F337119

General Info

Members Datasets Scaffolds Average Seq Length
224 133 448 383

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0085898|Ga0496104_0085898_828_2213
Length 445
Sequence LITPSRRVTAGAARARQSHLITSDPRCAWIAGGYAVSHRFTSAAFVLVALSAVRASAQAAPQPPPDAQALRAAIDDLKKEFDARLSALEMRLAAVEGGPQAPERAPAPGSKVFNPDMAVIGDFLGTAGRVRTDPANHVTPDPAFEMHESEASFQAVVDPYARADFFISFGEQGVDLEEGFVTLTSLPGGLLTKVGKMRAAFGKVNSLHNHVLPWADRPLVIKNLVGGEDGIDDAGVSVAHLIPNPWIFLEATGQVFRGDSGPEEQPLYQTNQRGQLSYVAHLRGYGDLSESTNLDLGFSASRGYNGSGLPQDIDDLTTSLLGFDATLRWKPLRRSIYHSFVGRSEVIWSRREQPNGLQSGMGYYVSADYQLARRWFAGVRFDGSDRAYDSTLHDTGGSALLTFWPSEFSQIRGQYRRTNYAIGPAANELLFQFQFSIGAHGAHPF

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.12
Rhizosphere 96.43
Stem 0
Stem Tuber 0
Unclassified 18.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0085898 3300048907 Bacteria 3004
2 JGI25406J46586_10000253 3300003203 Bacteria 23771
3 JGI25406J46586_10000372 3300003203 Bacteria 20484
4 rootL2_10079171 3300003322 Unclassified 2846
5 Ga0065707_10006329 3300005295 Unclassified 4050
6 Ga0070676_10051865 3300005328 Unclassified 2410
7 Ga0070690_100009514 3300005330 Bacteria 5634
8 Ga0070670_100005884 3300005331 Bacteria 10364
9 Ga0070670_100087487 3300005331 Unclassified 2678
10 Ga0070670_100088181 3300005331 Bacteria 2667
11 Ga0070677_10008201 3300005333 Bacteria 3509
12 Ga0070666_10011319 3300005335 Bacteria 5598
13 Ga0070687_100011537 3300005343 Bacteria 3868
14 Ga0070661_100061831 3300005344 Bacteria 2749
15 Ga0070669_100000306 3300005353 Bacteria 38513
16 Ga0070669_100003950 3300005353 Bacteria 10726
17 Ga0070675_100049212 3300005354 Bacteria 3459
18 Ga0070688_100049844 3300005365 Unclassified 2607
19 Ga0070688_100067662 3300005365 Bacteria 2276
20 Ga0070713_100011204 3300005436 Bacteria 6520
21 Ga0070713_100016627 3300005436 Bacteria 5534
22 Ga0070700_100023578 3300005441 Unclassified 3601
23 Ga0070694_100016245 3300005444 Bacteria 4685
24 Ga0070694_100026428 3300005444 Archaea 3761
25 Ga0070694_100128270 3300005444 Bacteria 1829
26 Ga0068867_100005130 3300005459 Bacteria 9254
27 Ga0068867_100051645 3300005459 Bacteria 3033
28 Ga0070707_100319010 3300005468 Bacteria 1510
29 Ga0070698_100000549 3300005471 Bacteria 40084
30 Ga0070698_100022903 3300005471 Bacteria 6531
31 Ga0070698_100078030 3300005471 Bacteria 3311
32 Ga0070699_100001070 3300005518 Bacteria 25499
33 Ga0070699_100006421 3300005518 Bacteria 10241
34 Ga0070699_100019639 3300005518 Bacteria 5822
35 Ga0070699_100052256 3300005518 Unclassified 3537
36 Ga0070699_100093347 3300005518 Bacteria 2633
37 Ga0070672_100069560 3300005543 Unclassified 2795
38 Ga0070696_100022541 3300005546 Unclassified 4280
39 Ga0070696_100110453 3300005546 Unclassified 1979
40 Ga0070696_100116904 3300005546 Unclassified 1926
41 Ga0070665_100003341 3300005548 Bacteria 17173
42 Ga0070704_100000034 3300005549 Bacteria 44933
43 Ga0070704_100042725 3300005549 Bacteria 3137
44 Ga0070664_100006824 3300005564 Bacteria 9207
45 Ga0070664_100119133 3300005564 Unclassified 2310
46 Ga0070664_100219952 3300005564 Bacteria 1699
47 Ga0068857_100016603 3300005577 Bacteria 6449
