F337559

General Info

Members Datasets Scaffolds Average Seq Length
225 167 450 172

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100583850|Ga0070697_1005838501
Length 200
Sequence MSRPPAPPYRGEGPHALWHVSEDSSIKRFEPRITTGMGLGKDARGSVAVTPKSDTDKPVVWATDTRHLPLFWFPRDCPRGTFWARPETTDADVESFLDGDRSRRVHTIEGAWLDRIRAASVYAYRVPEGTFHAHTTVGGYWLSTSAVDPLEVRPLGDLLALHARSAIELRVVPSIWPLWDRVVASTLEFSGIRLRNAAPR

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
71 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.67
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 5.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100583850 3300005536 Unclassified 981
2 Ga0070675_100787233 3300005354 Bacteria 869
3 Ga0070671_100408584 3300005355 Bacteria 1162
4 Ga0070671_100553473 3300005355 Bacteria 992
5 Ga0070674_100039104 3300005356 Bacteria 3202
6 Ga0070674_100106934 3300005356 Bacteria 2048
7 Ga0070709_10088573 3300005434 Bacteria 2036
8 Ga0070714_100093848 3300005435 Bacteria 2633
9 Ga0070714_100132733 3300005435 Bacteria 2226
10 Ga0070713_100015385 3300005436 Bacteria 5716
11 Ga0070713_100761095 3300005436 Bacteria 927
12 Ga0070713_101364551 3300005436 Bacteria 687
13 Ga0070710_10145915 3300005437 Bacteria 1455
14 Ga0070711_100014632 3300005439 Bacteria 4945
15 Ga0070705_100443557 3300005440 Bacteria 972
16 Ga0070700_100550963 3300005441 Bacteria 896
17 Ga0070694_100209011 3300005444 Bacteria 1459
18 Ga0068867_101197060 3300005459 Bacteria 698
19 Ga0070706_100669760 3300005467 Bacteria 963
20 Ga0070707_100555401 3300005468 Bacteria 1110
21 Ga0070707_101154807 3300005468 Unclassified 740
22 Ga0070698_100184558 3300005471 Bacteria 2024
23 Ga0070698_100552024 3300005471 Bacteria 1091
24 Ga0070699_100453819 3300005518 Bacteria 1162
25 Ga0070697_100771091 3300005536 Bacteria 850
26 Ga0070672_100163953 3300005543 Bacteria 1846
27 Ga0070686_100197273 3300005544 Bacteria 1440
28 Ga0070665_100031537 3300005548 Bacteria 5334
29 Ga0070704_100282638 3300005549 Bacteria 1375
30 Ga0070704_101011324 3300005549 Unclassified 752
31 Ga0068864_100650419 3300005618 Bacteria 1026
32 Ga0068870_10012713 3300005840 Bacteria 3940
33 Ga0068858_100198574 3300005842 Bacteria 1896
34 Ga0070715_10008651 3300006163 Bacteria 3555
35 Ga0070716_100026937 3300006173 Bacteria 3082
36 Ga0070716_100328983 3300006173 Bacteria 1074
37 Ga0097621_100314922 3300006237 Bacteria 1385
38 Ga0075433_10418108 3300006852 Bacteria 1182
39 Ga0075434_100071552 3300006871 Bacteria 3459
40 Ga0075434_100343827 3300006871 Unclassified 1513
41 Ga0075434_100356994 3300006871 Bacteria 1483
42 Ga0075436_100025992 3300006914 Bacteria 4031
43 Ga0075436_100368612 3300006914 Bacteria 1037
44 Ga0075436_100466177 3300006914 Bacteria 921
45 Ga0075435_100035754 3300007076 Bacteria 3943
46 Ga0075435_100133176 3300007076 Bacteria 2081
47 Ga0075435_100342218 3300007076 Unclassified 1281
48 Ga0111539_10179004 3300009094 Bacteria 2477
49 Ga0105245_11290734 3300009098 Bacteria 779
50 Ga0114129_10013130 3300009147 Bacteria 11799
