacteria 27571
82 Ga0207702_10006433 3300026078 Bacteria 10135
83 Ga0207702_10030486 3300026078 Bacteria 4495
84 Ga0207641_10648854 3300026088 Bacteria 1036
85 Ga0207676_10004309 3300026095 Bacteria 10061
86 Ga0207683_10160829 3300026121 Bacteria 2030
87 Ga0209813_10010300 3300027866 Bacteria 2414
88 Ga0307511_10000474 3300030521 Bacteria 43520
89 Ga0307511_10069307 3300030521 Bacteria 2594
90 Ga0307512_10009190 3300030522 Bacteria 9551
91 Ga0307513_10044155 3300031456 Bacteria 4885
92 Ga0307509_10022154 3300031507 Bacteria 7170
93 Ga0307508_10014130 3300031616 Bacteria 7285
94 Ga0307508_10019396 3300031616 Bacteria 6182
95 Ga0307508_10134035 3300031616 Bacteria 2080
96 Ga0307514_10048827 3300031649 Bacteria 3293
97 Ga0307516_10093380 3300031730 Bacteria 2834
98 Ga0307516_10094387 3300031730 Bacteria 2816
99 Ga0307518_10061908 3300031838 Bacteria 2717
100 Ga0307518_10101105 3300031838 Bacteria 2064
101 Ga0307507_10142214 3300033179 Bacteria 1835
102 Ga0307507_10256538 3300033179 Bacteria 1122
103 Ga0307510_10074388 3300033180 Bacteria 3356
104 Ga0373931_0162664 3300035691 Bacteria 1309
105 Ga0395898_0005266 3300037466 Bacteria 13987
106 Ga0395898_0051436 3300037466 Bacteria 4028
107 Ga0395898_0107328 3300037466 Bacteria 2677
108 Ga0395901_0097417 3300038443 Bacteria 3083
109 Ga0439448_0020539 3300042005 Bacteria 2044
110 Ga0439448_0061370 3300042005 Bacteria 1243
111 Ga0439449_0059702 3300042007 Bacteria 1408
112 Ga0450903_000359 3300042138 Bacteria 10012
113 Ga0439458_0000041 3300042157 Bacteria 20369
114 Ga0450901_004423 3300042533 Bacteria 1455
115 Ga0466972_0005436 3300044658 Bacteria 6381
116 Ga0466972_0055665 3300044658 Bacteria 1902
117 Ga0466972_0076999 3300044658 Bacteria 1589
118 Ga0466965_0025932 3300044683 Bacteria 2840
119 Ga0466965_0275344 3300044683 Bacteria 908
120 Ga0466966_0024673 3300044684 Bacteria 3932
121 Ga0466961_0058030 3300044693 Bacteria 2463
122 Ga0466971_0294585 3300044719 Bacteria 778
123 Ga0466970_0108751 3300044765 Bacteria 1513
124 Ga0466960_0007281 3300044901 Bacteria 4485
125 Ga0466967_0088415 3300045976 Bacteria 2811
126 Ga0495592_0195851 3300046454 Bacteria 1367
127 Ga0495629_0006630 3300046459 Bacteria 8567
128 Ga0495629_0035898 3300046459 Bacteria 3501
129 Ga0495651_0003137 3300046462 Bacteria 12748
130 Ga0495639_0055232 3300046475 Bacteria 1811
131 Ga0495662_0004776 3300046476 Bacteria 6792
132 Ga0495662_0041821 3300046476 Bacteria 2212
133 Ga0495662_0046977 3300046476 Bacteria 2084
134 Ga0495662_0167849 3300046476 Bacteria 1081
135 Ga0495664_0005174 3300046477 Bacteria 7157
136 Ga0495628_0555386 3300046516 Bacteria 824
137 Ga0495630_0340037 3300046517 Bacteria 1148
138 Ga0495652_0058058 3300046529 Bacteria 3279
139 Ga0495587_0001841 3300046536 Bacteria 14139
140 Ga0495645_0009117 3300046543 Bacteria 6933
141 Ga0495634_0003761 3300046642 Bacteria 12069
142 Ga0495657_0001614 3300046675 Bacteria 19370
143 Ga0495657_0005234 3300046675 Bacteria 10272
144 Ga0495646_0011377 3300046680 Bacteria 5650
145 Ga0495658_0206651 3300046683 Bacteria 1225
146 Ga0495613_0004200 3300046689 Bacteria 10782
147 Ga0495613_0032825 3300046689 Bacteria 3857
148 Ga0495613_0053001 3300046689 Bacteria 2986
149 Ga0495613_0084973 3300046689 Bacteria 2297
150 Ga0495670_0187931 3300046691 Bacteria 1092
151 Ga0495589_0017658 3300046794 Bacteria 3661
152 Ga0495589_0092073 3300046794 Bacteria 1472
153 Ga0495600_0079635 3300046809 Bacteria 2138
154 Ga0495600_0115898 3300046809 Bacteria 1744
155 Ga0495581_0004708 3300047315 Bacteria 7878
156 Ga0495604_0027003 3300047317 Bacteria 4568
157 Ga0495636_0001909 3300047318 Bacteria 7974
158 Ga0495636_0028195 3300047318 Bacteria 2288
159 Ga0495676_0068874 3300047321 Bacteria 2732
160 Ga0495687_003824 3300047443 Bacteria 10612
161 Ga0495687_024010 3300047443 Bacteria 2904
162 Ga0495675_0060826 3300047444 Bacteria 2393
163 Ga0495685_006069 3300047447 Bacteria 3952
