F337128

General Info

Members Datasets Scaffolds Average Seq Length
224 155 448 141

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0566762|Ga0496108_0566762_150_632
Length 160
Sequence MAIVSKPYVISQRLVRGTVWAVAECLFCNAVAGRLPVVMVWESPEVVAFLDHRPVFKGHVLVVPRAHVEVLGDLAGPAVGPYFADVQRLAVAVERGLDAGGTFVALNNRVSQSVAHLHTHVVPRTKGDGLRGFFWPRTKYASADEATDFAARIAAAVSTP

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 2501939600 Micromonospora sp. L5 Isolate Unclassified
149 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
150 2855683550 Micromonospora sp. RP3T Isolate Unclassified
151 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
152 2858868258 Micromonospora sp. MH33 Isolate Unclassified
153 2902582711 Micromonospora sp. AP08 Isolate Unclassified
154 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
155 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 0
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 13.39
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0566762 3300048911 Bacteria 990
2 Ga0070683_100227964 3300005329 Bacteria 1771
3 Ga0070683_101361228 3300005329 Bacteria 682
4 Ga0070670_100005581 3300005331 Bacteria 10611
5 Ga0070680_100148186 3300005336 Bacteria 1970
6 Ga0070680_100681695 3300005336 Bacteria 884
7 Ga0070687_100121652 3300005343 Bacteria 1494
8 Ga0070675_100865146 3300005354 Bacteria 828
9 Ga0070673_100083729 3300005364 Bacteria 2592
10 Ga0070709_10080995 3300005434 Bacteria 2118
11 Ga0070714_100001559 3300005435 Bacteria 16686
12 Ga0070710_10016952 3300005437 Bacteria 3719
13 Ga0070711_100044291 3300005439 Bacteria 3020
14 Ga0070711_100497288 3300005439 Bacteria 1005
15 Ga0070705_100446501 3300005440 Bacteria 969
16 Ga0070678_100403560 3300005456 Bacteria 1188
17 Ga0070681_10450038 3300005458 Bacteria 1200
18 Ga0070681_10586689 3300005458 Bacteria 1029
19 Ga0070685_10864369 3300005466 Bacteria 671
20 Ga0070679_100006045 3300005530 Bacteria 11257
21 Ga0070684_100090313 3300005535 Bacteria 2724
22 Ga0070684_101686710 3300005535 Bacteria 598
23 Ga0070672_101290476 3300005543 Bacteria 652
24 Ga0070693_100155223 3300005547 Bacteria 1453
25 Ga0068855_100417095 3300005563 Bacteria 1469
26 Ga0068857_100025928 3300005577 Bacteria 5164
27 Ga0068856_100377339 3300005614 Bacteria 1437
28 Ga0070702_100572418 3300005615 Bacteria 842
29 Ga0068864_100034811 3300005618 Bacteria 4285
30 Ga0068864_100325424 3300005618 Bacteria 1445
31 Ga0068866_10539292 3300005718 Bacteria 778
32 Ga0068861_100274498 3300005719 Bacteria 1449
33 Ga0068870_10936289 3300005840 Bacteria 614
34 Ga0068863_100097466 3300005841 Bacteria 2792
35 Ga0068863_100452143 3300005841 Bacteria 1261
36 Ga0068863_101283622 3300005841 Bacteria 739
37 Ga0068858_100031375 3300005842 Bacteria 4935
38 Ga0068858_100142604 3300005842 Bacteria 2250
39 Ga0068862_101214584 3300005844 Bacteria 753
40 Ga0070717_10033710 3300006028 Bacteria 4133
41 Ga0068871_100461643 3300006358 Bacteria 1140
42 Ga0068871_100609628 3300006358 Bacteria 993