51 Ga0114129_10755120 3300009147 Bacteria 1245
52 Ga0105241_10407250 3300009174 Bacteria 1194
53 Ga0157374_10137931 3300013296 Bacteria 2366
54 Ga0157375_10348732 3300013308 Bacteria 1646
55 Ga0163163_11311972 3300014325 Bacteria 786
56 Ga0157380_11845557 3300014326 Bacteria 664
57 Ga0157379_11778089 3300014968 Bacteria 605
58 Ga0163161_10323863 3300017792 Bacteria 1219
59 Ga0207692_10019730 3300025898 Bacteria 3052
60 Ga0207688_10125439 3300025901 Bacteria 1501
61 Ga0207688_10468951 3300025901 Bacteria 786
62 Ga0207685_10000993 3300025905 Bacteria 5493
63 Ga0207699_10053650 3300025906 Bacteria 2391
64 Ga0207643_10027277 3300025908 Bacteria 3166
65 Ga0207684_10231179 3300025910 Unclassified 1595
66 Ga0207693_10006272 3300025915 Bacteria 9862
67 Ga0207663_10003238 3300025916 Bacteria 7934
68 Ga0207646_10000222 3300025922 Bacteria 77632
69 Ga0207646_10835331 3300025922 Bacteria 819
70 Ga0207659_10398067 3300025926 Bacteria 1151
71 Ga0207664_10106997 3300025929 Bacteria 2320
72 Ga0207664_10369092 3300025929 Bacteria 1273
73 Ga0207644_10352796 3300025931 Bacteria 1195
74 Ga0207709_10050354 3300025935 Bacteria 2547
75 Ga0207670_10513940 3300025936 Bacteria 974
76 Ga0207669_10013996 3300025937 Bacteria 4008
77 Ga0207665_10004571 3300025939 Bacteria 9185
78 Ga0207691_10025442 3300025940 Bacteria 5557
79 Ga0207691_10085934 3300025940 Bacteria 2823
80 Ga0207679_10254588 3300025945 Bacteria 1494
81 Ga0207668_10390500 3300025972 Bacteria 1174
82 Ga0207640_10362999 3300025981 Bacteria 1168
83 Ga0207677_11295485 3300026023 Unclassified 669
84 Ga0207708_10276813 3300026075 Bacteria 1359
85 Ga0207702_10092328 3300026078 Bacteria 2653
86 Ga0207648_10173604 3300026089 Bacteria 1906
87 Ga0207674_10118370 3300026116 Bacteria 2619
88 Ga0268266_10033157 3300028379 Bacteria 4392
89 Ga0307409_100206828 3300031995 Bacteria 1761
90 Ga0307416_100040178 3300032002 Bacteria 3631
91 Ga0307416_100254687 3300032002 Bacteria 1711
92 Ga0316583_10088553 3300032133 Bacteria 1080
93 Ga0373934_0129893 3300035086 Bacteria 1027
94 Ga0373955_0349045 3300035172 Bacteria 896
95 Ga0373924_0210173 3300035410 Bacteria 859
96 Ga0373931_0474814 3300035691 Bacteria 803
97 Ga0373937_0000842 3300036401 Bacteria 26299
98 Ga0373937_0817728 3300036401 Bacteria 880
99 Ga0395899_0072720 3300037312 Bacteria 2516
100 Ga0395900_0070974 3300037418 Bacteria 3580
101 Ga0395900_0094226 3300037418 Bacteria 3076
102 Ga0395900_0191047 3300037418 Bacteria 2077
103 Ga0395900_0694029 3300037418 Archaea 952
104 Ga0395898_0143604 3300037466 Bacteria 2285
105 Ga0395898_0471641 3300037466 Unclassified 1194
106 Ga0395898_1176533 3300037466 Bacteria 698
107 Ga0395905_0065576 3300037471 Bacteria 3400
108 Ga0436364_0133854 3300037853 Bacteria 10209
109 Ga0395901_0082264 3300038443 Bacteria 3364
110 Ga0395901_0088815 3300038443 Bacteria 3233
111 Ga0395901_0169475 3300038443 Bacteria 2291
112 Ga0395901_0743289 3300038443 Unclassified 975
113 Ga0395901_0971081 3300038443 Bacteria 827
114 Ga0436362_1119336 3300039453 Bacteria 934
115 Ga0450920_003216 3300042122 Bacteria 2819
