F337207

General Info

Members Datasets Scaffolds Average Seq Length
224 153 224 126

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_18299_c2|nmdc:mga0k408_18299_c2_184_624
Length 146
Sequence VLLRVGVDHHAHRWQVTEPMERFFWICLAGALGTGTRYLVGLWALSRFGPEFPYGTLFVNVAGCFLMAVVMQLSISLVAFPPNLRFALTTGFMGGLTTYSSFNYETTRLVAQGARNAALANLALTLLLCAGAGLLGFWLTHRLLGS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
88 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
89 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
90 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
91 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
92 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
93 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
94 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
95 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
96 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
97 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
98 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
99 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
102 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
103 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
104 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
105 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
138 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
139 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
140 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
141 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
142 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
143 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
144 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
145 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
146 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.04
Nodule 0
Rhizoplane 0.89
Rhizosphere 86.61
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13292834 2162886012 Bacteria 851
2 JGI24751J29686_10045888 3300002459 Bacteria 903
3 Ga0065712_10025988 3300005290 Unclassified 1340
4 Ga0065712_10081469 3300005290 Bacteria 3004
5 Ga0065712_10290378 3300005290 Unclassified 878
6 Ga0065715_10133798 3300005293 Bacteria 1966
7 Ga0065707_10124341 3300005295 Bacteria 2046
8 Ga0065707_10238231 3300005295 Unclassified 1165
9 Ga0065707_10342974 3300005295 Bacteria 930
10 Ga0070690_100015750 3300005330 Bacteria 4517
11 Ga0070690_100320697 3300005330 Bacteria 1116
12 Ga0070670_100103129 3300005331 Bacteria 2457
13 Ga0070670_100181391 3300005331 Bacteria 1828
14 Ga0068869_102069473 3300005334 Unclassified 511
15 Ga0070682_100133288 3300005337 Bacteria 1684
16 Ga0070682_100601471 3300005337 Bacteria 868
17 Ga0068868_100680367 3300005338 Bacteria 919
18 Ga0070689_100015898 3300005340 Bacteria 5499
19 Ga0070687_100076413 3300005343 Bacteria 1814
20 Ga0070692_10397863 3300005345 Bacteria 869
21 Ga0070668_101415522 3300005347 Unclassified 634
22 Ga0070669_101110685 3300005353 Unclassified 681
23 Ga0070675_100105553 3300005354 Unclassified 2377
24 Ga0070674_100003654 3300005356 Bacteria 8666
25 Ga0070674_100182715 3300005356 Bacteria 1608
26 Ga0070688_100058884 3300005365 Bacteria 2420
27 Ga0070688_100673941 3300005365 Unclassified 798
28 Ga0070659_100014064 3300005366 Bacteria 5972
29 Ga0070701_11019880 3300005438 Bacteria 578
30 Ga0070700_100205920 3300005441 Bacteria 1385
31 Ga0070700_100277052 3300005441 Bacteria 1215
32 Ga0070694_100097978 3300005444 Unclassified 2069
33 Ga0070663_100217900 3300005455 Unclassified 1497
