F337616

General Info

Members Datasets Scaffolds Average Seq Length
225 84 450 92

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10332595|Ga0081455_103325952
Length 91
Sequence MSGSNLWSDGNALAGPLHDVFHAELTTAVGRCTGCGRTAPMAEARVFDQAPGVVAQVLLRLVRGPGRAWLDLRGLSYLQLPVPDETRAPQL

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
23 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
24 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
25 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
26 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
27 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
28 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
29 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
30 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
31 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
32 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
33 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
34 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
35 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
36 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
37 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
38 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
39 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
40 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
41 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
42 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
43 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
44 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
45 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
46 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
47 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
48 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
49 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
50 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
51 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
65 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
66 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
67 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
68 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
69 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
70 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
71 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
72 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
75 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
76 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
78 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
79 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
80 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
81 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
82 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
83 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
84 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.44
Rhizosphere 99.56
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10332595 3300005937 Bacteria 1078
2 JGI25406J46586_10063811 3300003203 Bacteria 1179
3 JGI25407J50210_10005217 3300003373 Bacteria 3185
4 JGI25407J50210_10008748 3300003373 Bacteria 2554
5 JGI25407J50210_10010602 3300003373 Bacteria 2346
6 JGI25407J50210_10074873 3300003373 Bacteria 844
7 Ga0070689_100689318 3300005340 Bacteria 891
8 Ga0070687_100467725 3300005343 Bacteria 842