116 Ga0466961_0191880 3300044693 Bacteria 1266
117 Ga0466963_0000049 3300044694 Bacteria 39571
118 Ga0466963_0000760 3300044694 Bacteria 15952
119 Ga0466963_0367770 3300044694 Bacteria 1013
120 Ga0466963_0708379 3300044694 Bacteria 710
121 Ga0466964_0022150 3300044706 Bacteria 2462
122 Ga0466968_0029102 3300044735 Bacteria 2282
123 Ga0466957_0174301 3300044842 Unclassified 1402
124 Ga0466959_0302099 3300045049 Bacteria 1096
125 Ga0466959_0533112 3300045049 Unclassified 792
126 Ga0466958_0021763 3300045836 Bacteria 3750
127 Ga0466958_0045361 3300045836 Bacteria 2651
128 Ga0466967_0000159 3300045976 Bacteria 27108
129 Ga0466967_0003379 3300045976 Bacteria 10393
130 Ga0466967_0206518 3300045976 Bacteria 1862
131 Ga0466967_0477547 3300045976 Bacteria 1221
132 Ga0466967_0601766 3300045976 Bacteria 1085
133 Ga0495592_0005420 3300046454 Bacteria 9421
134 Ga0495651_0000004 3300046462 Bacteria 177080
135 Ga0495653_0007037 3300046463 Bacteria 9231
136 Ga0495605_0027740 3300046474 Bacteria 2931
137 Ga0495585_0021373 3300046492 Bacteria 3716
138 Ga0495596_0093209 3300046500 Bacteria 1169
139 Ga0495608_0013747 3300046511 Bacteria 5615
140 Ga0495608_0024372 3300046511 Bacteria 4139
141 Ga0495618_0027582 3300046514 Bacteria 3534
142 Ga0495628_0001177 3300046516 Bacteria 23864
143 Ga0495631_0353720 3300046518 Bacteria 625
144 Ga0495644_0002071 3300046523 Bacteria 8091
145 Ga0495652_0000047 3300046529 Bacteria 121525
146 Ga0495587_0000175 3300046536 Bacteria 46737
147 Ga0495609_0233403 3300046538 Bacteria 761
148 Ga0495645_0000028 3300046543 Bacteria 113461
149 Ga0495667_0055055 3300046559 Bacteria 2616
150 Ga0495656_0001124 3300046615 Bacteria 8704
151 Ga0495611_0063169 3300046648 Bacteria 1685
152 Ga0495635_0108314 3300046663 Unclassified 1898
153 Ga0495659_0076026 3300046664 Bacteria 1266
154 Ga0495657_0002632 3300046675 Bacteria 15029
155 Ga0495657_0005701 3300046675 Bacteria 9806
156 Ga0495599_0000073 3300046678 Bacteria 70685
157 Ga0495623_0000105 3300046679 Bacteria 51809
158 Ga0495646_0013541 3300046680 Bacteria 5185
159 Ga0495670_0495069 3300046691 Bacteria 664
160 Ga0495671_0112453 3300046692 Bacteria 1330
161 Ga0495600_0141536 3300046809 Bacteria 1560
162 Ga0495600_0155069 3300046809 Bacteria 1481
163 Ga0495604_0000027 3300047317 Bacteria 143025
164 Ga0495674_0098784 3300047319 Bacteria 2486
165 Ga0495680_0001582 3300047322 Bacteria 24358
166 Ga0495680_0012072 3300047322 Bacteria 7622
167 Ga0495675_0000273 3300047444 Bacteria 37403
168 Ga0495677_0062628 3300047445 Bacteria 1381
169 Ga0495602_0000096 3300048088 Bacteria 82587
170 Ga0496100_0005501 3300048903 Bacteria 6830
171 Ga0496101_0007488 3300048904 Bacteria 7076
172 Ga0496102_0058734 3300048905 Bacteria 3515
173 Ga0496103_0007436 3300048906 Bacteria 6530
174 Ga0496104_0084526 3300048907 Bacteria 3028
175 Ga0496105_0031611 3300048908 Bacteria 4339
176 Ga0496105_0100140 3300048908 Bacteria 2393
177 Ga0496106_0037631 3300048909 Bacteria 3620
178 Ga0496107_0042101 3300048910 Bacteria 3280