48 Ga0068859_100001958 3300005617 Bacteria 20998
49 Ga0068859_100270962 3300005617 Bacteria 1790
50 Ga0068864_100021655 3300005618 Bacteria 5383
51 Ga0068861_100011857 3300005719 Bacteria 6068
52 Ga0068870_10001533 3300005840 Bacteria 9381
53 Ga0068870_10036037 3300005840 Bacteria 2543
54 Ga0068863_100007259 3300005841 Bacteria 10854
55 Ga0068858_100047919 3300005842 Bacteria 3961
56 Ga0068860_100049056 3300005843 Bacteria 4023
57 Ga0068860_100180148 3300005843 Bacteria 2042
58 Ga0068862_100000265 3300005844 Bacteria 58275
59 Ga0068862_100032604 3300005844 Bacteria 4402
60 Ga0068862_100071397 3300005844 Unclassified 2998
61 Ga0081455_10070227 3300005937 Bacteria 2909
62 Ga0081539_10000010 3300005985 Bacteria 484386
63 Ga0081539_10009718 3300005985 Bacteria 7963
64 Ga0097621_100001041 3300006237 Bacteria 19462
65 Ga0097621_100058731 3300006237 Bacteria 3147
66 Ga0068871_100008489 3300006358 Bacteria 7390
67 Ga0068871_100008986 3300006358 Bacteria 7215
68 Ga0068871_100055875 3300006358 Bacteria 3207
69 Ga0075430_100001077 3300006846 Bacteria 21644
70 Ga0075431_100005953 3300006847 Bacteria 12071
71 Ga0075431_100247007 3300006847 Unclassified 1814
72 Ga0075433_10001297 3300006852 Bacteria 18280
73 Ga0075433_10022608 3300006852 Bacteria 5280
74 Ga0075433_10203599 3300006852 Bacteria 1759
75 Ga0075434_100015365 3300006871 Bacteria 7335
76 Ga0075434_100021963 3300006871 Bacteria 6212
77 Ga0075434_100191220 3300006871 Bacteria 2067
78 Ga0075434_100252197 3300006871 Bacteria 1784
79 Ga0075429_100127080 3300006880 Bacteria 2229
80 Ga0075429_100171114 3300006880 Bacteria 1903
81 Ga0075429_100196773 3300006880 Bacteria 1766
82 Ga0068865_100051541 3300006881 Bacteria 2849
83 Ga0097620_100001958 3300006931 Bacteria 20998
84 Ga0097620_100270963 3300006931 Bacteria 1790
85 Ga0075435_100026337 3300007076 Bacteria 4535
86 Ga0075435_100033814 3300007076 Unclassified 4045
87 Ga0111539_10018992 3300009094 Bacteria 8498
88 Ga0111539_10030533 3300009094 Bacteria 6549
89 Ga0111539_10051988 3300009094 Bacteria 4879
90 Ga0105245_10013610 3300009098 Bacteria 7087
91 Ga0105247_10028438 3300009101 Bacteria 3383
92 Ga0114129_10000307 3300009147 Bacteria 57086
93 Ga0114129_10020856 3300009147 Bacteria 9309
94 Ga0114129_10022898 3300009147 Bacteria 8860
95 Ga0114129_10024820 3300009147 Bacteria 8497
96 Ga0114129_10038400 3300009147 Bacteria 6755
97 Ga0114129_10066834 3300009147 Bacteria 5014
98 Ga0114129_10082948 3300009147 Bacteria 4454
99 Ga0114129_10307887 3300009147 Unclassified 2110
100 Ga0114129_10340778 3300009147 Bacteria 1988
101 Ga0114129_10375986 3300009147 Bacteria 1877
102 Ga0105248_10041976 3300009177 Bacteria 5129
103 Ga0105248_10096856 3300009177 Bacteria 3324
104 Ga0105248_10125413 3300009177 Bacteria 2896
105 Ga0105248_10144337 3300009177 Bacteria 2686
106 Ga0105248_10151417 3300009177 Unclassified 2617
107 Ga0105237_10004823 3300009545 Bacteria 15491
108 Ga0105249_10007048 3300009553 Bacteria 9806
109 Ga0105249_10468821 3300009553 Bacteria 1300
110 Ga0157374_10029442 3300013296 Bacteria 4973
111 Ga0163162_10209757 3300013306 Unclassified 2077