34 Ga0070663_102075926 3300005455 Unclassified 512
35 Ga0070678_100110578 3300005456 Bacteria 2149
36 Ga0070678_101384123 3300005456 Unclassified 656
37 Ga0070662_100084472 3300005457 Bacteria 2371
38 Ga0070685_11297027 3300005466 Unclassified 556
39 Ga0070685_11628880 3300005466 Unclassified 500
40 Ga0070706_101513467 3300005467 Unclassified 613
41 Ga0070698_100004706 3300005471 Bacteria 14993
42 Ga0070679_100499685 3300005530 Bacteria 1160
43 Ga0070697_101606247 3300005536 Unclassified 581
44 Ga0070693_100091671 3300005547 Bacteria 1833
45 Ga0070665_100034245 3300005548 Bacteria 5107
46 Ga0068857_102352715 3300005577 Unclassified 523
47 Ga0070702_100438727 3300005615 Bacteria 944
48 Ga0070702_100862053 3300005615 Bacteria 706
49 Ga0068863_100060089 3300005841 Bacteria 3595
50 Ga0068858_101239718 3300005842 Bacteria 733
51 Ga0068858_101809897 3300005842 Bacteria 603
52 Ga0068860_100252693 3300005843 Unclassified 1717
53 Ga0068862_100132226 3300005844 Bacteria 2208
54 Ga0068862_101830586 3300005844 Unclassified 616
55 Ga0081455_10029879 3300005937 Bacteria 4962
56 Ga0081455_10302116 3300005937 Bacteria 1148
57 Ga0070717_10093699 3300006028 Bacteria 2540
58 Ga0075366_10087468 3300006195 Bacteria 1865
59 Ga0075366_10592630 3300006195 Unclassified 687
60 Ga0075428_100091823 3300006844 Bacteria 3310
61 Ga0075428_100271072 3300006844 Bacteria 1826
62 Ga0075434_100100077 3300006871 Bacteria 2905
63 Ga0075434_102568716 3300006871 Bacteria 510
64 Ga0075429_100295718 3300006880 Bacteria 1418
65 Ga0075435_100104006 3300007076 Bacteria 2355
66 Ga0111539_10145781 3300009094 Bacteria 2772
67 Ga0111539_10351985 3300009094 Bacteria 1714
68 Ga0111539_10459391 3300009094 Bacteria 1483
69 Ga0111539_10657959 3300009094 Bacteria 1220
70 Ga0111539_10718598 3300009094 Bacteria 1163
71 Ga0111539_10889189 3300009094 Bacteria 1036
72 Ga0105245_11995155 3300009098 Bacteria 634
73 Ga0114129_10000720 3300009147 Bacteria 41928
74 Ga0114129_10020580 3300009147 Bacteria 9382
75 Ga0114129_10074356 3300009147 Bacteria 4733
76 Ga0114129_12797000 3300009147 Unclassified 580
77 Ga0105249_10122921 3300009553 Bacteria 2469
78 Ga0105249_10750660 3300009553 Bacteria 1038
79 Ga0157372_13069522 3300013307 Unclassified 533
80 Ga0157380_10870966 3300014326 Unclassified 924
81 Ga0157380_13244058 3300014326 Unclassified 520
82 Ga0157376_10045514 3300014969 Bacteria 3613
83 Ga0207707_10647459 3300025912 Unclassified 891
84 Ga0207681_11248043 3300025923 Unclassified 624
85 Ga0207650_10024358 3300025925 Unclassified 4301
86 Ga0207650_10469731 3300025925 Unclassified 1049
87 Ga0207659_10973676 3300025926 Bacteria 730
88 Ga0207659_11190949 3300025926 Bacteria 655
89 Ga0207687_11468170 3300025927 Bacteria 586
90 Ga0207690_10147715 3300025932 Bacteria 1740
91 Ga0207706_10291738 3300025933 Unclassified 1422
92 Ga0207670_10022631 3300025936 Bacteria 3898
93 Ga0207669_10019533 3300025937 Bacteria 3531
94 Ga0207669_10149225 3300025937 Bacteria 1635
95 Ga0207689_11471769 3300025942 Unclassified 569
96 Ga0207661_10201543 3300025944 Bacteria 1750
97 Ga0207712_10039396 3300025961 Bacteria 3237
98 Ga0207712_10078557 3300025961 Bacteria 2395
99 Ga0207677_10490813 3300026023 Bacteria 1060
100 Ga0207678_10254974 3300026067 Unclassified 1503
101 Ga0207708_10258771 3300026075 Bacteria 1404
102 Ga0207708_10454511 3300026075 Bacteria 1067
103 Ga0207674_11905599 3300026116 Unclassified 560
104 Ga0268266_10015006 3300028379 Bacteria 6650
105 Ga0268266_10025503 3300028379 Bacteria 5029