179 Ga0496108_0054258 3300048911 Bacteria 3363
180 Ga0496109_0342620 3300048912 Bacteria 1411
181 Ga0496110_0062180 3300048913 Bacteria 3297
182 Ga0496112_0060777 3300048915 Bacteria 3724
183 Ga0496112_0255793 3300048915 Bacteria 1701
184 Ga0496114_0438048 3300048917 Bacteria 1157
185 Ga0501036_0264899 3300049572 Bacteria 1439
186 Ga0501039_0244220 3300049575 Bacteria 1412
187 Ga0501039_0518563 3300049575 Bacteria 936
188 Ga0501042_0633733 3300049578 Bacteria 777
189 Ga0501048_0223619 3300049582 Bacteria 1336
190 Ga0501067_0002246 3300049583 Bacteria 10664
191 Ga0501067_0085562 3300049583 Bacteria 1749
192 Ga0501068_0110409 3300049584 Bacteria 1709
193 Ga0501069_0006594 3300049585 Bacteria 6069
194 Ga0501069_0012723 3300049585 Bacteria 4479
195 Ga0501071_0058578 3300049587 Bacteria 2786
196 Ga0501071_0139768 3300049587 Bacteria 1803
197 Ga0501072_0711380 3300049588 Bacteria 789
198 Ga0501072_0954314 3300049588 Bacteria 669
199 Ga0501074_0288809 3300049590 Bacteria 1166
200 Ga0501076_0058658 3300049592 Bacteria 3060
201 Ga0501076_0174179 3300049592 Bacteria 1754
202 Ga0501077_0310538 3300049593 Bacteria 1005
203 Ga0501079_0081979 3300049741 Bacteria 2495
204 Ga0501079_0312467 3300049741 Bacteria 1230
205 Ga0501081_0894266 3300049743 Bacteria 670
206 Ga0501045_0198754 3300049824 Bacteria 1494
207 nmdc:mga05p37_12812_c2 3300050507 Bacteria 9407
208 nmdc:mga09592_236512_c1 3300050508 Bacteria 1582
209 nmdc:mga08y16_271297_c1 3300050511 Bacteria 1751
210 nmdc:mga0n895_197575_c1 3300050512 Bacteria 2042
211 nmdc:mga0n895_283638_c1 3300050512 Bacteria 1679
212 nmdc:mga0n895_423231_c1 3300050512 Unclassified 1346
213 nmdc:mga0rr50_133196_c1 3300050513 Bacteria 1992
214 nmdc:mga0rr50_404369_c1 3300050513 Bacteria 1153
215 nmdc:mga08x19_436137_c1 3300050514 Bacteria 921
216 nmdc:mga0a205_14226_c1 3300050515 Bacteria 7421
217 Ga0495601_0000585 3300053077 Bacteria 19382
218 Ga0495612_0187314 3300053078 Bacteria 910
219 Ga0495655_0206832 3300053083 Bacteria 644
220 Ga0495595_0004195 3300053084 Bacteria 5797
221 Ga0495619_0001233 3300053085 Bacteria 16742
222 Ga0495619_0021114 3300053085 Bacteria 4155
223 Ga0501084_0633233 3300054114 Bacteria 903
224 Ga0501082_0533989 3300060353 Bacteria 1026
225 Ga0530510_0050046 3300061734 Bacteria 3018
226 Ga0070697_100583850
227 Ga0070675_100787233
228 Ga0070671_100408584
229 Ga0070671_100553473
230 Ga0070674_100039104
231 Ga0070674_100106934
232 Ga0070709_10088573
233 Ga0070714_100093848
234 Ga0070714_100132733
235 Ga0070713_100015385
236 Ga0070713_100761095
237 Ga0070713_101364551
238 Ga0070710_10145915
239 Ga0070711_100014632
240 Ga0070705_100443557
241 Ga0070700_100550963
242 Ga0070694_100209011
243 Ga0068867_101197060
244 Ga0070706_100669760
245 Ga0070707_100555401
246 Ga0070707_101154807
247 Ga0070698_100184558
248 Ga0070698_100552024
249 Ga0070699_100453819
250 Ga0070697_100771091
251 Ga0070672_100163953
252 Ga0070686_100197273
253 Ga0070665_100031537
254 Ga0070704_100282638
255 Ga0070704_101011324
256 Ga0068864_100650419
257 Ga0068870_10012713
