F337541

General Info

Members Datasets Scaffolds Average Seq Length
225 172 450 124

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100108970|Ga0070706_1001089703
Length 137
Sequence MPVAFRRRERREAVAVPILKQGDVLIASIQSALSDQDLVQLRDDFADQVGRFRSRGIIIDVTALDVLDSFATRTLQSIAYIAKLRGASTVVVGIQPDVAFAMVQLGLSLEGVATALDLEEGLAHTAAIAKQGRHRVR

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
54 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
99 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
102 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
103 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
104 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
105 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
106 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
107 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
108 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
109 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
160 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
164 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
165 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
166 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2515154123 Trinickia symbiotica JPY347 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.22
Metatranscriptomes 5.33
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 0.44
Rhizoplane 3.11
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 14.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100108970 3300005467 Bacteria 2577
2 JGI24739J22299_10067499 3300001989 Bacteria 1117
3 JGI24737J22298_10128121 3300001990 Unclassified 750
4 JGI24735J21928_10003327 3300002067 Bacteria 5484
5 JGI25156J39149_1035038 3300002705 Unclassified 723
6 rootH1_10061087 3300003323 Bacteria 3647
7 rootH1_10105351 3300003323 Bacteria 3240
8 rootH1_10237951 3300003323 Bacteria 1284
9 Ga0070658_10057153 3300005327 Bacteria 3173
10 Ga0068869_100863583 3300005334 Bacteria 781
11 Ga0070660_100000472 3300005339 Bacteria 26882
12 Ga0070687_100318141 3300005343 Bacteria 993
13 Ga0070661_100617861 3300005344 Bacteria 877
14 Ga0070688_100163248 3300005365 Bacteria 1532
15 Ga0070709_10051828 3300005434 Bacteria 2577
16 Ga0070714_100480393 3300005435 Bacteria 1183
17 Ga0070708_100007410 3300005445 Bacteria 8780
18 Ga0070663_100315157 3300005455 Bacteria 1256
19 Ga0070662_100782623 3300005457 Unclassified 810
20 Ga0070706_100100848 3300005467 Unclassified 2683
21 Ga0070707_100025014 3300005468 Bacteria 5662
22 Ga0070707_100424922 3300005468 Bacteria 1289
23 Ga0070707_100532710 3300005468 Bacteria 1136
24 Ga0070707_100732410 3300005468 Bacteria 952
25 Ga0070698_100980182 3300005471 Bacteria 792
26 Ga0070679_100161531 3300005530 Bacteria 2215
27 Ga0070686_100426808 3300005544 Bacteria 1014
28 Ga0068855_100000015 3300005563 Bacteria 223993
29 Ga0068855_100021327 3300005563 Bacteria 7769
30 Ga0068852_100474475 3300005616 Bacteria 1242
31 Ga0068859_100197834 3300005617 Unclassified 2094
32 Ga0081455_10362091 3300005937 Bacteria 1019
33 Ga0075363_100269008 3300006048 Bacteria 984
34 Ga0075366_10077542 3300006195 Bacteria 1983