164 Ga0495685_017112 3300047447 Bacteria 2480
165 Ga0495681_0074454 3300047470 Bacteria 1531
166 Ga0495684_0375837 3300047471 Bacteria 1003
167 Ga0495593_0000736 3300047673 Bacteria 18999
168 Ga0495602_0048493 3300048088 Bacteria 3816
169 Ga0495614_0007337 3300048089 Bacteria 4909
170 Ga0496101_0410618 3300048904 Bacteria 1067
171 Ga0496104_0506440 3300048907 Bacteria 1118
172 Ga0496105_0446502 3300048908 Bacteria 1021
173 Ga0496106_0138632 3300048909 Bacteria 1912
174 Ga0496108_0565471 3300048911 Bacteria 991
175 Ga0496109_0025334 3300048912 Bacteria 5285
176 Ga0496109_0451924 3300048912 Bacteria 1213
177 Ga0496110_0491592 3300048913 Bacteria 1117
178 Ga0496111_0102367 3300048914 Bacteria 2105
179 Ga0496113_0391493 3300048916 Bacteria 1115
180 Ga0501033_0000850 3300049570 Bacteria 27891
181 Ga0501043_0036077 3300049579 Bacteria 3889
182 Ga0501047_0159924 3300049581 Bacteria 2124
183 Ga0501080_0455896 3300049742 Bacteria 1146
184 Ga0501035_0061380 3300049822 Bacteria 3346
185 Ga0501035_0387085 3300049822 Bacteria 1165
186 Ga0501044_0004671 3300049823 Bacteria 15323
187 Ga0501044_0193105 3300049823 Bacteria 1997
188 nmdc:mga06z11_43912_c1 3300050494 Bacteria 2252
189 nmdc:mga04h51_2920_c1 3300050495 Bacteria 4105
190 nmdc:mga06r32_402006_c1 3300050510 Bacteria 1352
191 nmdc:mga0n895_683145_c1 3300050512 Bacteria 1024
192 nmdc:mga08x19_17975_c1 3300050514 Bacteria 4330
193 nmdc:mga0a205_239121_c1 3300050515 Bacteria 1697
194 Ga0500647_0160216 3300053091 Bacteria 1045
195 Ga0500640_025841 3300053095 Bacteria 2555
196 Ga0500600_0045367 3300053149 Bacteria 2516
197 Ga0466962_0017552 3300061719 Bacteria 3445
198 2547408664 2547132111 Bacteria 8013147
199 2585306464 2582581313 Bacteria 10042643
200 2585319999 2582581314 Bacteria 11452267
201 2644263307 2643221647 Bacteria 10741251
202 2784586321 2784132148 Bacteria 8627943
203 2785366562 2784746768 Bacteria 10036182
204 2786667641 2786546132 Bacteria 10419719
205 2808917914 2808606375 Bacteria 9466072
206 2809229820 2808606448 Bacteria 8656184
207 2862290195 2862281513 Bacteria 9621493
208 2867435181 2867428634 Bacteria 9590268
209 2873157967 2873151551 Bacteria 8625867
210 2877683986 2877676314 Bacteria 9512378
211 2935391399 2935390628 Bacteria 7043367
212 2954389289 2954380949 Bacteria 10050426
213 2954673780 2954673503 Bacteria 9685905
214 2954690210 2954682443 Bacteria 9862841
215 2954700063 2954691527 Bacteria 10720516
216 2954702157 2954701450 Bacteria 10834262
217 2954718886 2954711539 Bacteria 10867210
218 2954728856 2954721474 Bacteria 10456478
219 2954732956 2954731030 Bacteria 10243860
220 2954747755 2954740390 Bacteria 10229294
221 2954751833 2954749733 Bacteria 10366972
222 2954766878 2954759201 Bacteria 9358192
223 3006492851 3006486233 Bacteria 8157040
224 3006494655 3006493962 Bacteria 8825450
225 8056832790 8056829672 Bacteria 9045328
226 Ga0075368_10005574
227 JGI24737J22298_10025970
228 rootH1_10019164
229 rootH2_10133313
230 rootL2_10156713
231 Ga0070676_10320040
232 Ga0068869_100057317
233 Ga0070680_100126069
234 Ga0070682_100071610
235 Ga0070689_100498522
236 Ga0070671_100049727
237 Ga0070673_100202567
238 Ga0070688_100209495
239 Ga0070709_10071315
240 Ga0070713_100020964
241 Ga0070710_10028157
242 Ga0070711_100232876
243 Ga0070662_100244630
244 Ga0070679_100089054
245 Ga0068853_100452600
246 Ga0070693_100013253
247 Ga0068855_100298363
248 Ga0068856_100003836
249 Ga0070702_100067463
250 Ga0068859_100145405
251 Ga0068864_100271864
252 Ga0068851_10046145
253 Ga0068870_10023904
254 Ga0068863_100091444
255 Ga0068858_100212171
256 Ga0081455_10047380
257 Ga0070717_10113698
258 Ga0070712_100148503
259 Ga0075367_10038660
260 Ga0097621_100106795
261 Ga0075431_100530947
262 Ga0075434_100591795
263 Ga0075429_100131340
264 Ga0075436_100102968
265 Ga0097620_100145404
266 Ga0075435_100005760
267 Ga0105251_10018864
268 Ga0105251_10093330
269 Ga0105240_10144545
270 Ga0105245_10015246