112 Ga0157375_10006055 3300013308 Bacteria 10548
113 Ga0157375_10344102 3300013308 Bacteria 1657
114 Ga0163163_10000833 3300014325 Bacteria 26251
115 Ga0163163_10034484 3300014325 Bacteria 4902
116 Ga0157380_10019970 3300014326 Bacteria 5001
117 Ga0157379_10218166 3300014968 Unclassified 1728
118 Ga0207697_10002659 3300025315 Bacteria 9149
119 Ga0207710_10026651 3300025900 Bacteria 2499
120 Ga0207688_10003565 3300025901 Bacteria 8494
121 Ga0207680_10065627 3300025903 Bacteria 2229
122 Ga0207643_10001325 3300025908 Bacteria 14342
123 Ga0207643_10009070 3300025908 Bacteria 5343
124 Ga0207671_10018005 3300025914 Bacteria 5432
125 Ga0207662_10022477 3300025918 Unclassified 3617
126 Ga0207649_10111352 3300025920 Unclassified 1829
127 Ga0207681_10003377 3300025923 Bacteria 9992
128 Ga0207650_10071837 3300025925 Bacteria 2604
129 Ga0207650_10080759 3300025925 Bacteria 2466
130 Ga0207650_10099420 3300025925 Bacteria 2237
131 Ga0207659_10000470 3300025926 Bacteria 24214
132 Ga0207687_10005111 3300025927 Bacteria 8697
133 Ga0207687_10030831 3300025927 Bacteria 3619
134 Ga0207700_10018465 3300025928 Bacteria 4686
135 Ga0207644_10022420 3300025931 Bacteria 4315
136 Ga0207686_10027904 3300025934 Bacteria 3311
137 Ga0207670_10009918 3300025936 Bacteria 5457
138 Ga0207670_10042387 3300025936 Bacteria 2998
139 Ga0207691_10071282 3300025940 Unclassified 3136
140 Ga0207711_10080532 3300025941 Bacteria 2844
141 Ga0207689_10022314 3300025942 Bacteria 5323
142 Ga0207661_10153800 3300025944 Bacteria 1990
143 Ga0207679_10180789 3300025945 Bacteria 1745
144 Ga0207712_10012172 3300025961 Bacteria 5495
145 Ga0207677_10025457 3300026023 Unclassified 3693
146 Ga0207703_10008884 3300026035 Bacteria 7915
147 Ga0207703_10035285 3300026035 Bacteria 3974
148 Ga0207708_10016982 3300026075 Bacteria 5479
149 Ga0207708_10024909 3300026075 Bacteria 4526
150 Ga0207641_10132206 3300026088 Bacteria 2242
151 Ga0207648_10007270 3300026089 Bacteria 10917
152 Ga0207648_10090136 3300026089 Unclassified 2679
153 Ga0207676_10016132 3300026095 Bacteria 5404
154 Ga0207674_10007513 3300026116 Bacteria 12706
155 Ga0207674_10044359 3300026116 Bacteria 4579
156 Ga0207675_100043069 3300026118 Unclassified 4216
157 Ga0207675_100082694 3300026118 Unclassified 3011
158 Ga0207675_100123509 3300026118 Unclassified 2451
159 Ga0207683_10083520 3300026121 Bacteria 2838
160 Ga0207683_10134531 3300026121 Bacteria 2225
161 Ga0207428_10000958 3300027907 Bacteria 32012
162 Ga0268266_10026010 3300028379 Bacteria 4978
163 Ga0268265_10012569 3300028380 Bacteria 5740
164 Ga0268265_10027027 3300028380 Bacteria 4090
165 Ga0268264_10203590 3300028381 Bacteria 1812
166 Ga0268264_10216050 3300028381 Bacteria 1763
167 Ga0373926_0020340 3300035083 Bacteria 2293
168 Ga0373953_0069600 3300035117 Unclassified 1450
169 Ga0373954_0031330 3300035118 Bacteria 2455
170 Ga0373935_0027870 3300035692 Unclassified 3491
171 Ga0373927_0000944 3300035695 Bacteria 22130
172 Ga0373947_0009693 3300035725 Bacteria 5526
173 Ga0373937_0037163 3300036401 Unclassified 4438
174 Ga0495603_0022932 3300046455 Unclassified 3778