9 Ga0070673_101155965 3300005364 Bacteria 724
10 Ga0070705_100665019 3300005440 Bacteria 814
11 Ga0070700_100380592 3300005441 Bacteria 1055
12 Ga0070685_10600625 3300005466 Bacteria 792
13 Ga0068858_100559964 3300005842 Bacteria 1107
14 Ga0081455_10847738 3300005937 Bacteria 571
15 Ga0081538_10001406 3300005981 Bacteria 24724
16 Ga0081538_10002699 3300005981 Bacteria 17069
17 Ga0081538_10003911 3300005981 Bacteria 13895
18 Ga0081538_10004699 3300005981 Bacteria 12504
19 Ga0081538_10005292 3300005981 Bacteria 11645
20 Ga0081538_10005411 3300005981 Bacteria 11477
21 Ga0081538_10024529 3300005981 Bacteria 4294
22 Ga0081538_10039047 3300005981 Bacteria 3050
23 Ga0081538_10054424 3300005981 Bacteria 2367
24 Ga0081538_10125212 3300005981 Bacteria 1224
25 Ga0081538_10126561 3300005981 Bacteria 1213
26 Ga0081539_10002642 3300005985 Bacteria 24471
27 Ga0081539_10039647 3300005985 Bacteria 2776
28 Ga0075428_102096175 3300006844 Bacteria 585
29 Ga0075431_100724228 3300006847 Bacteria 971
30 Ga0075431_100746413 3300006847 Bacteria 954
31 Ga0114129_10512979 3300009147 Bacteria 1564
32 Ga0114129_12614139 3300009147 Bacteria 602
33 Ga0182007_10262140 3300015262 Bacteria 623
34 Ga0207670_10720923 3300025936 Bacteria 827
35 Ga0207679_10136970 3300025945 Bacteria 1973
36 Ga0207703_11420109 3300026035 Bacteria 668
37 Ga0207708_10383477 3300026075 Bacteria 1159
38 Ga0207676_10299886 3300026095 Bacteria 1467
39 Ga0307408_100028781 3300031548 Bacteria 3843
40 Ga0307408_100084501 3300031548 Bacteria 2381
41 Ga0307408_100114624 3300031548 Bacteria 2077
42 Ga0307408_100135452 3300031548 Bacteria 1927
43 Ga0307408_100162615 3300031548 Bacteria 1774
44 Ga0307408_100373724 3300031548 Bacteria 1216
45 Ga0307408_100926896 3300031548 Bacteria 799
46 Ga0307408_102355590 3300031548 Bacteria 516
47 Ga0307405_10010066 3300031731 Bacteria 4879
48 Ga0307405_10018285 3300031731 Bacteria 3863
49 Ga0307405_10078711 3300031731 Bacteria 2146
50 Ga0307405_10098419 3300031731 Bacteria 1955
51 Ga0307405_10127375 3300031731 Bacteria 1753
52 Ga0307405_10283064 3300031731 Bacteria 1249
53 Ga0307405_10389600 3300031731 Bacteria 1087
54 Ga0307405_11399552 3300031731 Bacteria 611
55 Ga0307413_10035401 3300031824 Bacteria 2863
56 Ga0307413_10136133 3300031824 Bacteria 1689
57 Ga0307413_10158912 3300031824 Bacteria 1585
58 Ga0307413_10161100 3300031824 Bacteria 1576
59 Ga0307413_10320211 3300031824 Bacteria 1184
60 Ga0307413_10417943 3300031824 Bacteria 1055
61 Ga0307413_10470053 3300031824 Bacteria 1002
62 Ga0307413_10544875 3300031824 Bacteria 940
63 Ga0307410_10021230 3300031852 Bacteria 3990
64 Ga0307410_10038691 3300031852 Bacteria 3126
65 Ga0307410_10044054 3300031852 Bacteria 2961
66 Ga0307410_10065414 3300031852 Bacteria 2501
67 Ga0307410_10228506 3300031852 Bacteria 1435
68 Ga0307410_11221827 3300031852 Bacteria 655
69 Ga0307410_11361104 3300031852 Bacteria 622
70 Ga0307410_12074544 3300031852 Unclassified 508
71 Ga0307410_12133251 3300031852 Bacteria 501
72 Ga0307406_10007338 3300031901 Bacteria 6111
73 Ga0307406_10018403 3300031901 Bacteria 4081
74 Ga0307406_10068259 3300031901 Bacteria 2320
75 Ga0307406_10351170 3300031901 Bacteria 1152
76 Ga0307406_10504137 3300031901 Bacteria 982
77 Ga0307406_10534290 3300031901 Bacteria 956
78 Ga0307406_10625768 3300031901 Bacteria 890
79 Ga0307406_10688014 3300031901 Unclassified 853
80 Ga0307406_11199088 3300031901 Bacteria 659