43 Ga0075429_100877787 3300006880 Bacteria 785
44 Ga0068865_100460420 3300006881 Bacteria 1053
45 Ga0111539_11291695 3300009094 Bacteria 847
46 Ga0111539_13175628 3300009094 Bacteria 530
47 Ga0105247_10179546 3300009101 Bacteria 1412
48 Ga0114129_10233551 3300009147 Bacteria 2476
49 Ga0114129_10708511 3300009147 Bacteria 1293
50 Ga0105248_10015227 3300009177 Bacteria 8475
51 Ga0105239_10499040 3300010375 Bacteria 1383
52 Ga0157374_10261429 3300013296 Bacteria 1705
53 Ga0163162_10607329 3300013306 Bacteria 1220
54 Ga0157372_11732591 3300013307 Bacteria 719
55 Ga0157375_10260430 3300013308 Bacteria 1896
56 Ga0163163_10035115 3300014325 Bacteria 4861
57 Ga0163163_10069692 3300014325 Bacteria 3501
58 Ga0163163_10656933 3300014325 Bacteria 1112
59 Ga0157379_10067396 3300014968 Bacteria 3199
60 Ga0157379_10148840 3300014968 Bacteria 2112
61 Ga0157379_10708880 3300014968 Bacteria 945
62 Ga0157376_10903443 3300014969 Bacteria 901
63 Ga0157376_11149019 3300014969 Bacteria 803
64 Ga0207692_10019278 3300025898 Bacteria 3080
65 Ga0207707_10147089 3300025912 Bacteria 2060
66 Ga0207707_10456585 3300025912 Bacteria 1093
67 Ga0207663_10485720 3300025916 Bacteria 957
68 Ga0207660_10159789 3300025917 Bacteria 1738
69 Ga0207662_10147369 3300025918 Bacteria 1495
70 Ga0207652_10091982 3300025921 Bacteria 2668
71 Ga0207650_10006622 3300025925 Bacteria 7901
72 Ga0207659_10152145 3300025926 Bacteria 1808
73 Ga0207664_10006782 3300025929 Bacteria 7910
74 Ga0207690_11437789 3300025932 Bacteria 576
75 Ga0207669_11199059 3300025937 Bacteria 643
76 Ga0207691_10489170 3300025940 Bacteria 1045
77 Ga0207691_10986747 3300025940 Bacteria 703
78 Ga0207711_10035121 3300025941 Bacteria 4248
79 Ga0207661_10090571 3300025944 Bacteria 2547
80 Ga0207679_10718102 3300025945 Bacteria 908
81 Ga0207651_10025059 3300025960 Bacteria 3702
82 Ga0207712_10888657 3300025961 Bacteria 787
83 Ga0207703_10025501 3300026035 Bacteria 4650
84 Ga0207703_10082606 3300026035 Bacteria 2682
85 Ga0207702_10991113 3300026078 Bacteria 833
86 Ga0207641_10046175 3300026088 Bacteria 3671
87 Ga0207641_10056860 3300026088 Bacteria 3326
88 Ga0207648_11654971 3300026089 Bacteria 601
89 Ga0207676_10084315 3300026095 Bacteria 2590
90 Ga0207676_10517644 3300026095 Bacteria 1135
91 Ga0207676_10757190 3300026095 Bacteria 945
92 Ga0207674_10065071 3300026116 Bacteria 3676
93 Ga0207674_10069860 3300026116 Bacteria 3531
94 Ga0207675_100757643 3300026118 Bacteria 982
95 Ga0207683_10316007 3300026121 Bacteria 1430
96 Ga0207683_10454061 3300026121 Bacteria 1182
97 Ga0265336_10042308 3300028666 Bacteria 1391
98 Ga0265338_10040591 3300028800 Bacteria 4368
99 Ga0265338_10094719 3300028800 Bacteria 2455
100 Ga0265320_10001577 3300031240 Bacteria 16369
101 Ga0265320_10015327 3300031240 Bacteria 4337
102 Ga0265339_10017386 3300031249 Bacteria 4261
103 Ga0307509_10264801 3300031507 Bacteria 1491
104 Ga0265314_10000913 3300031711 Bacteria 34774
105 Ga0265314_10093629 3300031711 Bacteria 1950
106 Ga0265342_10002070 3300031712 Bacteria 17789