175 Ga0495629_0025888 3300046459 Bacteria 4168
176 Ga0495584_0089273 3300046491 Unclassified 1554
177 Ga0495594_0061316 3300046499 Bacteria 2081
178 Ga0495659_0002461 3300046664 Bacteria 5973
179 Ga0495659_0011395 3300046664 Unclassified 2865
180 Ga0495659_0012217 3300046664 Unclassified 2778
181 Ga0495588_0014854 3300046674 Bacteria 3737
182 Ga0495658_0044749 3300046683 Unclassified 2481
183 Ga0495669_0067590 3300046684 Bacteria 1625
184 Ga0495613_0000865 3300046689 Bacteria 23237
185 Ga0495600_0028825 3300046809 Bacteria 3593
186 Ga0495604_0020219 3300047317 Bacteria 5320
187 Ga0495674_0016885 3300047319 Bacteria 6808
188 Ga0495676_0025407 3300047321 Bacteria 5115
189 Ga0495684_0003376 3300047471 Bacteria 12533
190 Ga0496101_0006393 3300048904 Bacteria 7582
191 Ga0496104_0006403 3300048907 Bacteria 10354
192 Ga0496104_0056328 3300048907 Bacteria 3717
193 Ga0496105_0062347 3300048908 Bacteria 3077
194 Ga0496108_0003082 3300048911 Bacteria 13396
195 Ga0496112_0015039 3300048915 Bacteria 7203
196 Ga0501068_0043722 3300049584 Unclassified 2696
197 Ga0501069_0047768 3300049585 Unclassified 2376
198 nmdc:mga05p37_16166_c1 3300050507 Bacteria 8984
199 nmdc:mga05p37_252448_c1 3300050507 Unclassified 2115
200 nmdc:mga05p37_67031_c1 3300050507 Bacteria 4416
201 nmdc:mga05p37_71448_c1 3300050507 Bacteria 4269
202 nmdc:mga09592_107101_c1 3300050508 Bacteria 2398
203 nmdc:mga09592_186899_c1 3300050508 Bacteria 1793
204 nmdc:mga0qj67_1253_c1 3300050509 Bacteria 17772
205 nmdc:mga06r32_497_c1 3300050510 Bacteria 33939
206 nmdc:mga08y16_8850_c1 3300050511 Bacteria 10567
207 nmdc:mga0n895_127010_c1 3300050512 Bacteria 2574
208 nmdc:mga0n895_14162_c1 3300050512 Bacteria 7232
209 nmdc:mga0n895_17193_c1 3300050512 Bacteria 6664
210 nmdc:mga0n895_29527_c1 3300050512 Bacteria 5232
211 nmdc:mga0n895_564847_c1 3300050512 Unclassified 1143
212 nmdc:mga0rr50_197798_c1 3300050513 Unclassified 1650
213 nmdc:mga0rr50_39975_c1 3300050513 Bacteria 3406
214 nmdc:mga0rr50_6462_c1 3300050513 Bacteria 7138
215 nmdc:mga08x19_137272_c1 3300050514 Bacteria 1649
216 nmdc:mga08x19_188016_c1 3300050514 Bacteria 1412
217 nmdc:mga0a205_1558_c1 3300050515 Bacteria 19618
218 nmdc:mga0a205_2045_c1 3300050515 Bacteria 17625
219 nmdc:mga0a205_33344_c1 3300050515 Bacteria 4937
220 nmdc:mga0a205_37095_c1 3300050515 Bacteria 4687
221 nmdc:mga0a205_52932_c1 3300050515 Bacteria 3918
222 nmdc:mga0a205_93046_c1 3300050515 Bacteria 2913
223 Ga0495601_0000195 3300053077 Bacteria 32156
224 Ga0495595_0036832 3300053084 Unclassified 2222
225 Ga0496104_0085898
226 JGI25406J46586_10000253
227 JGI25406J46586_10000372
228 rootL2_10079171
229 Ga0065707_10006329
230 Ga0070676_10051865
231 Ga0070690_100009514
232 Ga0070670_100005884
233 Ga0070670_100087487
234 Ga0070670_100088181
235 Ga0070677_10008201
236 Ga0070666_10011319
237 Ga0070687_100011537
238 Ga0070661_100061831
239 Ga0070669_100000306
240 Ga0070669_100003950
241 Ga0070675_100049212
242 Ga0070688_100049844
243 Ga0070688_100067662
244 Ga0070713_100011204
245 Ga0070713_100016627
246 Ga0070700_100023578
247 Ga0070694_100016245
248 Ga0070694_100026428