81 Ga0307406_11437324 3300031901 Bacteria 605
82 Ga0307406_11802932 3300031901 Bacteria 544
83 Ga0307407_10005626 3300031903 Bacteria 5463
84 Ga0307407_10015461 3300031903 Bacteria 3774
85 Ga0307407_10069969 3300031903 Bacteria 2084
86 Ga0307407_10107341 3300031903 Bacteria 1746
87 Ga0307407_10159116 3300031903 Bacteria 1476
88 Ga0307407_10183093 3300031903 Bacteria 1390
89 Ga0307407_10269667 3300031903 Bacteria 1174
90 Ga0307407_10353890 3300031903 Bacteria 1041
91 Ga0307412_10094663 3300031911 Bacteria 2098
92 Ga0307412_10099581 3300031911 Bacteria 2053
93 Ga0307412_10217505 3300031911 Bacteria 1462
94 Ga0307412_10275803 3300031911 Bacteria 1318
95 Ga0307412_10335492 3300031911 Bacteria 1208
96 Ga0307412_10573361 3300031911 Bacteria 951
97 Ga0307409_100004149 3300031995 Bacteria 8063
98 Ga0307409_100017980 3300031995 Bacteria 4732
99 Ga0307409_100027940 3300031995 Bacteria 4008
100 Ga0307409_100036837 3300031995 Bacteria 3600
101 Ga0307409_100048946 3300031995 Bacteria 3220
102 Ga0307409_100056866 3300031995 Bacteria 3027
103 Ga0307409_100197553 3300031995 Bacteria 1796
104 Ga0307409_100278173 3300031995 Bacteria 1545
105 Ga0307409_100307755 3300031995 Bacteria 1477
106 Ga0307409_100461770 3300031995 Bacteria 1228
107 Ga0307409_101151285 3300031995 Bacteria 798
108 Ga0307416_100002613 3300032002 Bacteria 10408
109 Ga0307416_100014221 3300032002 Bacteria 5442
110 Ga0307416_100022244 3300032002 Bacteria 4572
111 Ga0307416_100035692 3300032002 Bacteria 3801
112 Ga0307416_100040092 3300032002 Bacteria 3634
113 Ga0307416_100047216 3300032002 Bacteria 3406
114 Ga0307416_100157868 3300032002 Bacteria 2091
115 Ga0307416_100245784 3300032002 Bacteria 1737
116 Ga0307416_100398852 3300032002 Bacteria 1412
117 Ga0307416_100468231 3300032002 Bacteria 1317
118 Ga0307416_100540054 3300032002 Bacteria 1237
119 Ga0307416_100603574 3300032002 Bacteria 1177
120 Ga0307416_103700435 3300032002 Unclassified 512
121 Ga0307414_10105000 3300032004 Bacteria 2135
122 Ga0307414_10125783 3300032004 Bacteria 1980
123 Ga0307414_10133334 3300032004 Bacteria 1932
124 Ga0307414_10283953 3300032004 Bacteria 1392
125 Ga0307414_10514768 3300032004 Bacteria 1061
126 Ga0307414_11369523 3300032004 Bacteria 657
127 Ga0307411_10468191 3300032005 Bacteria 1058
128 Ga0307411_10827768 3300032005 Bacteria 817
129 Ga0307411_10898217 3300032005 Bacteria 787
130 Ga0307411_11300180 3300032005 Bacteria 662
131 Ga0307411_11919446 3300032005 Bacteria 551
132 Ga0307415_100000426 3300032126 Bacteria 18072
133 Ga0307415_100004316 3300032126 Bacteria 7362
134 Ga0307415_100009783 3300032126 Bacteria 5396
135 Ga0307415_100012318 3300032126 Bacteria 4940
136 Ga0307415_100013192 3300032126 Bacteria 4815
137 Ga0307415_100026787 3300032126 Bacteria 3642
138 Ga0307415_100094005 3300032126 Bacteria 2178
139 Ga0307415_100267988 3300032126 Bacteria 1397
140 Ga0307415_100397830 3300032126 Bacteria 1175
141 Ga0307415_100499054 3300032126 Bacteria 1063
142 Ga0307415_100917265 3300032126 Bacteria 808
143 Ga0307415_100981305 3300032126 Unclassified 784
144 Ga0307415_102103070 3300032126 Bacteria 551
145 Ga0395899_0063691 3300037312 Bacteria 2712
146 Ga0395900_0011648 3300037418 Bacteria 8997
147 Ga0395900_0146497 3300037418 Bacteria 2414
148 Ga0395900_0199976 3300037418 Bacteria 2022
149 Ga0395900_0426588 3300037418 Bacteria 1286
150 Ga0395900_1448273 3300037418 Bacteria 599
151 Ga0395898_0036003 3300037466 Bacteria 4919