35 Ga0075370_10360821 3300006353 Bacteria 869
36 Ga0075428_100034855 3300006844 Bacteria 5550
37 Ga0075431_100098482 3300006847 Bacteria 3019
38 Ga0075431_100608751 3300006847 Bacteria 1076
39 Ga0075431_100652759 3300006847 Bacteria 1032
40 Ga0097620_100197834 3300006931 Unclassified 2094
41 Ga0099794_10037288 3300007265 Bacteria 2300
42 Ga0105240_10007311 3300009093 Bacteria 16070
43 Ga0114129_10034333 3300009147 Bacteria 7162
44 Ga0114129_10129312 3300009147 Bacteria 3471
45 Ga0105237_10009788 3300009545 Bacteria 10249
46 Ga0105238_10475021 3300009551 Bacteria 1249
47 Ga0105238_10493577 3300009551 Bacteria 1224
48 Ga0099796_10004811 3300010159 Bacteria 3307
49 Ga0099796_10016590 3300010159 Bacteria 2177
50 Ga0099796_10539570 3300010159 Unclassified 524
51 Ga0105239_10005183 3300010375 Bacteria 15356
52 Ga0154016_104683 3300013045 Bacteria 1041
53 Ga0157373_10002080 3300013100 Bacteria 15158
54 Ga0157371_10094045 3300013102 Unclassified 2124
55 Ga0157370_10004570 3300013104 Bacteria 15845
56 Ga0157370_10141005 3300013104 Bacteria 2246
57 Ga0157370_10243701 3300013104 Bacteria 1663
58 Ga0157369_10000268 3300013105 Bacteria 70336
59 Ga0157369_10000517 3300013105 Bacteria 50746
60 Ga0157369_10087353 3300013105 Bacteria 3330
61 Ga0157374_10000390 3300013296 Bacteria 40131
62 Ga0157372_10010494 3300013307 Bacteria 9862
63 Ga0157372_10554630 3300013307 Bacteria 1339
64 Ga0182006_1137316 3300015261 Unclassified 837
65 Ga0182007_10021494 3300015262 Bacteria 2291
66 Ga0197907_10207134 3300020069 Bacteria 1793
67 Ga0206356_10065709 3300020070 Bacteria 2883
68 Ga0206356_10296657 3300020070 Bacteria 892
69 Ga0206354_11278436 3300020081 Unclassified 738
70 Ga0206354_11451404 3300020081 Bacteria 1175
71 Ga0206353_10819949 3300020082 Bacteria 4323
72 Ga0206353_11894579 3300020082 Bacteria 1546
73 Ga0224712_10000001 3300022467 Bacteria 72814
74 Ga0224712_10008612 3300022467 Bacteria 3033
75 Ga0228598_1061796 3300024227 Unclassified 746
76 Ga0209672_100132 3300025228 Bacteria 73895
77 Ga0209759_1006841 3300025256 Bacteria 3771
78 Ga0207647_10000452 3300025904 Bacteria 33403
79 Ga0207705_10029880 3300025909 Bacteria 3886
80 Ga0207684_10094593 3300025910 Unclassified 2549
81 Ga0207707_10613497 3300025912 Unclassified 920
82 Ga0207695_10151979 3300025913 Bacteria 2254
83 Ga0207662_10422660 3300025918 Bacteria 907
84 Ga0207657_10060989 3300025919 Bacteria 3236
85 Ga0207649_10124987 3300025920 Bacteria 1739
86 Ga0207649_10667206 3300025920 Bacteria 804
87 Ga0207646_10066461 3300025922 Unclassified 3219
88 Ga0207646_10160232 3300025922 Bacteria 2030
89 Ga0207646_10374949 3300025922 Bacteria 1285
90 Ga0207694_10249187 3300025924 Bacteria 1453
91 Ga0207694_11126941 3300025924 Bacteria 664
92 Ga0207664_10546368 3300025929 Unclassified 1039
93 Ga0207690_10534717 3300025932 Bacteria 951
94 Ga0207706_10699286 3300025933 Bacteria 866
95 Ga0207670_10011169 3300025936 Bacteria 5203
96 Ga0207689_11671939 3300025942 Bacteria 528
97 Ga0207679_10010960 3300025945 Bacteria 5850
98 Ga0207667_10000315 3300025949 Bacteria 67202
99 Ga0207667_10013049 3300025949 Bacteria 9538