249 Ga0070694_100128270
250 Ga0068867_100005130
251 Ga0068867_100051645
252 Ga0070707_100319010
253 Ga0070698_100000549
254 Ga0070698_100022903
255 Ga0070698_100078030
256 Ga0070699_100001070
257 Ga0070699_100006421
258 Ga0070699_100019639
259 Ga0070699_100052256
260 Ga0070699_100093347
261 Ga0070672_100069560
262 Ga0070696_100022541
263 Ga0070696_100110453
264 Ga0070696_100116904
265 Ga0070665_100003341
266 Ga0070704_100000034
267 Ga0070704_100042725
268 Ga0070664_100006824
269 Ga0070664_100119133
270 Ga0070664_100219952
271 Ga0068857_100016603
272 Ga0068859_100001958
273 Ga0068859_100270962
274 Ga0068864_100021655
275 Ga0068861_100011857
276 Ga0068870_10001533
277 Ga0068870_10036037
278 Ga0068863_100007259
279 Ga0068858_100047919
280 Ga0068860_100049056
281 Ga0068860_100180148
282 Ga0068862_100000265
283 Ga0068862_100032604
284 Ga0068862_100071397
285 Ga0081455_10070227
286 Ga0081539_10000010
287 Ga0081539_10009718
288 Ga0097621_100001041
289 Ga0097621_100058731
290 Ga0068871_100008489
291 Ga0068871_100008986
292 Ga0068871_100055875
293 Ga0075430_100001077
294 Ga0075431_100005953
295 Ga0075431_100247007
296 Ga0075433_10001297
297 Ga0075433_10022608
298 Ga0075433_10203599
299 Ga0075434_100015365
300 Ga0075434_100021963
301 Ga0075434_100191220
302 Ga0075434_100252197
303 Ga0075429_100127080
304 Ga0075429_100171114
305 Ga0075429_100196773
306 Ga0068865_100051541
307 Ga0097620_100001958
308 Ga0097620_100270963
309 Ga0075435_100026337
310 Ga0075435_100033814
311 Ga0111539_10018992
312 Ga0111539_10030533
313 Ga0111539_10051988
314 Ga0105245_10013610
315 Ga0105247_10028438
316 Ga0114129_10000307
317 Ga0114129_10020856
318 Ga0114129_10022898
319 Ga0114129_10024820
320 Ga0114129_10038400
321 Ga0114129_10066834
322 Ga0114129_10082948
323 Ga0114129_10307887
324 Ga0114129_10340778
325 Ga0114129_10375986
326 Ga0105248_10041976
327 Ga0105248_10096856
328 Ga0105248_10125413
329 Ga0105248_10144337
330 Ga0105248_10151417
331 Ga0105237_10004823
332 Ga0105249_10007048
333 Ga0105249_10468821
334 Ga0157374_10029442
335 Ga0163162_10209757
336 Ga0157375_10006055
337 Ga0157375_10344102
338 Ga0163163_10000833
339 Ga0163163_10034484
340 Ga0157380_10019970
341 Ga0157379_10218166
342 Ga0207697_10002659
343 Ga0207710_10026651
344 Ga0207688_10003565
345 Ga0207680_10065627
346 Ga0207643_10001325
347 Ga0207643_10009070
348 Ga0207671_10018005
349 Ga0207662_10022477
350 Ga0207649_10111352
351 Ga0207681_10003377
352 Ga0207650_10071837
353 Ga0207650_10080759
354 Ga0207650_10099420
355 Ga0207659_10000470
356 Ga0207687_10005111
357 Ga0207687_10030831
358 Ga0207700_10018465
359 Ga0207644_10022420
360 Ga0207686_10027904
361 Ga0207670_10009918
362 Ga0207670_10042387
363 Ga0207691_10071282
364 Ga0207711_10080532
365 Ga0207689_10022314
366 Ga0207661_10153800
367 Ga0207679_10180789
368 Ga0207712_10012172
369 Ga0207677_10025457
370 Ga0207703_10008884
371 Ga0207703_10035285
372 Ga0207708_10016982
373 Ga0207708_10024909
374 Ga0207641_10132206
375 Ga0207648_10007270
376 Ga0207648_10090136
377 Ga0207676_10016132
378 Ga0207674_10007513
379 Ga0207674_10044359
380 Ga0207675_100043069