107 Ga0265342_10002845 3300031712 Bacteria 14604
108 Ga0265342_10049593 3300031712 Bacteria 2512
109 Ga0307406_10998301 3300031901 Bacteria 718
110 Ga0307409_100041792 3300031995 Bacteria 3428
111 Ga0307416_103611962 3300032002 Bacteria 518
112 Ga0307415_100065576 3300032126 Bacteria 2531
113 Ga0307507_10276339 3300033179 Bacteria 1055
114 Ga0373934_0128990 3300035086 Bacteria 1031
115 Ga0373954_0090767 3300035118 Bacteria 1467
116 Ga0373956_0031583 3300035119 Bacteria 2322
117 Ga0373955_0146394 3300035172 Bacteria 1388
118 Ga0373955_0191739 3300035172 Bacteria 1215
119 Ga0373931_0211388 3300035691 Bacteria 1164
120 Ga0373927_0959804 3300035695 Bacteria 564
121 Ga0373933_0007460 3300035724 Bacteria 5970
122 Ga0373933_0050507 3300035724 Bacteria 2483
123 Ga0373947_0433875 3300035725 Bacteria 889
124 Ga0373937_0018807 3300036401 Bacteria 6175
125 Ga0373937_0173197 3300036401 Bacteria 2025
126 Ga0373937_0336332 3300036401 Bacteria 1430
127 Ga0373937_0902540 3300036401 Bacteria 832
128 Ga0373925_0021298 3300037068 Bacteria 4723
129 Ga0436364_0879126 3300037853 Bacteria 520
130 Ga0436364_1412518 3300037853 Bacteria 592
131 Ga0466957_0139643 3300044842 Bacteria 1560
132 Ga0466959_0177569 3300045049 Bacteria 1491
133 Ga0466967_0067976 3300045976 Bacteria 3180
134 Ga0466967_1873275 3300045976 Bacteria 597
135 Ga0495594_0054060 3300046499 Bacteria 2213
136 Ga0495630_0285502 3300046517 Bacteria 1261
137 Ga0495630_0730912 3300046517 Bacteria 757
138 Ga0495667_0089445 3300046559 Bacteria 1996
139 Ga0495635_0422426 3300046663 Bacteria 884
140 Ga0495658_0851276 3300046683 Bacteria 583
141 Ga0495604_0134212 3300047317 Bacteria 1775
142 Ga0495674_0616191 3300047319 Bacteria 859
143 Ga0495680_0082609 3300047322 Bacteria 2424
144 Ga0495675_0251729 3300047444 Bacteria 1061
145 Ga0496100_0163634 3300048903 Bacteria 1597
146 Ga0496101_0597898 3300048904 Bacteria 872
147 Ga0496102_0248394 3300048905 Bacteria 1677
148 Ga0496103_0230519 3300048906 Bacteria 1191
149 Ga0496104_0037616 3300048907 Bacteria 4525
150 Ga0496104_0052787 3300048907 Bacteria 3840
151 Ga0496104_0066054 3300048907 Bacteria 3434
152 Ga0496104_1052816 3300048907 Bacteria 717
153 Ga0496105_0070695 3300048908 Bacteria 2885
154 Ga0496105_0443694 3300048908 Bacteria 1025
155 Ga0496105_0566383 3300048908 Bacteria 885
156 Ga0496107_0168788 3300048910 Bacteria 1623
157 Ga0496108_0002361 3300048911 Bacteria 15117
158 Ga0496108_0031245 3300048911 Bacteria 4417
159 Ga0496108_0830355 3300048911 Bacteria 796
160 Ga0496109_0005119 3300048912 Bacteria 10951
161 Ga0496109_0165192 3300048912 Bacteria 2075
162 Ga0496110_0002060 3300048913 Bacteria 14989
163 Ga0496110_0081534 3300048913 Bacteria 2884
164 Ga0496111_0040812 3300048914 Bacteria 3329
165 Ga0496112_0245908 3300048915 Bacteria 1740
166 Ga0496112_1053996 3300048915 Bacteria 732
167 Ga0496113_0019762 3300048916 Bacteria 4720
168 Ga0496113_1023104 3300048916 Bacteria 650
169 Ga0496114_0004651 3300048917 Bacteria 10670
170 Ga0496114_0049792 3300048917 Bacteria 3486