271 Ga0105241_10018557
272 Ga0105238_10276798
273 Ga0105239_10967418
274 Ga0105246_10002493
275 Ga0157373_10391293
276 Ga0157371_10293518
277 Ga0157370_10362886
278 Ga0157374_10137433
279 Ga0157375_10076645
280 Ga0157379_10314141
281 Ga0182007_10004115
282 Ga0182005_1052813
283 Ga0183367_1003
284 Ga0206353_11467127
285 Ga0209758_1001840
286 Ga0207656_10125767
287 Ga0207692_10013232
288 Ga0207643_10000491
289 Ga0207705_10055348
290 Ga0207654_10024757
291 Ga0207707_10076764
292 Ga0207660_10449198
293 Ga0207657_10193778
294 Ga0207649_10056409
295 Ga0207652_10540996
296 Ga0207650_10271106
297 Ga0207659_10016614
298 Ga0207687_10032493
299 Ga0207700_10002949
300 Ga0207644_10352433
301 Ga0207690_10351109
302 Ga0207689_10117537
303 Ga0207667_10259124
304 Ga0207640_10591449
305 Ga0207703_10380132
306 Ga0207678_10000882
307 Ga0207702_10006433
308 Ga0207702_10030486
309 Ga0207641_10648854
310 Ga0207676_10004309
311 Ga0207683_10160829
312 Ga0209813_10010300
313 Ga0307511_10000474
314 Ga0307511_10069307
315 Ga0307512_10009190
316 Ga0307513_10044155
317 Ga0307509_10022154
318 Ga0307508_10014130
319 Ga0307508_10019396
320 Ga0307508_10134035
321 Ga0307514_10048827
322 Ga0307516_10093380
323 Ga0307516_10094387
324 Ga0307518_10061908
325 Ga0307518_10101105
326 Ga0307507_10142214
327 Ga0307507_10256538
328 Ga0307510_10074388
329 Ga0373931_0162664
330 Ga0395898_0005266
331 Ga0395898_0051436
332 Ga0395898_0107328
333 Ga0395901_0097417
334 Ga0439448_0020539
335 Ga0439448_0061370
336 Ga0439449_0059702
337 Ga0450903_000359
338 Ga0439458_0000041
339 Ga0450901_004423
340 Ga0466972_0005436
341 Ga0466972_0055665
342 Ga0466972_0076999
343 Ga0466965_0025932
344 Ga0466965_0275344
345 Ga0466966_0024673
346 Ga0466961_0058030
347 Ga0466971_0294585
348 Ga0466970_0108751
349 Ga0466960_0007281
350 Ga0466967_0088415
351 Ga0495592_0195851
352 Ga0495629_0006630
353 Ga0495629_0035898
354 Ga0495651_0003137
355 Ga0495639_0055232
356 Ga0495662_0004776
357 Ga0495662_0041821
358 Ga0495662_0046977
359 Ga0495662_0167849
360 Ga0495664_0005174
361 Ga0495628_0555386
362 Ga0495630_0340037
363 Ga0495652_0058058
364 Ga0495587_0001841
365 Ga0495645_0009117
366 Ga0495634_0003761
367 Ga0495657_0001614
368 Ga0495657_0005234
369 Ga0495646_0011377
370 Ga0495658_0206651
371 Ga0495613_0004200
372 Ga0495613_0032825
373 Ga0495613_0053001
374 Ga0495613_0084973
375 Ga0495670_0187931
376 Ga0495589_0017658
377 Ga0495589_0092073
378 Ga0495600_0079635
379 Ga0495600_0115898
380 Ga0495581_0004708
381 Ga0495604_0027003
382 Ga0495636_0001909
383 Ga0495636_0028195
384 Ga0495676_0068874
385 Ga0495687_003824
386 Ga0495687_024010
387 Ga0495675_0060826
388 Ga0495685_006069
389 Ga0495685_017112
390 Ga0495681_0074454
391 Ga0495684_0375837
392 Ga0495593_0000736
393 Ga0495602_0048493
394 Ga0495614_0007337
395 Ga0496101_0410618
396 Ga0496104_0506440
397 Ga0496105_0446502
398 Ga0496106_0138632
399 Ga0496108_0565471
400 Ga0496109_0025334
401 Ga0496109_0451924
402 Ga0496110_0491592
403 Ga0496111_0102367
404 Ga0496113_0391493
405 Ga0501033_0000850
406 Ga0501043_0036077
407 Ga0501047_0159924
408 Ga0501080_0455896
409 Ga0501035_0061380
410 Ga0501035_0387085
411 Ga0501044_0004671
412 Ga0501044_0193105
413 nmdc:mga06z11_43912_c1
414 nmdc:mga04h51_2920_c1
415 nmdc:mga06r32_402006_c1
416 nmdc:mga0n895_683145_c1
417 nmdc:mga08x19_17975_c1
418 nmdc:mga0a205_239121_c1
419 Ga0500647_0160216
420 Ga0500640_025841
421 Ga0500600_0045367
422 Ga0466962_0017552
423 2547408664
424 2585306464
425 2585319999
426 2644263307
427 2784586321
428 2785366562
429 2786667641
430 2808917914
431 2809229820
432 2862290195
433 2867435181
434 2873157967
435 2877683986
436 2935391399
437 2954389289
438 2954673780
439 2954690210
440 2954700063
441 2954702157
442 2954718886
443 2954728856
444 2954732956
445 2954747755
446 2954751833
447 2954766878
448 3006492851
449 3006494655
450 8056832790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07398