106 Ga0268265_10281521 3300028380 Unclassified 1488
107 Ga0268265_10350630 3300028380 Bacteria 1348
108 Ga0265334_10001584 3300028573 Bacteria 10937
109 Ga0307515_10007372 3300028794 Bacteria 21759
110 Ga0307515_10446020 3300028794 Bacteria 910
111 Ga0307511_10027664 3300030521 Bacteria 5174
112 Ga0307511_10098631 3300030521 Bacteria 1933
113 Ga0307509_10008600 3300031507 Bacteria 12966
114 Ga0307509_10104894 3300031507 Bacteria 2850
115 Ga0307509_10888625 3300031507 Unclassified 556
116 Ga0307508_10045617 3300031616 Bacteria 3916
117 Ga0307508_10810989 3300031616 Bacteria 554
118 Ga0316576_10127931 3300031727 Unclassified 1910
119 Ga0307409_102019835 3300031995 Bacteria 606
120 Ga0307416_102547159 3300032002 Unclassified 610
121 Ga0307411_10570689 3300032005 Bacteria 968
122 Ga0373949_0000056 3300035090 Bacteria 42956
123 Ga0373936_0000004 3300035113 Bacteria 351159
124 Ga0373954_0232711 3300035118 Unclassified 907
125 Ga0373961_0000090 3300035241 Bacteria 49242
126 Ga0436365_0949838 3300039437 Bacteria 1041
127 Ga0439453_0009633 3300041408 Bacteria 1577
128 Ga0439453_0153795 3300041408 Unclassified 547
129 Ga0451807_2615332 3300041486 Bacteria 1683
130 Ga0439431_0053137 3300041997 Bacteria 1054
131 Ga0439443_000135 3300042003 Bacteria 4983
132 Ga0439443_125151 3300042003 Bacteria 507
133 Ga0439445_0067932 3300042004 Unclassified 983
134 Ga0439451_021408 3300042009 Bacteria 1304
135 Ga0439454_007680 3300042011 Bacteria 1357
136 Ga0439454_022112 3300042011 Unclassified 945
137 Ga0439455_0137247 3300042012 Unclassified 692
138 Ga0439456_006302 3300042013 Unclassified 2421
139 Ga0450920_117491 3300042122 Unclassified 557
140 Ga0450888_008099 3300042126 Bacteria 1177
141 Ga0450896_013603 3300042133 Bacteria 1158
142 Ga0450898_005645 3300042134 Bacteria 1898
143 Ga0450905_024961 3300042142 Bacteria 898
144 Ga0450908_053160 3300042184 Unclassified 706
145 Ga0439434_0056055 3300042435 Bacteria 1227
146 Ga0439434_0202158 3300042435 Unclassified 670
147 Ga0439435_0027099 3300042436 Bacteria 1530
148 Ga0439435_0042153 3300042436 Unclassified 1280
149 Ga0439435_0088365 3300042436 Unclassified 938
150 Ga0439444_0007150 3300042437 Bacteria 1706
151 Ga0439464_0013915 3300042439 Unclassified 2159
152 Ga0439464_0028469 3300042439 Unclassified 1557
153 Ga0439460_0002923 3300042461 Unclassified 4116
154 Ga0439460_0031172 3300042461 Unclassified 1520
155 Ga0450893_0076422 3300042532 Unclassified 656
156 Ga0451577_0041603 3300042876 Bacteria 4124
157 Ga0451577_0054624 3300042876 Bacteria 3565
158 Ga0451577_1520554 3300042876 Bacteria 592
159 Ga0439440_0043530 3300042993 Unclassified 1101
160 Ga0453684_0000968 3300044712 Bacteria 94634
161 Ga0453684_0003597 3300044712 Bacteria 34571
162 Ga0453684_0140936 3300044712 Bacteria 2879
163 Ga0453684_2103911 3300044712 Unclassified 566
164 Ga0451576_0022590 3300045051 Bacteria 6819
165 Ga0466967_0167099 3300045976 Bacteria 2068
166 Ga0495592_0764723 3300046454 Unclassified 576
167 Ga0495590_0057282 3300046457 Bacteria 1362
168 Ga0495641_0308208 3300046461 Bacteria 714
169 Ga0495630_0777537 3300046517 Bacteria 731
170 Ga0495622_0241365 3300046557 Bacteria 796
171 Ga0495649_0637440 3300046694 Bacteria 524
172 Ga0496112_0320504 3300048915 Bacteria 1494
173 Ga0501036_0664749 3300049572 Unclassified 862
174 Ga0501039_0879427 3300049575 Unclassified 698
175 Ga0501040_0060742 3300049576 Unclassified 2598
176 Ga0501040_0496163 3300049576 Bacteria 880
177 Ga0501040_0525808 3300049576 Unclassified 853