171 Ga0496114_0215008 3300048917 Bacteria 1687
172 Ga0496115_0014082 3300048918 Bacteria 6055
173 Ga0496115_0048450 3300048918 Bacteria 3399
174 Ga0501033_0041524 3300049570 Bacteria 3432
175 Ga0501036_0348231 3300049572 Bacteria 1237
176 Ga0501036_0638149 3300049572 Bacteria 882
177 Ga0501038_0189023 3300049574 Bacteria 1658
178 Ga0501039_1469070 3300049575 Bacteria 524
179 Ga0501040_1000019 3300049576 Bacteria 606
180 Ga0501068_0033454 3300049584 Bacteria 3061
181 Ga0501068_0226931 3300049584 Bacteria 1187
182 Ga0501068_1009285 3300049584 Bacteria 549
183 Ga0501069_0043849 3300049585 Bacteria 2476
184 Ga0501069_0050643 3300049585 Bacteria 2309
185 Ga0501070_0000736 3300049586 Bacteria 29947
186 Ga0501070_0084485 3300049586 Bacteria 2628
187 Ga0501071_1074063 3300049587 Bacteria 622
188 Ga0501073_0033497 3300049589 Bacteria 3658
189 Ga0501073_0077417 3300049589 Bacteria 2314
190 Ga0501074_0061522 3300049590 Bacteria 2705
191 Ga0501074_0065717 3300049590 Bacteria 2610
192 Ga0501075_0018781 3300049591 Bacteria 5009
193 Ga0501077_0015894 3300049593 Bacteria 4741
194 Ga0501079_0023988 3300049741 Bacteria 4679
195 Ga0501079_0295392 3300049741 Bacteria 1267
196 Ga0501080_0019127 3300049742 Bacteria 6343
197 Ga0501080_0075840 3300049742 Bacteria 3127
198 Ga0501081_0006937 3300049743 Bacteria 7361
199 Ga0501083_0003664 3300049744 Bacteria 10785
200 Ga0501083_0111536 3300049744 Bacteria 1798
201 Ga0501083_0281877 3300049744 Bacteria 1081
202 Ga0501045_0123322 3300049824 Bacteria 1924
203 nmdc:mga05p37_446730_c1 3300050507 Bacteria 1498
204 nmdc:mga09592_1135198_c1 3300050508 Bacteria 648
205 nmdc:mga06r32_96215_c1 3300050510 Bacteria 2899
206 Ga0495601_0399446 3300053077 Bacteria 891
207 Ga0495601_0474154 3300053077 Bacteria 809
208 Ga0495612_0257575 3300053078 Bacteria 777
209 Ga0500646_0000139 3300053090 Bacteria 21207
210 Ga0501084_0018183 3300054114 Bacteria 5852
211 Ga0501084_0099343 3300054114 Bacteria 2444
212 Ga0501082_0019356 3300060353 Bacteria 5867
213 Ga0501082_0090518 3300060353 Bacteria 2641
214 Ga0501082_0157916 3300060353 Bacteria 1970
215 Ga0530510_0290510 3300061734 Bacteria 1222
216 Ga0530510_1026610 3300061734 Bacteria 631
217 2501943577 2501939600 Bacteria 6907073
218 2623586679 2622736626 Bacteria 7181580
219 2855688480 2855683550 Bacteria 7134265
220 2856860598 2856858025 Bacteria 7255264
221 2858874282 2858868258 Bacteria 7683772
222 2902586143 2902582711 Bacteria 6187705
223 2996227114 2996221748 Bacteria 6799777
224 649811333 649633069 Bacteria 6962533
225 Ga0496108_0566762
226 Ga0070683_100227964
227 Ga0070683_101361228
228 Ga0070670_100005581
229 Ga0070680_100148186
230 Ga0070680_100681695
231 Ga0070687_100121652
232 Ga0070675_100865146
233 Ga0070673_100083729
234 Ga0070709_10080995
235 Ga0070714_100001559
236 Ga0070710_10016952
237 Ga0070711_100044291
238 Ga0070711_100497288
239 Ga0070705_100446501
240 Ga0070678_100403560
241 Ga0070681_10450038
242 Ga0070681_10586689
243 Ga0070685_10864369