152 Ga0395898_0365263 3300037466 Bacteria 1376
153 Ga0395898_0507945 3300037466 Bacteria 1146
154 Ga0395898_0789027 3300037466 Bacteria 890
155 Ga0395905_0042942 3300037471 Bacteria 4242
156 Ga0395905_0084166 3300037471 Bacteria 2980
157 Ga0395905_0104521 3300037471 Bacteria 2659
158 Ga0395905_0174185 3300037471 Bacteria 2020
159 Ga0395905_0347375 3300037471 Bacteria 1375
160 Ga0395905_0923377 3300037471 Bacteria 776
161 Ga0395901_0015729 3300038443 Bacteria 7709
162 Ga0395901_0018779 3300038443 Bacteria 7064
163 Ga0395901_0028610 3300038443 Bacteria 5731
164 Ga0395901_0034636 3300038443 Bacteria 5215
165 Ga0395901_0036965 3300038443 Bacteria 5049
166 Ga0395901_0522688 3300038443 Bacteria 1205
167 Ga0395901_0954094 3300038443 Bacteria 836
168 Ga0439448_0154969 3300042005 Bacteria 796
169 Ga0439450_142050 3300042008 Bacteria 627
170 Ga0439463_002064 3300042016 Bacteria 5206
171 Ga0439463_005298 3300042016 Bacteria 3203
172 Ga0450917_009109 3300042120 Bacteria 775
173 Ga0450923_189593 3300042125 Bacteria 509
174 Ga0450902_006938 3300042137 Bacteria 1743
175 Ga0450910_037602 3300042147 Bacteria 776
176 Ga0439458_0072733 3300042157 Bacteria 870
177 Ga0439458_0224399 3300042157 Bacteria 518
178 Ga0439444_0006279 3300042437 Bacteria 1792
179 Ga0439460_0011955 3300042461 Bacteria 2243
180 Ga0439460_0146843 3300042461 Bacteria 785
181 Ga0439440_0001397 3300042993 Bacteria 4387
182 Ga0439440_0138743 3300042993 Bacteria 689
183 Ga0496110_0372544 3300048913 Bacteria 1301
184 Ga0501031_0009445 3300049568 Bacteria 6340
185 Ga0501032_0049344 3300049569 Bacteria 2839
186 Ga0501033_0106700 3300049570 Bacteria 2040
187 Ga0501034_0085671 3300049571 Bacteria 3152
188 Ga0501036_0018498 3300049572 Bacteria 5839
189 Ga0501037_0025496 3300049573 Bacteria 4368
190 Ga0501038_0004126 3300049574 Bacteria 13517
191 Ga0501038_0018033 3300049574 Bacteria 6376
192 Ga0501039_0017038 3300049575 Bacteria 5570
193 Ga0501040_0004733 3300049576 Bacteria 8835
194 Ga0501040_0023534 3300049576 Bacteria 4131
195 Ga0501041_0011582 3300049577 Bacteria 5217
196 Ga0501042_0032023 3300049578 Bacteria 3721
197 Ga0501042_0157505 3300049578 Bacteria 1638
198 Ga0501046_0008366 3300049580 Bacteria 9022
199 Ga0501046_0339326 3300049580 Bacteria 1092
200 Ga0501048_0032215 3300049582 Bacteria 3788
201 Ga0501069_0119444 3300049585 Bacteria 1505
202 Ga0501070_0108025 3300049586 Bacteria 2299
203 Ga0501070_0977035 3300049586 Bacteria 658
204 Ga0501071_0014397 3300049587 Bacteria 5409
205 Ga0501072_0005443 3300049588 Bacteria 9696
206 Ga0501074_0013512 3300049590 Bacteria 5934
207 Ga0501075_0005090 3300049591 Bacteria 8982
208 Ga0501076_0039991 3300049592 Bacteria 3683
209 Ga0501077_0016926 3300049593 Bacteria 4598
210 Ga0501079_0006112 3300049741 Bacteria 9027
211 Ga0501079_0009284 3300049741 Bacteria 7453
212 Ga0501080_0196969 3300049742 Bacteria 1850
213 Ga0501081_0049124 3300049743 Bacteria 2904
214 Ga0501083_0112496 3300049744 Bacteria 1789
215 Ga0501035_0022881 3300049822 Bacteria 5739
216 Ga0501045_0006456 3300049824 Bacteria 8121
217 nmdc:mga05p37_249174_c1 3300050507 Bacteria 2131
218 nmdc:mga06r32_1012576_c1 3300050510 Bacteria 783
219 nmdc:mga06r32_1280747_c1 3300050510 Unclassified 677
220 nmdc:mga06r32_431008_c1 3300050510 Bacteria 1299
221 Ga0501084_0020046 3300054114 Bacteria 5575
222 Ga0590071_096744 3300059421 Bacteria 742
223 Ga0590077_012569 3300059426 Bacteria 1757
224 Ga0501082_0003197 3300060353 Bacteria 14282