178 Ga0501040_0660926 3300049576 Bacteria 755
179 Ga0501046_0171553 3300049580 Unclassified 1627
180 Ga0501068_0027918 3300049584 Bacteria 3335
181 Ga0501071_0199210 3300049587 Unclassified 1504
182 Ga0501071_0390366 3300049587 Unclassified 1062
183 Ga0501072_0083011 3300049588 Unclassified 2540
184 Ga0501073_0079128 3300049589 Bacteria 2288
185 Ga0501074_0120430 3300049590 Bacteria 1877
186 Ga0501074_0444761 3300049590 Unclassified 919
187 Ga0501076_0494549 3300049592 Bacteria 1008
188 Ga0501077_0526956 3300049593 Unclassified 758
189 Ga0501079_1212978 3300049741 Unclassified 594
190 Ga0501081_0992146 3300049743 Bacteria 634
191 Ga0501045_0362799 3300049824 Unclassified 1078
192 nmdc:mga0k408_18299_c2 3300050493 Bacteria 3234
193 nmdc:mga0k408_778771_c1 3300050493 Unclassified 558
194 nmdc:mga05p37_1555492_c1 3300050507 Bacteria 655
195 nmdc:mga05p37_1847769_c1 3300050507 Unclassified 580
196 nmdc:mga05p37_246_c1 3300050507 Bacteria 55408
197 nmdc:mga05p37_3671_c1 3300050507 Bacteria 17940
198 nmdc:mga09592_933505_c1 3300050508 Bacteria 728
199 nmdc:mga08y16_115432_c1 3300050511 Bacteria 2795
200 nmdc:mga08y16_192019_c1 3300050511 Bacteria 2118
201 nmdc:mga08y16_2175591_c1 3300050511 Unclassified 501
202 nmdc:mga08y16_242400_c1 3300050511 Bacteria 1863
203 nmdc:mga0rr50_1822516_c1 3300050513 Bacteria 512
204 nmdc:mga0rr50_512594_c1 3300050513 Bacteria 1020
205 Ga0500646_0005837 3300053090 Bacteria 3121
206 Ga0500646_0171490 3300053090 Bacteria 730
207 Ga0500566_0088155 3300053094 Bacteria 1718
208 Ga0500654_106057 3300053099 Bacteria 1174
209 Ga0500554_238027 3300053102 Bacteria 602
210 Ga0500556_0320984 3300053104 Bacteria 603
211 Ga0500562_047736 3300053108 Bacteria 1143
212 Ga0500614_166980 3300053123 Bacteria 669
213 Ga0500614_224163 3300053123 Bacteria 583
214 Ga0500642_0044346 3300053130 Bacteria 1936
215 Ga0500564_313556 3300053138 Bacteria 597
216 Ga0500577_0431453 3300053142 Bacteria 576
217 Ga0500622_0290793 3300053156 Bacteria 700
218 Ga0500636_0201385 3300053177 Bacteria 1053
219 Ga0501084_0247203 3300054114 Unclassified 1506
220 Ga0501084_1314697 3300054114 Unclassified 606
221 Ga0590071_065751 3300059421 Unclassified 890
222 Ga0590077_017051 3300059426 Bacteria 1526
223 Ga0501082_1750449 3300060353 Unclassified 542
224 Ga0530510_0460621 3300061734 Unclassified 962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025926 Ga0207659_11190949 Ga0207659_111909492 85
2 3300049741 Ga0501079_1212978 Ga0501079_1212978_269_583 102
3 3300042011 Ga0439454_022112 Ga0439454_022112_37_357 104
4 3300041486 Ga0451807_2615332 Ga0451807_2615332_14_373 116
5 3300005548 Ga0070665_100034245 Ga0070665_1000342454 119
6 3300014969 Ga0157376_10045514 Ga0157376_100455143 119
7 3300028379 Ga0268266_10015006 Ga0268266_100150065 119
8 3300005471 Ga0070698_100004706 Ga0070698_1000047068 120
9 3300006871 Ga0075434_102568716 Ga0075434_1025687161 120
10 3300007076 Ga0075435_100104006 Ga0075435_1001040062 120
11 3300049587 Ga0501071_0199210 Ga0501071_0199210_1009_1380 120
12 3300050513 nmdc:mga0rr50_512594_c1 nmdc:mga0rr50_512594_c1_194_568 120
13 3300005330 Ga0070690_100015750 Ga0070690_1000157503 121
14 3300005340 Ga0070689_100015898 Ga0070689_1000158986 121
15 3300005365 Ga0070688_100058884 Ga0070688_1000588842 121
16 3300005441 Ga0070700_100205920 Ga0070700_1002059201 121
17 3300005441 Ga0070700_100277052 Ga0070700_1002770521 121
18 3300005466 Ga0070685_11297027 Ga0070685_112970271 121
19 3300005536 Ga0070697_101606247 Ga0070697_1016062471 121