100 Ga0207658_10184768 3300025986 Bacteria 1728
101 Ga0207677_11272296 3300026023 Bacteria 675
102 Ga0207678_10266889 3300026067 Bacteria 1467
103 Ga0207678_10560700 3300026067 Bacteria 999
104 Ga0207708_10193189 3300026075 Bacteria 1621
105 Ga0207702_10095724 3300026078 Bacteria 2610
106 Ga0207675_100015446 3300026118 Bacteria 7122
107 Ga0207698_10429617 3300026142 Bacteria 1270
108 Ga0209179_1035942 3300027512 Bacteria 1031
109 Ga0209588_1183980 3300027671 Unclassified 655
110 Ga0307517_10023230 3300028786 Bacteria 7720
111 Ga0307515_10575945 3300028794 Bacteria 736
112 Ga0265763_1004030 3300030763 Bacteria 1189
113 Ga0265760_10049014 3300031090 Bacteria 1269
114 Ga0265332_10031588 3300031238 Bacteria 2309
115 Ga0307509_10438989 3300031507 Bacteria 1002
116 Ga0307509_10789927 3300031507 Bacteria 614
117 Ga0307509_10946033 3300031507 Bacteria 527
118 Ga0307516_10117946 3300031730 Bacteria 2448
119 Ga0373960_0352393 3300035121 Bacteria 558
120 Ga0395899_0000097 3300037312 Bacteria 152056
121 Ga0395899_0115187 3300037312 Bacteria 1929
122 Ga0395900_0000225 3300037418 Bacteria 89034
123 Ga0395900_0064615 3300037418 Bacteria 3760
124 Ga0395900_0165421 3300037418 Bacteria 2254
125 Ga0395900_1073141 3300037418 Bacteria 723
126 Ga0395898_0000346 3300037466 Bacteria 104661
127 Ga0395898_0000708 3300037466 Bacteria 59283
128 Ga0395898_0014259 3300037466 Bacteria 8169
129 Ga0395898_0026073 3300037466 Bacteria 5885
130 Ga0395905_0021301 3300037471 Bacteria 6132
131 Ga0395901_0000034 3300038443 Bacteria 230365
132 Ga0395901_0000121 3300038443 Bacteria 100690
133 Ga0395901_0114123 3300038443 Bacteria 2837
134 Ga0395901_0608683 3300038443 Bacteria 1101
135 Ga0395901_0699060 3300038443 Bacteria 1012
136 Ga0436365_0312911 3300039437 Bacteria 698
137 Ga0436362_0796790 3300039453 Bacteria 659
138 Ga0451791_0268023 3300041451 Bacteria 3583
139 Ga0451793_0090275 3300041452 Bacteria 1600
140 Ga0451797_1580995 3300041453 Unclassified 536
141 Ga0451802_0335210 3300041460 Bacteria 802
142 Ga0451804_0117188 3300041463 Unclassified 705
143 Ga0451837_1470877 3300041494 Bacteria 1426
144 Ga0451839_0035181 3300041496 Bacteria 865
145 Ga0451841_0172323 3300041498 Bacteria 2678
146 Ga0451845_0762293 3300041501 Bacteria 1074
147 Ga0451849_1466735 3300041505 Unclassified 2454
148 Ga0451851_0247094 3300041507 Bacteria 2703
149 Ga0451843_1248438 3300041509 Bacteria 2006
150 Ga0451855_1274833 3300041511 Unclassified 508
151 Ga0451853_0052533 3300041512 Bacteria 1244
152 Ga0451853_0140934 3300041512 Bacteria 16854
153 Ga0451853_2390330 3300041512 Bacteria 554
154 Ga0439448_0017684 3300042005 Unclassified 2178
155 Ga0439455_0042185 3300042012 Unclassified 1171
156 Ga0439458_0060955 3300042157 Bacteria 942
157 Ga0439440_0138210 3300042993 Unclassified 690
158 Ga0466969_0001130 3300044656 Bacteria 14359
159 Ga0466972_0001043 3300044658 Bacteria 13290
160 Ga0466972_0033896 3300044658 Bacteria 2504
161 Ga0466966_0023273 3300044684 Bacteria 4058
162 Ga0466966_0128395 3300044684 Bacteria 1553
163 Ga0466961_0005580 3300044693 Bacteria 7945
164 Ga0466961_0110708 3300044693 Bacteria 1728