244 Ga0070679_100006045
245 Ga0070684_100090313
246 Ga0070684_101686710
247 Ga0070672_101290476
248 Ga0070693_100155223
249 Ga0068855_100417095
250 Ga0068857_100025928
251 Ga0068856_100377339
252 Ga0070702_100572418
253 Ga0068864_100034811
254 Ga0068864_100325424
255 Ga0068866_10539292
256 Ga0068861_100274498
257 Ga0068870_10936289
258 Ga0068863_100097466
259 Ga0068863_100452143
260 Ga0068863_101283622
261 Ga0068858_100031375
262 Ga0068858_100142604
263 Ga0068862_101214584
264 Ga0070717_10033710
265 Ga0068871_100461643
266 Ga0068871_100609628
267 Ga0075429_100877787
268 Ga0068865_100460420
269 Ga0111539_11291695
270 Ga0111539_13175628
271 Ga0105247_10179546
272 Ga0114129_10233551
273 Ga0114129_10708511
274 Ga0105248_10015227
275 Ga0105239_10499040
276 Ga0157374_10261429
277 Ga0163162_10607329
278 Ga0157372_11732591
279 Ga0157375_10260430
280 Ga0163163_10035115
281 Ga0163163_10069692
282 Ga0163163_10656933
283 Ga0157379_10067396
284 Ga0157379_10148840
285 Ga0157379_10708880
286 Ga0157376_10903443
287 Ga0157376_11149019
288 Ga0207692_10019278
289 Ga0207707_10147089
290 Ga0207707_10456585
291 Ga0207663_10485720
292 Ga0207660_10159789
293 Ga0207662_10147369
294 Ga0207652_10091982
295 Ga0207650_10006622
296 Ga0207659_10152145
297 Ga0207664_10006782
298 Ga0207690_11437789
299 Ga0207669_11199059
300 Ga0207691_10489170
301 Ga0207691_10986747
302 Ga0207711_10035121
303 Ga0207661_10090571
304 Ga0207679_10718102
305 Ga0207651_10025059
306 Ga0207712_10888657
307 Ga0207703_10025501
308 Ga0207703_10082606
309 Ga0207702_10991113
310 Ga0207641_10046175
311 Ga0207641_10056860
312 Ga0207648_11654971
313 Ga0207676_10084315
314 Ga0207676_10517644
315 Ga0207676_10757190
316 Ga0207674_10065071
317 Ga0207674_10069860
318 Ga0207675_100757643
319 Ga0207683_10316007
320 Ga0207683_10454061
321 Ga0265336_10042308
322 Ga0265338_10040591
323 Ga0265338_10094719
324 Ga0265320_10001577
325 Ga0265320_10015327
326 Ga0265339_10017386
327 Ga0307509_10264801
328 Ga0265314_10000913
329 Ga0265314_10093629
330 Ga0265342_10002070
331 Ga0265342_10002845
332 Ga0265342_10049593
333 Ga0307406_10998301
334 Ga0307409_100041792
335 Ga0307416_103611962
336 Ga0307415_100065576
337 Ga0307507_10276339
338 Ga0373934_0128990
339 Ga0373954_0090767
340 Ga0373956_0031583
341 Ga0373955_0146394
342 Ga0373955_0191739
343 Ga0373931_0211388
344 Ga0373927_0959804
345 Ga0373933_0007460
346 Ga0373933_0050507
347 Ga0373947_0433875
348 Ga0373937_0018807
349 Ga0373937_0173197
350 Ga0373937_0336332
351 Ga0373937_0902540
352 Ga0373925_0021298
353 Ga0436364_0879126
354 Ga0436364_1412518
355 Ga0466957_0139643
356 Ga0466959_0177569
357 Ga0466967_0067976
358 Ga0466967_1873275
359 Ga0495594_0054060
360 Ga0495630_0285502
361 Ga0495630_0730912
362 Ga0495667_0089445
363 Ga0495635_0422426
364 Ga0495658_0851276
365 Ga0495604_0134212
366 Ga0495674_0616191
367 Ga0495680_0082609
368 Ga0495675_0251729
369 Ga0496100_0163634
370 Ga0496101_0597898
371 Ga0496102_0248394
372 Ga0496103_0230519
373 Ga0496104_0037616