20 3300005841 Ga0068863_100060089 Ga0068863_1000600893 121
21 3300005937 Ga0081455_10302116 Ga0081455_103021162 121
22 3300006028 Ga0070717_10093699 Ga0070717_100936992 121
23 3300009553 Ga0105249_10750660 Ga0105249_107506602 121
24 3300025936 Ga0207670_10022631 Ga0207670_100226313 121
25 3300025961 Ga0207712_10039396 Ga0207712_100393962 121
26 3300026075 Ga0207708_10454511 Ga0207708_104545111 121
27 3300028380 Ga0268265_10350630 Ga0268265_103506302 121
28 3300028794 Ga0307515_10007372 Ga0307515_1000737212 121
29 3300028794 Ga0307515_10446020 Ga0307515_104460202 121
30 3300031507 Ga0307509_10888625 Ga0307509_108886252 121
31 3300031616 Ga0307508_10045617 Ga0307508_100456173 121
32 3300031616 Ga0307508_10810989 Ga0307508_108109892 121
33 3300035113 Ga0373936_0000004 Ga0373936_0000004_197328_197699 121
34 3300035118 Ga0373954_0232711 Ga0373954_0232711_500_871 121
35 3300035241 Ga0373961_0000090 Ga0373961_0000090_6738_7109 121
36 3300046457 Ga0495590_0057282 Ga0495590_0057282_78_449 121
37 3300046694 Ga0495649_0637440 Ga0495649_0637440_70_441 121
38 3300053090 Ga0500646_0005837 Ga0500646_0005837_2505_2876 121
39 3300053090 Ga0500646_0171490 Ga0500646_0171490_241_612 121
40 3300053094 Ga0500566_0088155 Ga0500566_0088155_436_807 121
41 3300053099 Ga0500654_106057 Ga0500654_106057_389_760 121
42 3300053102 Ga0500554_238027 Ga0500554_238027_73_444 121
43 3300053104 Ga0500556_0320984 Ga0500556_0320984_15_386 121
44 3300053108 Ga0500562_047736 Ga0500562_047736_355_726 121
45 3300053123 Ga0500614_166980 Ga0500614_166980_51_422 121
46 3300053123 Ga0500614_224163 Ga0500614_224163_36_407 121
47 3300053130 Ga0500642_0044346 Ga0500642_0044346_417_788 121
48 3300053138 Ga0500564_313556 Ga0500564_313556_193_564 121
49 3300053142 Ga0500577_0431453 Ga0500577_0431453_137_508 121
50 3300053156 Ga0500622_0290793 Ga0500622_0290793_261_632 121
51 3300053177 Ga0500636_0201385 Ga0500636_0201385_512_883 121
52 3300005330 Ga0070690_100320697 Ga0070690_1003206972 123
53 3300005343 Ga0070687_100076413 Ga0070687_1000764132 123
54 3300005345 Ga0070692_10397863 Ga0070692_103978632 123
55 3300005438 Ga0070701_11019880 Ga0070701_110198802 123
56 3300005615 Ga0070702_100862053 Ga0070702_1008620531 123
57 3300009098 Ga0105245_11995155 Ga0105245_119951552 123
58 3300025912 Ga0207707_10647459 Ga0207707_106474591 123
59 3300025927 Ga0207687_11468170 Ga0207687_114681701 123
60 3300025944 Ga0207661_10201543 Ga0207661_102015432 123
61 3300026023 Ga0207677_10490813 Ga0207677_104908132 123
62 3300028379 Ga0268266_10025503 Ga0268266_100255034 123
63 3300030521 Ga0307511_10098631 Ga0307511_100986312 123
64 3300031507 Ga0307509_10008600 Ga0307509_100086009 123
65 3300031507 Ga0307509_10104894 Ga0307509_101048943 123
66 3300032002 Ga0307416_102547159 Ga0307416_1025471591 123
67 3300035090 Ga0373949_0000056 Ga0373949_0000056_27031_27438 123
68 3300042876 Ga0451577_0041603 Ga0451577_0041603_955_1332 123
69 3300044712 Ga0453684_0000968 Ga0453684_0000968_2765_3142 123
70 3300046517 Ga0495630_0777537 Ga0495630_0777537_283_672 123
71 3300046557 Ga0495622_0241365 Ga0495622_0241365_211_600 123
72 2162886012 MBSR1b_contig_13292834 MBSR1b_0576.00003150 124
73 3300002459 JGI24751J29686_10045888 JGI24751J29686_100458882 124
74 3300005290 Ga0065712_10025988 Ga0065712_100259882 124
75 3300005290 Ga0065712_10081469 Ga0065712_100814693 124
76 3300005290 Ga0065712_10290378 Ga0065712_102903781 124
77 3300005293 Ga0065715_10133798 Ga0065715_101337982 124
78 3300005295 Ga0065707_10124341 Ga0065707_101243414 124