165 Ga0466963_0002461 3300044694 Bacteria 10349
166 Ga0466964_0101203 3300044706 Bacteria 1271
167 Ga0466964_0202779 3300044706 Bacteria 953
168 Ga0466971_0268198 3300044719 Unclassified 816
169 Ga0466968_0261405 3300044735 Bacteria 824
170 Ga0466968_0610421 3300044735 Bacteria 551
171 Ga0466970_0216857 3300044765 Bacteria 1067
172 Ga0466957_0050026 3300044842 Bacteria 2542
173 Ga0466957_0181863 3300044842 Unclassified 1373
174 Ga0466960_0128952 3300044901 Bacteria 1333
175 Ga0466959_0088958 3300045049 Bacteria 2219
176 Ga0451576_0528677 3300045051 Bacteria 1239
177 Ga0466958_0017790 3300045836 Bacteria 4115
178 Ga0466967_0123885 3300045976 Bacteria 2392
179 Ga0495652_0240389 3300046529 Bacteria 1348
180 Ga0495667_0667892 3300046559 Bacteria 645
181 Ga0495646_0559844 3300046680 Bacteria 583
182 Ga0495604_0513951 3300047317 Unclassified 776
183 Ga0495687_212378 3300047443 Unclassified 605
184 Ga0496112_1547722 3300048915 Unclassified 577
185 Ga0496115_0090196 3300048918 Bacteria 2504
186 Ga0501031_0330447 3300049568 Bacteria 987
187 Ga0501036_0914637 3300049572 Unclassified 720
188 Ga0501041_0372321 3300049577 Bacteria 903
189 Ga0501042_0322994 3300049578 Bacteria 1115
190 Ga0501042_1190440 3300049578 Bacteria 556
191 Ga0501046_0046874 3300049580 Bacteria 3429
192 Ga0501046_0457005 3300049580 Bacteria 918
193 Ga0501048_0089127 3300049582 Bacteria 2176
194 Ga0501067_0260639 3300049583 Bacteria 965
195 Ga0501068_0234457 3300049584 Bacteria 1167
196 Ga0501069_0673440 3300049585 Bacteria 623
197 Ga0501071_0019189 3300049587 Bacteria 4745
198 Ga0501071_1612736 3300049587 Unclassified 501
199 Ga0501072_0047070 3300049588 Bacteria 3396
200 Ga0501073_0021303 3300049589 Bacteria 4673
201 Ga0501075_0984064 3300049591 Bacteria 641
202 Ga0501076_0053597 3300049592 Bacteria 3197
203 Ga0501077_0100918 3300049593 Bacteria 1829
204 Ga0501079_0190395 3300049741 Bacteria 1601
205 Ga0501081_0052867 3300049743 Bacteria 2804
206 Ga0501083_0592589 3300049744 Bacteria 721
207 Ga0501044_0743781 3300049823 Bacteria 863
208 nmdc:mga07m45_219404_c1 3300050496 Bacteria 1106
209 nmdc:mga05p37_230817_c1 3300050507 Bacteria 2230
210 nmdc:mga06r32_200506_c1 3300050510 Bacteria 1983
211 nmdc:mga06r32_359445_c1 3300050510 Bacteria 1440
212 Ga0500635_0075875 3300053080 Bacteria 1200
213 Ga0500578_0174206 3300053086 Bacteria 1329
214 Ga0500583_0428264 3300053092 Unclassified 631
215 Ga0500566_0000566 3300053094 Bacteria 20793
216 Ga0500650_0507192 3300053098 Unclassified 512
217 Ga0500614_068664 3300053123 Bacteria 968
218 Ga0500585_011097 3300053144 Bacteria 2652
219 Ga0500603_015086 3300053150 Bacteria 1814
220 Ga0500622_0070839 3300053156 Bacteria 1763
221 Ga0501084_0572393 3300054114 Bacteria 954
222 Ga0501082_0460632 3300060353 Bacteria 1111
223 Ga0466962_0062466 3300061719 Bacteria 1778
224 Ga0530510_0034007 3300061734 Bacteria 3671
225 2515687503 2515154123 Bacteria 6387382
226 Ga0070706_100108970
227 JGI24739J22299_10067499
228 JGI24737J22298_10128121
229 JGI24735J21928_10003327
230 JGI25156J39149_1035038
231 rootH1_10061087
232 rootH1_10105351
233 rootH1_10237951
