F337013

General Info

Members Datasets Scaffolds Average Seq Length
224 73 448 117

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0156110|Ga0453683_0156110_889_1341
Length 142
Sequence MNQVLEAVEEQQLRNDIPKFQAGDTIRVHVRIKEGDKERIQAFEGVVIARKHSGVRETITVRKTSFGVGVERIFPLHASVIERIELVRHGRVRRAKLYYLRKLRGKAARIRERDMRGERAMGAAASXXXXDVSEAEPHTSED

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
34 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
35 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
36 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
37 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
38 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
39 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
40 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
41 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
42 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
52 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
53 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
54 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
55 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
56 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
57 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
58 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
59 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
60 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
68 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
69 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
70 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
71 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
72 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
73 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.8
Metatranscriptomes 19.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 0
Rhizosphere 86.16
Stem 0
Stem Tuber 0
Unclassified 15.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0156110 3300044673 Bacteria 1443
2 Ga0070690_100120810 3300005330 Bacteria 1758
3 Ga0070713_100550869 3300005436 Unclassified 1092
4 Ga0070711_100000230 3300005439 Bacteria 29565
5 Ga0070694_100147440 3300005444 Bacteria 1715
6 Ga0070694_101192777 3300005444 Unclassified 638
7 Ga0070706_100141684 3300005467 Bacteria 2244
8 Ga0070686_100052159 3300005544 Bacteria 2607
9 Ga0070704_100516462 3300005549 Bacteria 1039
10 Ga0081538_10050045 3300005981 Bacteria 2528
11 Ga0075364_10415905 3300006051 Bacteria 918
12 Ga0070715_10072678 3300006163 Bacteria 1540
13 Ga0075428_100992078 3300006844 Bacteria 889
14 Ga0075431_100199222 3300006847 Unclassified 2049
15 Ga0075433_10783893 3300006852 Unclassified 833
16 Ga0075434_100823652 3300006871 Bacteria 944
17 Ga0075429_100977163 3300006880 Unclassified 740
18 Ga0075436_100000350 3300006914 Bacteria 29446
19 Ga0075436_100016972 3300006914 Bacteria 4982
20 Ga0075435_100099873 3300007076 Bacteria 2404
21 Ga0075435_101248199 3300007076 Bacteria 650
22 Ga0105240_10818120 3300009093 Bacteria 1008
23 Ga0114129_10019891 3300009147 Bacteria 9554
24 Ga0114129_10231073 3300009147 Bacteria 2491
25 Ga0105241_10590788 3300009174 Bacteria 1002
26 Ga0105241_11034523 3300009174 Bacteria 770
27 Ga0105238_10856048 3300009551 Bacteria 926
28 Ga0157370_10006835 3300013104 Bacteria 12500
29 Ga0157378_10504684 3300013297 Unclassified 1209
30 Ga0157378_10733551 3300013297 Bacteria 1010
31 Ga0163163_10452868 3300014325 Bacteria 1343
32 Ga0154015_1496968 3300020610 Bacteria 603
33 Ga0207654_10652390 3300025911 Bacteria 754
34 Ga0207695_10996135 3300025913 Bacteria 718
35 Ga0207693_10852527 3300025915 Unclassified 701
36 Ga0207663_10000168 3300025916 Bacteria 29560
37 Ga0207665_11177782 3300025939 Unclassified 611