79 3300005295 Ga0065707_10238231 Ga0065707_102382312 124
80 3300005295 Ga0065707_10342974 Ga0065707_103429741 124
81 3300005331 Ga0070670_100103129 Ga0070670_1001031294 124
82 3300005331 Ga0070670_100181391 Ga0070670_1001813914 124
83 3300005334 Ga0068869_102069473 Ga0068869_1020694731 124
84 3300005337 Ga0070682_100133288 Ga0070682_1001332883 124
85 3300005337 Ga0070682_100601471 Ga0070682_1006014712 124
86 3300005338 Ga0068868_100680367 Ga0068868_1006803671 124
87 3300005347 Ga0070668_101415522 Ga0070668_1014155222 124
88 3300005353 Ga0070669_101110685 Ga0070669_1011106851 124
89 3300005354 Ga0070675_100105553 Ga0070675_1001055532 124
90 3300005356 Ga0070674_100003654 Ga0070674_1000036545 124
91 3300005356 Ga0070674_100182715 Ga0070674_1001827152 124
92 3300005365 Ga0070688_100673941 Ga0070688_1006739411 124
93 3300005366 Ga0070659_100014064 Ga0070659_1000140648 124
94 3300005444 Ga0070694_100097978 Ga0070694_1000979782 124
95 3300005455 Ga0070663_100217900 Ga0070663_1002179002 124
96 3300005455 Ga0070663_102075926 Ga0070663_1020759261 124
97 3300005456 Ga0070678_100110578 Ga0070678_1001105781 124
98 3300005456 Ga0070678_101384123 Ga0070678_1013841232 124
99 3300005457 Ga0070662_100084472 Ga0070662_1000844723 124
100 3300005466 Ga0070685_11628880 Ga0070685_116288801 124
101 3300005467 Ga0070706_101513467 Ga0070706_1015134671 124
102 3300005530 Ga0070679_100499685 Ga0070679_1004996851 124
103 3300005547 Ga0070693_100091671 Ga0070693_1000916713 124
104 3300005577 Ga0068857_102352715 Ga0068857_1023527151 124
105 3300005615 Ga0070702_100438727 Ga0070702_1004387271 124
106 3300005842 Ga0068858_101239718 Ga0068858_1012397181 124
107 3300005842 Ga0068858_101809897 Ga0068858_1018098971 124
108 3300005843 Ga0068860_100252693 Ga0068860_1002526932 124
109 3300005844 Ga0068862_100132226 Ga0068862_1001322262 124
110 3300005844 Ga0068862_101830586 Ga0068862_1018305862 124
111 3300005937 Ga0081455_10029879 Ga0081455_100298792 124
112 3300006195 Ga0075366_10087468 Ga0075366_100874682 124
113 3300006195 Ga0075366_10592630 Ga0075366_105926302 124
114 3300006844 Ga0075428_100091823 Ga0075428_1000918234 124
115 3300006844 Ga0075428_100271072 Ga0075428_1002710723 124
116 3300006871 Ga0075434_100100077 Ga0075434_1001000772 124
117 3300006880 Ga0075429_100295718 Ga0075429_1002957182 124
118 3300009094 Ga0111539_10145781 Ga0111539_101457813 124
119 3300009094 Ga0111539_10351985 Ga0111539_103519852 124
120 3300009094 Ga0111539_10459391 Ga0111539_104593912 124
121 3300009094 Ga0111539_10657959 Ga0111539_106579592 124
122 3300009094 Ga0111539_10718598 Ga0111539_107185982 124
123 3300009094 Ga0111539_10889189 Ga0111539_108891893 124
124 3300009147 Ga0114129_10000720 Ga0114129_1000072032 124
125 3300009147 Ga0114129_10020580 Ga0114129_100205805 124
126 3300009147 Ga0114129_10074356 Ga0114129_100743565 124
127 3300009147 Ga0114129_12797000 Ga0114129_127970002 124
128 3300009553 Ga0105249_10122921 Ga0105249_101229212 124
129 3300013307 Ga0157372_13069522 Ga0157372_130695221 124
130 3300014326 Ga0157380_10870966 Ga0157380_108709662 124
131 3300014326 Ga0157380_13244058 Ga0157380_132440581 124
132 3300025923 Ga0207681_11248043 Ga0207681_112480431 124
133 3300025925 Ga0207650_10024358 Ga0207650_100243582 124
134 3300025925 Ga0207650_10469731 Ga0207650_104697312 124
135 3300025926 Ga0207659_10973676 Ga0207659_109736762 124
136 3300025932 Ga0207690_10147715 Ga0207690_101477152 124
137 3300025933 Ga0207706_10291738 Ga0207706_102917383 124
138 3300025937 Ga0207669_10019533 Ga0207669_100195332 124