234 Ga0070658_10057153
235 Ga0068869_100863583
236 Ga0070660_100000472
237 Ga0070687_100318141
238 Ga0070661_100617861
239 Ga0070688_100163248
240 Ga0070709_10051828
241 Ga0070714_100480393
242 Ga0070708_100007410
243 Ga0070663_100315157
244 Ga0070662_100782623
245 Ga0070706_100100848
246 Ga0070707_100025014
247 Ga0070707_100424922
248 Ga0070707_100532710
249 Ga0070707_100732410
250 Ga0070698_100980182
251 Ga0070679_100161531
252 Ga0070686_100426808
253 Ga0068855_100000015
254 Ga0068855_100021327
255 Ga0068852_100474475
256 Ga0068859_100197834
257 Ga0081455_10362091
258 Ga0075363_100269008
259 Ga0075366_10077542
260 Ga0075370_10360821
261 Ga0075428_100034855
262 Ga0075431_100098482
263 Ga0075431_100608751
264 Ga0075431_100652759
265 Ga0097620_100197834
266 Ga0099794_10037288
267 Ga0105240_10007311
268 Ga0114129_10034333
269 Ga0114129_10129312
270 Ga0105237_10009788
271 Ga0105238_10475021
272 Ga0105238_10493577
273 Ga0099796_10004811
274 Ga0099796_10016590
275 Ga0099796_10539570
276 Ga0105239_10005183
277 Ga0154016_104683
278 Ga0157373_10002080
279 Ga0157371_10094045
280 Ga0157370_10004570
281 Ga0157370_10141005
282 Ga0157370_10243701
283 Ga0157369_10000268
284 Ga0157369_10000517
285 Ga0157369_10087353
286 Ga0157374_10000390
287 Ga0157372_10010494
288 Ga0157372_10554630
289 Ga0182006_1137316
290 Ga0182007_10021494
291 Ga0197907_10207134
292 Ga0206356_10065709
293 Ga0206356_10296657
294 Ga0206354_11278436
295 Ga0206354_11451404
296 Ga0206353_10819949
297 Ga0206353_11894579
298 Ga0224712_10000001
299 Ga0224712_10008612
300 Ga0228598_1061796
301 Ga0209672_100132
302 Ga0209759_1006841
303 Ga0207647_10000452
304 Ga0207705_10029880
305 Ga0207684_10094593
306 Ga0207707_10613497
307 Ga0207695_10151979
308 Ga0207662_10422660
309 Ga0207657_10060989
310 Ga0207649_10124987
311 Ga0207649_10667206
312 Ga0207646_10066461
313 Ga0207646_10160232
314 Ga0207646_10374949
315 Ga0207694_10249187
316 Ga0207694_11126941
317 Ga0207664_10546368
318 Ga0207690_10534717
319 Ga0207706_10699286
320 Ga0207670_10011169
321 Ga0207689_11671939
322 Ga0207679_10010960
323 Ga0207667_10000315
324 Ga0207667_10013049
325 Ga0207658_10184768
326 Ga0207677_11272296
327 Ga0207678_10266889
328 Ga0207678_10560700
329 Ga0207708_10193189
330 Ga0207702_10095724
331 Ga0207675_100015446
332 Ga0207698_10429617
333 Ga0209179_1035942
334 Ga0209588_1183980
335 Ga0307517_10023230
336 Ga0307515_10575945
337 Ga0265763_1004030
338 Ga0265760_10049014
339 Ga0265332_10031588
340 Ga0307509_10438989
341 Ga0307509_10789927
342 Ga0307509_10946033
343 Ga0307516_10117946
344 Ga0373960_0352393
345 Ga0395899_0000097
346 Ga0395899_0115187
347 Ga0395900_0000225
348 Ga0395900_0064615
349 Ga0395900_0165421
350 Ga0395900_1073141
351 Ga0395898_0000346
352 Ga0395898_0000708
353 Ga0395898_0014259
354 Ga0395898_0026073
355 Ga0395905_0021301
356 Ga0395901_0000034
357 Ga0395901_0000121
358 Ga0395901_0114123
359 Ga0395901_0608683
360 Ga0395901_0699060
361 Ga0436365_0312911
362 Ga0436362_0796790
363 Ga0451791_0268023
364 Ga0451793_0090275
365 Ga0451797_1580995
366 Ga0451802_0335210
367 Ga0451804_0117188
368 Ga0451837_1470877