258 Ga0068858_100198574
259 Ga0070715_10008651
260 Ga0070716_100026937
261 Ga0070716_100328983
262 Ga0097621_100314922
263 Ga0075433_10418108
264 Ga0075434_100071552
265 Ga0075434_100343827
266 Ga0075434_100356994
267 Ga0075436_100025992
268 Ga0075436_100368612
269 Ga0075436_100466177
270 Ga0075435_100035754
271 Ga0075435_100133176
272 Ga0075435_100342218
273 Ga0111539_10179004
274 Ga0105245_11290734
275 Ga0114129_10013130
276 Ga0114129_10755120
277 Ga0105241_10407250
278 Ga0157374_10137931
279 Ga0157375_10348732
280 Ga0163163_11311972
281 Ga0157380_11845557
282 Ga0157379_11778089
283 Ga0163161_10323863
284 Ga0207692_10019730
285 Ga0207688_10125439
286 Ga0207688_10468951
287 Ga0207685_10000993
288 Ga0207699_10053650
289 Ga0207643_10027277
290 Ga0207684_10231179
291 Ga0207693_10006272
292 Ga0207663_10003238
293 Ga0207646_10000222
294 Ga0207646_10835331
295 Ga0207659_10398067
296 Ga0207664_10106997
297 Ga0207664_10369092
298 Ga0207644_10352796
299 Ga0207709_10050354
300 Ga0207670_10513940
301 Ga0207669_10013996
302 Ga0207665_10004571
303 Ga0207691_10025442
304 Ga0207691_10085934
305 Ga0207679_10254588
306 Ga0207668_10390500
307 Ga0207640_10362999
308 Ga0207677_11295485
309 Ga0207708_10276813
310 Ga0207702_10092328
311 Ga0207648_10173604
312 Ga0207674_10118370
313 Ga0268266_10033157
314 Ga0307409_100206828
315 Ga0307416_100040178
316 Ga0307416_100254687
317 Ga0316583_10088553
318 Ga0373934_0129893
319 Ga0373955_0349045
320 Ga0373924_0210173
321 Ga0373931_0474814
322 Ga0373937_0000842
323 Ga0373937_0817728
324 Ga0395899_0072720
325 Ga0395900_0070974
326 Ga0395900_0094226
327 Ga0395900_0191047
328 Ga0395900_0694029
329 Ga0395898_0143604
330 Ga0395898_0471641
331 Ga0395898_1176533
332 Ga0395905_0065576
333 Ga0436364_0133854
334 Ga0395901_0082264
335 Ga0395901_0088815
336 Ga0395901_0169475
337 Ga0395901_0743289
338 Ga0395901_0971081
339 Ga0436362_1119336
340 Ga0450920_003216
341 Ga0466961_0191880
342 Ga0466963_0000049
343 Ga0466963_0000760
344 Ga0466963_0367770
345 Ga0466963_0708379
346 Ga0466964_0022150
347 Ga0466968_0029102
348 Ga0466957_0174301
349 Ga0466959_0302099
350 Ga0466959_0533112
351 Ga0466958_0021763
352 Ga0466958_0045361
353 Ga0466967_0000159
354 Ga0466967_0003379
355 Ga0466967_0206518
356 Ga0466967_0477547
357 Ga0466967_0601766
358 Ga0495592_0005420
359 Ga0495651_0000004
360 Ga0495653_0007037
361 Ga0495605_0027740
362 Ga0495585_0021373
363 Ga0495596_0093209
364 Ga0495608_0013747
365 Ga0495608_0024372
366 Ga0495618_0027582
367 Ga0495628_0001177
368 Ga0495631_0353720
369 Ga0495644_0002071
370 Ga0495652_0000047
371 Ga0495587_0000175
372 Ga0495609_0233403
373 Ga0495645_0000028
374 Ga0495667_0055055
375 Ga0495656_0001124
376 Ga0495611_0063169
377 Ga0495635_0108314
378 Ga0495659_0076026
379 Ga0495657_0002632
380 Ga0495657_0005701
381 Ga0495599_0000073
382 Ga0495623_0000105
383 Ga0495646_0013541
384 Ga0495670_0495069
385 Ga0495671_0112453
386 Ga0495600_0141536
387 Ga0495600_0155069
388 Ga0495604_0000027
389 Ga0495674_0098784
390 Ga0495680_0001582