139 3300025937 Ga0207669_10149225 Ga0207669_101492253 124
140 3300025942 Ga0207689_11471769 Ga0207689_114717691 124
141 3300025961 Ga0207712_10078557 Ga0207712_100785572 124
142 3300026067 Ga0207678_10254974 Ga0207678_102549743 124
143 3300026075 Ga0207708_10258771 Ga0207708_102587713 124
144 3300026116 Ga0207674_11905599 Ga0207674_119055992 124
145 3300028380 Ga0268265_10281521 Ga0268265_102815212 124
146 3300028573 Ga0265334_10001584 Ga0265334_100015843 124
147 3300030521 Ga0307511_10027664 Ga0307511_100276643 124
148 3300031727 Ga0316576_10127931 Ga0316576_101279312 124
149 3300031995 Ga0307409_102019835 Ga0307409_1020198351 124
150 3300032005 Ga0307411_10570689 Ga0307411_105706891 124
151 3300039437 Ga0436365_0949838 Ga0436365_0949838_611_991 124
152 3300041408 Ga0439453_0009633 Ga0439453_0009633_658_1038 124
153 3300041408 Ga0439453_0153795 Ga0439453_0153795_13_393 124
154 3300041997 Ga0439431_0053137 Ga0439431_0053137_421_801 124
155 3300042003 Ga0439443_000135 Ga0439443_000135_2189_2569 124
156 3300042003 Ga0439443_125151 Ga0439443_125151_82_462 124
157 3300042004 Ga0439445_0067932 Ga0439445_0067932_197_577 124
158 3300042009 Ga0439451_021408 Ga0439451_021408_248_628 124
159 3300042011 Ga0439454_007680 Ga0439454_007680_558_938 124
160 3300042012 Ga0439455_0137247 Ga0439455_0137247_172_552 124
161 3300042013 Ga0439456_006302 Ga0439456_006302_1058_1438 124
162 3300042122 Ga0450920_117491 Ga0450920_117491_161_541 124
163 3300042126 Ga0450888_008099 Ga0450888_008099_227_607 124
164 3300042133 Ga0450896_013603 Ga0450896_013603_481_861 124
165 3300042134 Ga0450898_005645 Ga0450898_005645_1102_1482 124
166 3300042142 Ga0450905_024961 Ga0450905_024961_400_780 124
167 3300042184 Ga0450908_053160 Ga0450908_053160_17_397 124
168 3300042435 Ga0439434_0056055 Ga0439434_0056055_258_638 124
169 3300042435 Ga0439434_0202158 Ga0439434_0202158_184_564 124
170 3300042436 Ga0439435_0027099 Ga0439435_0027099_715_1095 124
171 3300042436 Ga0439435_0042153 Ga0439435_0042153_602_982 124
172 3300042436 Ga0439435_0088365 Ga0439435_0088365_448_828 124
173 3300042437 Ga0439444_0007150 Ga0439444_0007150_936_1316 124
174 3300042439 Ga0439464_0013915 Ga0439464_0013915_1251_1631 124
175 3300042439 Ga0439464_0028469 Ga0439464_0028469_393_773 124
176 3300042461 Ga0439460_0002923 Ga0439460_0002923_2283_2663 124
177 3300042461 Ga0439460_0031172 Ga0439460_0031172_78_458 124
178 3300042532 Ga0450893_0076422 Ga0450893_0076422_210_590 124
179 3300042876 Ga0451577_0054624 Ga0451577_0054624_441_821 124
180 3300042876 Ga0451577_1520554 Ga0451577_1520554_111_494 124
181 3300042993 Ga0439440_0043530 Ga0439440_0043530_671_1051 124
182 3300044712 Ga0453684_0003597 Ga0453684_0003597_9262_9642 124
183 3300044712 Ga0453684_0140936 Ga0453684_0140936_423_803 124
184 3300044712 Ga0453684_2103911 Ga0453684_2103911_159_539 124
185 3300045051 Ga0451576_0022590 Ga0451576_0022590_866_1246 124
186 3300045976 Ga0466967_0167099 Ga0466967_0167099_128_517 124
187 3300046454 Ga0495592_0764723 Ga0495592_0764723_56_433 124
188 3300046461 Ga0495641_0308208 Ga0495641_0308208_290_673 124
189 3300048915 Ga0496112_0320504 Ga0496112_0320504_621_1001 124
190 3300049572 Ga0501036_0664749 Ga0501036_0664749_186_566 124
191 3300049575 Ga0501039_0879427 Ga0501039_0879427_114_494 124
192 3300049576 Ga0501040_0060742 Ga0501040_0060742_1607_1993 124
193 3300049576 Ga0501040_0496163 Ga0501040_0496163_386_766 124
194 3300049576 Ga0501040_0525808 Ga0501040_0525808_452_832 124