369 Ga0451839_0035181
370 Ga0451841_0172323
371 Ga0451845_0762293
372 Ga0451849_1466735
373 Ga0451851_0247094
374 Ga0451843_1248438
375 Ga0451855_1274833
376 Ga0451853_0052533
377 Ga0451853_0140934
378 Ga0451853_2390330
379 Ga0439448_0017684
380 Ga0439455_0042185
381 Ga0439458_0060955
382 Ga0439440_0138210
383 Ga0466969_0001130
384 Ga0466972_0001043
385 Ga0466972_0033896
386 Ga0466966_0023273
387 Ga0466966_0128395
388 Ga0466961_0005580
389 Ga0466961_0110708
390 Ga0466963_0002461
391 Ga0466964_0101203
392 Ga0466964_0202779
393 Ga0466971_0268198
394 Ga0466968_0261405
395 Ga0466968_0610421
396 Ga0466970_0216857
397 Ga0466957_0050026
398 Ga0466957_0181863
399 Ga0466960_0128952
400 Ga0466959_0088958
401 Ga0451576_0528677
402 Ga0466958_0017790
403 Ga0466967_0123885
404 Ga0495652_0240389
405 Ga0495667_0667892
406 Ga0495646_0559844
407 Ga0495604_0513951
408 Ga0495687_212378
409 Ga0496112_1547722
410 Ga0496115_0090196
411 Ga0501031_0330447
412 Ga0501036_0914637
413 Ga0501041_0372321
414 Ga0501042_0322994
415 Ga0501042_1190440
416 Ga0501046_0046874
417 Ga0501046_0457005
418 Ga0501048_0089127
419 Ga0501067_0260639
420 Ga0501068_0234457
421 Ga0501069_0673440
422 Ga0501071_0019189
423 Ga0501071_1612736
424 Ga0501072_0047070
425 Ga0501073_0021303
426 Ga0501075_0984064
427 Ga0501076_0053597
428 Ga0501077_0100918
429 Ga0501079_0190395
430 Ga0501081_0052867
431 Ga0501083_0592589
432 Ga0501044_0743781
433 nmdc:mga07m45_219404_c1
434 nmdc:mga05p37_230817_c1
435 nmdc:mga06r32_200506_c1
436 nmdc:mga06r32_359445_c1
437 Ga0500635_0075875
438 Ga0500578_0174206
439 Ga0500583_0428264
440 Ga0500566_0000566
441 Ga0500650_0507192
442 Ga0500614_068664
443 Ga0500585_011097
444 Ga0500603_015086
445 Ga0500622_0070839
446 Ga0501084_0572393
447 Ga0501082_0460632
448 Ga0466962_0062466
449 Ga0530510_0034007
450 2515687503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

15

121

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.9004 2 115
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.8788 1 114
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.8787 2 115
3wfz-assembly2.cif.gz_C crystal structure of galacto-n-biose/lacto-n-biose i phosphorylase c236y mutant 0.8736 54 79
7b0u-assembly1.cif.gz_A stressosome complex from listeria innocua 0.8668 2 118
ID Description Score Start End Superfamily
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8344 2 113 3.30.750.24
af_Q10QI4_508_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8205 6 115 3.30.750.24
af_Q80ZD3_447_566_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8157 2 112 3.30.750.24
af_B0V3V8_450_565_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.813 2 114 3.30.750.24
4hylA00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8098 2 112 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A2V9KEL9-F1-model_v4 Anti-anti-sigma factor 0.9595 1 122
AF-A0A2V7FHM0-F1-model_v4 STAS domain-containing protein 0.9582 1 112
AF-A0A1X7D3N5-F1-model_v4 RsbT antagonist protein RsbS 0.953 1 116
AF-A0A2V7N4W5-F1-model_v4 Anti-anti-sigma factor 0.952 1 123
AF-A0A1X0YD46-F1-model_v4 Anti-anti-sigma factor 0.9517 2 118

Map