391 Ga0495680_0012072
392 Ga0495675_0000273
393 Ga0495677_0062628
394 Ga0495602_0000096
395 Ga0496100_0005501
396 Ga0496101_0007488
397 Ga0496102_0058734
398 Ga0496103_0007436
399 Ga0496104_0084526
400 Ga0496105_0031611
401 Ga0496105_0100140
402 Ga0496106_0037631
403 Ga0496107_0042101
404 Ga0496108_0054258
405 Ga0496109_0342620
406 Ga0496110_0062180
407 Ga0496112_0060777
408 Ga0496112_0255793
409 Ga0496114_0438048
410 Ga0501036_0264899
411 Ga0501039_0244220
412 Ga0501039_0518563
413 Ga0501042_0633733
414 Ga0501048_0223619
415 Ga0501067_0002246
416 Ga0501067_0085562
417 Ga0501068_0110409
418 Ga0501069_0006594
419 Ga0501069_0012723
420 Ga0501071_0058578
421 Ga0501071_0139768
422 Ga0501072_0711380
423 Ga0501072_0954314
424 Ga0501074_0288809
425 Ga0501076_0058658
426 Ga0501076_0174179
427 Ga0501077_0310538
428 Ga0501079_0081979
429 Ga0501079_0312467
430 Ga0501081_0894266
431 Ga0501045_0198754
432 nmdc:mga05p37_12812_c2
433 nmdc:mga09592_236512_c1
434 nmdc:mga08y16_271297_c1
435 nmdc:mga0n895_197575_c1
436 nmdc:mga0n895_283638_c1
437 nmdc:mga0n895_423231_c1
438 nmdc:mga0rr50_133196_c1
439 nmdc:mga0rr50_404369_c1
440 nmdc:mga08x19_436137_c1
441 nmdc:mga0a205_14226_c1
442 Ga0495601_0000585
443 Ga0495612_0187314
444 Ga0495655_0206832
445 Ga0495595_0004195
446 Ga0495619_0001233
447 Ga0495619_0021114
448 Ga0501084_0633233
449 Ga0501082_0533989
450 Ga0530510_0050046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21820

DUF6886

Family of unknown function (DUF6886)

18

197

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zhl-assembly1.cif.gz_A salmonella enterica rhs1 c-terminal toxin tretu 0.4967 92 136
1hx5-assembly1.cif.gz_A crystal structure of m. tuberculosis chaperonin-10 0.4652 105 135
4hn7-assembly1.cif.gz_A-2 crystal structure of e. coli pmrd 0.3685 103 148
7zhm-assembly1.cif.gz_A salmonella enterica rhs1 c-terminal toxin tretu complex with tritu immunity protein 0.3374 63 135
3lqu-assembly1.cif.gz_B crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase complexed with ribulose-5 phosphate 0.3346 122 166
ID Description Score Start End Superfamily
1hx5A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.4652 105 135 2.30.33.40
af_Q3UD82_676_823_3.90.228.10 Alpha Beta;Alpha-Beta Complex;Phosphoenolpyruvate Carboxykinase; domain 3; 0.4592 101 139 3.90.228.10
4hn7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.3685 103 148 2.40.50.650
af_C6SZS0_7_134_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.3446 58 143 2.60.40.150
af_Q9UT45_73_285_2.70.98.30 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5;Golgi alpha-mannosidase II; domain 4 0.3415 101 146 2.70.98.30
ID Description Score Start End GO Terms
AF-A0A7W0JKD8-F1-model_v4 Uncharacterized protein 0.9721 22 184
AF-A0A7W0JKD8-F1-model_v4 Uncharacterized protein 0.9605 22 184
AF-A0A535I829-F1-model_v4 DUF402 domain-containing protein 0.9553 17 184
AF-A0A7X4YMK6-F1-model_v4 DUF4433 domain-containing protein 0.9446 18 183
AF-A0A0S7XME6-F1-model_v4 Uncharacterized protein 0.9413 18 183

Map