195 3300049576 Ga0501040_0660926 Ga0501040_0660926_97_477 124
196 3300049580 Ga0501046_0171553 Ga0501046_0171553_218_604 124
197 3300049584 Ga0501068_0027918 Ga0501068_0027918_40_423 124
198 3300049587 Ga0501071_0390366 Ga0501071_0390366_551_931 124
199 3300049588 Ga0501072_0083011 Ga0501072_0083011_996_1376 124
200 3300049589 Ga0501073_0079128 Ga0501073_0079128_1370_1753 124
201 3300049590 Ga0501074_0120430 Ga0501074_0120430_1114_1494 124
202 3300049590 Ga0501074_0444761 Ga0501074_0444761_476_859 124
203 3300049592 Ga0501076_0494549 Ga0501076_0494549_254_634 124
204 3300049593 Ga0501077_0526956 Ga0501077_0526956_295_678 124
205 3300049743 Ga0501081_0992146 Ga0501081_0992146_179_559 124
206 3300049824 Ga0501045_0362799 Ga0501045_0362799_236_616 124
207 3300050493 nmdc:mga0k408_18299_c2 nmdc:mga0k408_18299_c2_184_624 124
208 3300050493 nmdc:mga0k408_778771_c1 nmdc:mga0k408_778771_c1_143_523 124
209 3300050507 nmdc:mga05p37_1555492_c1 nmdc:mga05p37_1555492_c1_62_442 124
210 3300050507 nmdc:mga05p37_1847769_c1 nmdc:mga05p37_1847769_c1_56_436 124
211 3300050507 nmdc:mga05p37_246_c1 nmdc:mga05p37_246_c1_49741_50121 124
212 3300050507 nmdc:mga05p37_3671_c1 nmdc:mga05p37_3671_c1_2158_2538 124
213 3300050508 nmdc:mga09592_933505_c1 nmdc:mga09592_933505_c1_217_597 124
214 3300050511 nmdc:mga08y16_115432_c1 nmdc:mga08y16_115432_c1_1707_2084 124
215 3300050511 nmdc:mga08y16_192019_c1 nmdc:mga08y16_192019_c1_1581_1961 124
216 3300050511 nmdc:mga08y16_2175591_c1 nmdc:mga08y16_2175591_c1_45_425 124
217 3300050511 nmdc:mga08y16_242400_c1 nmdc:mga08y16_242400_c1_164_547 124
218 3300050513 nmdc:mga0rr50_1822516_c1 nmdc:mga0rr50_1822516_c1_98_487 124
219 3300054114 Ga0501084_0247203 Ga0501084_0247203_113_493 124
220 3300054114 Ga0501084_1314697 Ga0501084_1314697_80_460 124
221 3300059421 Ga0590071_065751 Ga0590071_065751_120_500 124
222 3300059426 Ga0590077_017051 Ga0590077_017051_753_1133 124
223 3300060353 Ga0501082_1750449 Ga0501082_1750449_104_484 124
224 3300061734 Ga0530510_0460621 Ga0530510_0460621_82_462 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

24

137

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.9416 3 123
6bqo-assembly2.cif.gz_B-2 structure of a dual topology fluoride channel with monobody s8 0.9341 3 124
5a40-assembly2.cif.gz_C crystal structure of a dual topology fluoride ion channel. 0.9339 3 123
7kk9-assembly1.cif.gz_A fluoride channel fluc-ec2 mutant s81a/t82a with bromide 0.9195 1 123
7kka-assembly1.cif.gz_A fluoride channel fluc-ec2 mutant s81a with bromide 0.9185 1 123
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9438 6 116 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9346 7 116 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9227 6 117 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9189 6 116 1.10.287.70
af_Q2FXE6_4_114_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9149 6 116 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A496VKW7-F1-model_v4 Fluoride efflux transporter CrcB 0.9929 1 110 GO:0005886
GO:1903425
AF-A0A659UKJ0-F1-model_v4 Fluoride efflux transporter CrcB 0.9924 1 111 GO:0005886
GO:1903425
AF-A0A7C5UM20-F1-model_v4 Fluoride-specific ion channel FluC 0.9873 2 123 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A0B7HK37-F1-model_v4 Fluoride-specific ion channel FluC 0.9861 6 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A1Z4Q2N6-F1-model_v4 deleted 0.9858 3 121

Feature Viewer

pLDDT pTM Quality
96.16 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map