225 Ga0530510_0025042 3300061734 Bacteria 4265
226 Ga0081455_10332595
227 JGI25406J46586_10063811
228 JGI25407J50210_10005217
229 JGI25407J50210_10008748
230 JGI25407J50210_10010602
231 JGI25407J50210_10074873
232 Ga0070689_100689318
233 Ga0070687_100467725
234 Ga0070673_101155965
235 Ga0070705_100665019
236 Ga0070700_100380592
237 Ga0070685_10600625
238 Ga0068858_100559964
239 Ga0081455_10847738
240 Ga0081538_10001406
241 Ga0081538_10002699
242 Ga0081538_10003911
243 Ga0081538_10004699
244 Ga0081538_10005292
245 Ga0081538_10005411
246 Ga0081538_10024529
247 Ga0081538_10039047
248 Ga0081538_10054424
249 Ga0081538_10125212
250 Ga0081538_10126561
251 Ga0081539_10002642
252 Ga0081539_10039647
253 Ga0075428_102096175
254 Ga0075431_100724228
255 Ga0075431_100746413
256 Ga0114129_10512979
257 Ga0114129_12614139
258 Ga0182007_10262140
259 Ga0207670_10720923
260 Ga0207679_10136970
261 Ga0207703_11420109
262 Ga0207708_10383477
263 Ga0207676_10299886
264 Ga0307408_100028781
265 Ga0307408_100084501
266 Ga0307408_100114624
267 Ga0307408_100135452
268 Ga0307408_100162615
269 Ga0307408_100373724
270 Ga0307408_100926896
271 Ga0307408_102355590
272 Ga0307405_10010066
273 Ga0307405_10018285
274 Ga0307405_10078711
275 Ga0307405_10098419
276 Ga0307405_10127375
277 Ga0307405_10283064
278 Ga0307405_10389600
279 Ga0307405_11399552
280 Ga0307413_10035401
281 Ga0307413_10136133
282 Ga0307413_10158912
283 Ga0307413_10161100
284 Ga0307413_10320211
285 Ga0307413_10417943
286 Ga0307413_10470053
287 Ga0307413_10544875
288 Ga0307410_10021230
289 Ga0307410_10038691
290 Ga0307410_10044054
291 Ga0307410_10065414
292 Ga0307410_10228506
293 Ga0307410_11221827
294 Ga0307410_11361104
295 Ga0307410_12074544
296 Ga0307410_12133251
297 Ga0307406_10007338
298 Ga0307406_10018403
299 Ga0307406_10068259
300 Ga0307406_10351170
301 Ga0307406_10504137
302 Ga0307406_10534290
303 Ga0307406_10625768
304 Ga0307406_10688014
305 Ga0307406_11199088
306 Ga0307406_11437324
307 Ga0307406_11802932
308 Ga0307407_10005626
309 Ga0307407_10015461
310 Ga0307407_10069969
311 Ga0307407_10107341
312 Ga0307407_10159116
313 Ga0307407_10183093
314 Ga0307407_10269667
315 Ga0307407_10353890
316 Ga0307412_10094663
317 Ga0307412_10099581
318 Ga0307412_10217505
319 Ga0307412_10275803
320 Ga0307412_10335492
321 Ga0307412_10573361
322 Ga0307409_100004149
323 Ga0307409_100017980
324 Ga0307409_100027940
325 Ga0307409_100036837
326 Ga0307409_100048946
327 Ga0307409_100056866
328 Ga0307409_100197553
329 Ga0307409_100278173
330 Ga0307409_100307755
331 Ga0307409_100461770
332 Ga0307409_101151285
333 Ga0307416_100002613
334 Ga0307416_100014221
335 Ga0307416_100022244
336 Ga0307416_100035692
337 Ga0307416_100040092
338 Ga0307416_100047216
339 Ga0307416_100157868
340 Ga0307416_100245784
341 Ga0307416_100398852
342 Ga0307416_100468231
343 Ga0307416_100540054
344 Ga0307416_100603574
345 Ga0307416_103700435
346 Ga0307414_10105000
347 Ga0307414_10125783
348 Ga0307414_10133334
349 Ga0307414_10283953
350 Ga0307414_10514768
351 Ga0307414_11369523
352 Ga0307411_10468191
353 Ga0307411_10827768
354 Ga0307411_10898217
355 Ga0307411_11300180
356 Ga0307411_11919446
357 Ga0307415_100000426
358 Ga0307415_100004316
359 Ga0307415_100009783
360 Ga0307415_100012318
361 Ga0307415_100013192
362 Ga0307415_100026787
363 Ga0307415_100094005
364 Ga0307415_100267988
365 Ga0307415_100397830
366 Ga0307415_100499054
367 Ga0307415_100917265