MDMPI_C

MDMPI C-terminal domain

164

257

0.88

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

28

151

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7084 1 132
3bn8-assembly1.cif.gz_A-2 crystal structure of a putative sterol carrier protein type 2 (af1534) from archaeoglobus fulgidus dsm 4304 at 2.11 a resolution 0.7014 139 235
4n6c-assembly2.cif.gz_B crystal structure of the b1rzq2 protein from streptococcus pneumoniae. northeast structural genomics consortium (nesg) target spr36. 0.6999 1 131
6h6p-assembly1.cif.gz_A ubij-scp2 ubiquinone synthesis protein 0.6935 143 241
7mtl-assembly1.cif.gz_B crystal structure of colibactin self-resistance protein clbs in complex with a dsdna 0.6921 3 137
ID Description Score Start End Superfamily
af_O07256_17_140_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8352 11 129 1.20.120.450
af_O07256_152_254_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8167 145 235 3.30.1050.10
af_O07256_17_140_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7994 11 129 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7879 7 133 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7738 1 129 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A345G4G0-F1-model_v4 deleted 0.9937 1 244
AF-A0A100JBC4-F1-model_v4 deleted 0.9915 1 243
AF-A0A6I5N2L4-F1-model_v4 deleted 0.9914 1 170
AF-A0A6B3HUL8-F1-model_v4 Maleylpyruvate isomerase family protein 0.9901 1 144 GO:0005886
GO:0016853
GO:0046872
AF-A0A345G4G0-F1-model_v4 deleted 0.9897 1 244

Map