374 Ga0496104_0052787
375 Ga0496104_0066054
376 Ga0496104_1052816
377 Ga0496105_0070695
378 Ga0496105_0443694
379 Ga0496105_0566383
380 Ga0496107_0168788
381 Ga0496108_0002361
382 Ga0496108_0031245
383 Ga0496108_0830355
384 Ga0496109_0005119
385 Ga0496109_0165192
386 Ga0496110_0002060
387 Ga0496110_0081534
388 Ga0496111_0040812
389 Ga0496112_0245908
390 Ga0496112_1053996
391 Ga0496113_0019762
392 Ga0496113_1023104
393 Ga0496114_0004651
394 Ga0496114_0049792
395 Ga0496114_0215008
396 Ga0496115_0014082
397 Ga0496115_0048450
398 Ga0501033_0041524
399 Ga0501036_0348231
400 Ga0501036_0638149
401 Ga0501038_0189023
402 Ga0501039_1469070
403 Ga0501040_1000019
404 Ga0501068_0033454
405 Ga0501068_0226931
406 Ga0501068_1009285
407 Ga0501069_0043849
408 Ga0501069_0050643
409 Ga0501070_0000736
410 Ga0501070_0084485
411 Ga0501071_1074063
412 Ga0501073_0033497
413 Ga0501073_0077417
414 Ga0501074_0061522
415 Ga0501074_0065717
416 Ga0501075_0018781
417 Ga0501077_0015894
418 Ga0501079_0023988
419 Ga0501079_0295392
420 Ga0501080_0019127
421 Ga0501080_0075840
422 Ga0501081_0006937
423 Ga0501083_0003664
424 Ga0501083_0111536
425 Ga0501083_0281877
426 Ga0501045_0123322
427 nmdc:mga05p37_446730_c1
428 nmdc:mga09592_1135198_c1
429 nmdc:mga06r32_96215_c1
430 Ga0495601_0399446
431 Ga0495601_0474154
432 Ga0495612_0257575
433 Ga0500646_0000139
434 Ga0501084_0018183
435 Ga0501084_0099343
436 Ga0501082_0019356
437 Ga0501082_0090518
438 Ga0501082_0157916
439 Ga0530510_0290510
440 Ga0530510_1026610
441 2501943577
442 2623586679
443 2855688480
444 2856860598
445 2858874282
446 2902586143
447 2996227114
448 649811333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

32

127

0.89

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

24

131

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9292 3 135
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9254 3 135
3o0m-assembly1.cif.gz_A crystal structure of a zn-bound histidine triad family protein from mycobacterium smegmatis 0.9096 3 136
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9035 3 135
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8987 3 135
ID Description Score Start End Superfamily
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9387 3 106 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9357 18 103 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9351 18 107 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9292 3 135 3.30.428.10
af_A0A1D8PKG2_1_175_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9281 18 108 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A535RPA4-F1-model_v4 HIT family protein 0.9819 42 136 GO:0003824
GO:0009117
AF-A0A0Q0RPY1-F1-model_v4 HIT domain-containing protein 0.9769 18 136 GO:0003824
GO:0009117
AF-A0A1F2X1A4-F1-model_v4 HIT family hydrolase 0.9719 1 100 GO:0009117
GO:0016787
AF-A0A3N5E9W3-F1-model_v4 HIT family protein 0.9697 2 103 GO:0003824
GO:0009117
AF-A0A2V7YXG0-F1-model_v4 HIT family protein 0.9652 45 136 GO:0003824

Map