368 Ga0307415_100981305
369 Ga0307415_102103070
370 Ga0395899_0063691
371 Ga0395900_0011648
372 Ga0395900_0146497
373 Ga0395900_0199976
374 Ga0395900_0426588
375 Ga0395900_1448273
376 Ga0395898_0036003
377 Ga0395898_0365263
378 Ga0395898_0507945
379 Ga0395898_0789027
380 Ga0395905_0042942
381 Ga0395905_0084166
382 Ga0395905_0104521
383 Ga0395905_0174185
384 Ga0395905_0347375
385 Ga0395905_0923377
386 Ga0395901_0015729
387 Ga0395901_0018779
388 Ga0395901_0028610
389 Ga0395901_0034636
390 Ga0395901_0036965
391 Ga0395901_0522688
392 Ga0395901_0954094
393 Ga0439448_0154969
394 Ga0439450_142050
395 Ga0439463_002064
396 Ga0439463_005298
397 Ga0450917_009109
398 Ga0450923_189593
399 Ga0450902_006938
400 Ga0450910_037602
401 Ga0439458_0072733
402 Ga0439458_0224399
403 Ga0439444_0006279
404 Ga0439460_0011955
405 Ga0439460_0146843
406 Ga0439440_0001397
407 Ga0439440_0138743
408 Ga0496110_0372544
409 Ga0501031_0009445
410 Ga0501032_0049344
411 Ga0501033_0106700
412 Ga0501034_0085671
413 Ga0501036_0018498
414 Ga0501037_0025496
415 Ga0501038_0004126
416 Ga0501038_0018033
417 Ga0501039_0017038
418 Ga0501040_0004733
419 Ga0501040_0023534
420 Ga0501041_0011582
421 Ga0501042_0032023
422 Ga0501042_0157505
423 Ga0501046_0008366
424 Ga0501046_0339326
425 Ga0501048_0032215
426 Ga0501069_0119444
427 Ga0501070_0108025
428 Ga0501070_0977035
429 Ga0501071_0014397
430 Ga0501072_0005443
431 Ga0501074_0013512
432 Ga0501075_0005090
433 Ga0501076_0039991
434 Ga0501077_0016926
435 Ga0501079_0006112
436 Ga0501079_0009284
437 Ga0501080_0196969
438 Ga0501081_0049124
439 Ga0501083_0112496
440 Ga0501035_0022881
441 Ga0501045_0006456
442 nmdc:mga05p37_249174_c1
443 nmdc:mga06r32_1012576_c1
444 nmdc:mga06r32_1280747_c1
445 nmdc:mga06r32_431008_c1
446 Ga0501084_0020046
447 Ga0590071_096744
448 Ga0590077_012569
449 Ga0501082_0003197
450 Ga0530510_0025042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20120

DUF6510

Family of unknown function (DUF6510)

3

83

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b56-assembly1.cif.gz_A structure of ectonucleotide pyrophosphatase-phosphodiesterase-1 (npp1) 0.7776 42 67
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.642 36 75
7fj7-assembly1.cif.gz_B kpacka (pduw) native structure 0.6368 51 89
3pvl-assembly1.cif.gz_A structure of myosin viia myth4-ferm-sh3 in complex with the cen1 of sans 0.611 29 67
7xfr-assembly1.cif.gz_C-2 crystal structure of wipi2b in complex with the second site of atg16l1 0.6082 43 72
ID Description Score Start End Superfamily
af_Q4E258_345_641_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9044 42 67 2.130.10.10
af_A0A286Y9F5_1479_1577_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.795 41 67 2.30.29.30
af_A0A0P0Y585_51_153_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7842 43 70 2.40.70.10
af_A0A2R8QG39_1468_1586_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7826 41 67 2.30.29.30
af_E9QIX3_18_129_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7653 55 77 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A535FL01-F1-model_v4 Uncharacterized protein 0.9625 7 88
AF-A0A849ZD49-F1-model_v4 Uncharacterized protein 0.9617 7 85
AF-A0A6V8LQH0-F1-model_v4 Uncharacterized protein 0.9605 7 87
AF-A0A535QHV0-F1-model_v4 Hydrogenase maturation nickel metallochaperone HypA 0.9582 7 87
AF-A0A536GRS1-F1-model_v4 Hydrogenase maturation nickel metallochaperone HypA 0.9558 7 87

Map