381 Ga0207675_100082694
382 Ga0207675_100123509
383 Ga0207683_10083520
384 Ga0207683_10134531
385 Ga0207428_10000958
386 Ga0268266_10026010
387 Ga0268265_10012569
388 Ga0268265_10027027
389 Ga0268264_10203590
390 Ga0268264_10216050
391 Ga0373926_0020340
392 Ga0373953_0069600
393 Ga0373954_0031330
394 Ga0373935_0027870
395 Ga0373927_0000944
396 Ga0373947_0009693
397 Ga0373937_0037163
398 Ga0495603_0022932
399 Ga0495629_0025888
400 Ga0495584_0089273
401 Ga0495594_0061316
402 Ga0495659_0002461
403 Ga0495659_0011395
404 Ga0495659_0012217
405 Ga0495588_0014854
406 Ga0495658_0044749
407 Ga0495669_0067590
408 Ga0495613_0000865
409 Ga0495600_0028825
410 Ga0495604_0020219
411 Ga0495674_0016885
412 Ga0495676_0025407
413 Ga0495684_0003376
414 Ga0496101_0006393
415 Ga0496104_0006403
416 Ga0496104_0056328
417 Ga0496105_0062347
418 Ga0496108_0003082
419 Ga0496112_0015039
420 Ga0501068_0043722
421 Ga0501069_0047768
422 nmdc:mga05p37_16166_c1
423 nmdc:mga05p37_252448_c1
424 nmdc:mga05p37_67031_c1
425 nmdc:mga05p37_71448_c1
426 nmdc:mga09592_107101_c1
427 nmdc:mga09592_186899_c1
428 nmdc:mga0qj67_1253_c1
429 nmdc:mga06r32_497_c1
430 nmdc:mga08y16_8850_c1
431 nmdc:mga0n895_127010_c1
432 nmdc:mga0n895_14162_c1
433 nmdc:mga0n895_17193_c1
434 nmdc:mga0n895_29527_c1
435 nmdc:mga0n895_564847_c1
436 nmdc:mga0rr50_197798_c1
437 nmdc:mga0rr50_39975_c1
438 nmdc:mga0rr50_6462_c1
439 nmdc:mga08x19_137272_c1
440 nmdc:mga08x19_188016_c1
441 nmdc:mga0a205_1558_c1
442 nmdc:mga0a205_2045_c1
443 nmdc:mga0a205_33344_c1
444 nmdc:mga0a205_37095_c1
445 nmdc:mga0a205_52932_c1
446 nmdc:mga0a205_93046_c1
447 Ga0495601_0000195
448 Ga0495595_0036832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gey-assembly1.cif.gz_A high ph structure of pseudomonas putida oprb 0.7024 56 376
4rjw-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa opro 0.7001 59 376
4rjx-assembly1.cif.gz_A-3 crystal structure of the opro mutant protein f62y/d114y 0.6977 59 376
2o4v-assembly1.cif.gz_B an arginine ladder in oprp mediates phosphate specific transfer across the outer membrane 0.6903 53 376
3fyx-assembly1.cif.gz_A the structure of ompf porin with a synthetic dibenzo-18-crown-6 as modulator 0.6898 61 376
ID Description Score Start End Superfamily
2o4vB00 Mainly Beta;Beta Barrel;Porin;Porin 0.6903 53 376 2.40.160.10
af_A0A1D6LMU3_87_381_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.6423 61 374 2.40.160.10
af_A0A1D6LMU3_87_381_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.6369 61 374 2.40.160.10
4kr4C00 Mainly Beta;Beta Barrel;Porin;Porin 0.6302 61 376 2.40.160.10
af_A0A1D6GQ95_139_503_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.623 63 372 2.40.160.10
ID Description Score Start End GO Terms
AF-A0A2V9ZB27-F1-model_v4 LptD C-terminal domain-containing protein 0.9463 118 384
AF-A0A2V9ZB27-F1-model_v4 LptD C-terminal domain-containing protein 0.9427 118 384
AF-A0A7V2XJV2-F1-model_v4 Zinc-regulated TonB-dependent outer membrane receptor 0.9226 115 384
AF-A0A2V8EQ02-F1-model_v4 Uncharacterized protein 0.9221 214 384
AF-A0A2V7VAH4-F1-model_v4 TonB-dependent receptor 0.9141 43 311

Map