38 Ga0265760_10357970 3300031090 Bacteria 523
39 Ga0265316_10700844 3300031344 Bacteria 714
40 Ga0316575_10000970 3300031665 Bacteria 8844
41 Ga0316575_10014567 3300031665 Bacteria 2954
42 Ga0316575_10100759 3300031665 Bacteria 1174
43 Ga0316575_10187654 3300031665 Unclassified 859
44 Ga0316575_10287491 3300031665 Bacteria 694
45 Ga0316579_10005297 3300031691 Bacteria 5194
46 Ga0316579_10038397 3300031691 Bacteria 2214
47 Ga0316579_10053792 3300031691 Bacteria 1886
48 Ga0316579_10200037 3300031691 Unclassified 966
49 Ga0316579_10230629 3300031691 Bacteria 895
50 Ga0316579_10242892 3300031691 Bacteria 871
51 Ga0316579_10370359 3300031691 Unclassified 693
52 Ga0316579_10518039 3300031691 Unclassified 577
53 Ga0316576_10004712 3300031727 Bacteria 8231
54 Ga0316576_10060280 3300031727 Bacteria 2779
55 Ga0316576_10121993 3300031727 Bacteria 1958
56 Ga0316576_10131991 3300031727 Bacteria 1879
57 Ga0316576_10311056 3300031727 Bacteria 1176
58 Ga0316576_10380099 3300031727 Unclassified 1048
59 Ga0316576_10412949 3300031727 Bacteria 1000
60 Ga0316576_10457997 3300031727 Bacteria 941
61 Ga0316576_10481193 3300031727 Bacteria 915
62 Ga0316578_10005396 3300031728 Bacteria 6194
63 Ga0316578_10019488 3300031728 Bacteria 3735
64 Ga0316578_10045633 3300031728 Unclassified 2551
65 Ga0316578_10202100 3300031728 Bacteria 1196
66 Ga0316578_10273374 3300031728 Bacteria 1012
67 Ga0316578_10388490 3300031728 Bacteria 828
68 Ga0316577_10007674 3300031733 Bacteria 5759
69 Ga0316577_10018099 3300031733 Bacteria 3894
70 Ga0316577_10048891 3300031733 Bacteria 2361
71 Ga0316577_10060203 3300031733 Bacteria 2119
72 Ga0316577_10072583 3300031733 Unclassified 1921
73 Ga0316577_10077751 3300031733 Bacteria 1853
74 Ga0316577_10087907 3300031733 Bacteria 1739
75 Ga0316577_10093855 3300031733 Bacteria 1680
76 Ga0316583_10000533 3300032133 Bacteria 11428
77 Ga0316583_10003223 3300032133 Bacteria 5743
78 Ga0316583_10016210 3300032133 Unclassified 2682
79 Ga0316585_10016999 3300032137 Bacteria 2195
80 Ga0316585_10095156 3300032137 Bacteria 975
81 Ga0316585_10171414 3300032137 Bacteria 717
82 Ga0316585_10207710 3300032137 Bacteria 647
83 Ga0316585_10229499 3300032137 Bacteria 614
84 Ga0316580_10016129 3300032139 Bacteria 2289
85 Ga0316593_10008162 3300032168 Bacteria 2908
86 Ga0316593_10021681 3300032168 Bacteria 2011
87 Ga0316593_10044550 3300032168 Bacteria 1485
88 Ga0316593_10048624 3300032168 Bacteria 1428
89 Ga0316593_10065159 3300032168 Bacteria 1252
90 Ga0316593_10079020 3300032168 Bacteria 1146
91 Ga0316593_10079553 3300032168 Bacteria 1142
92 Ga0316593_10094825 3300032168 Bacteria 1053
93 Ga0316593_10127572 3300032168 Bacteria 916
94 Ga0316593_10129785 3300032168 Bacteria 909
95 Ga0316593_10134666 3300032168 Bacteria 893
96 Ga0316593_10168830 3300032168 Bacteria 801
97 Ga0316593_10262972 3300032168 Unclassified 647
98 Ga0316593_10450598 3300032168 Bacteria 502
99 Ga0316592_1001894 3300033524 Bacteria 3509
100 Ga0316592_1006246 3300033524 Bacteria 2289
101 Ga0316592_1050336 3300033524 Bacteria 930
102 Ga0316592_1136450 3300033524 Bacteria 574
103 Ga0316592_1179276 3300033524 Bacteria 506
104 Ga0316586_1003743 3300033527 Unclassified 2022
105 Ga0316588_1002270 3300033528 Bacteria 3332
106 Ga0316588_1014560 3300033528 Bacteria 1723
107 Ga0316588_1036602 3300033528 Bacteria 1165
108 Ga0316588_1043100 3300033528 Unclassified 1083
109 Ga0316588_1107658 3300033528 Bacteria 700
110 Ga0316588_1144340 3300033528 Bacteria 609
111 Ga0316588_1170192 3300033528 Bacteria 563
112 Ga0316588_1175566 3300033528 Bacteria 555
113 Ga0316587_1111033 3300033529 Bacteria 532
114 Ga0316596_1003879 3300033541 Bacteria 3312
115 Ga0316596_1008891 3300033541 Bacteria 2402
116 Ga0316596_1016976 3300033541 Bacteria 1827
117 Ga0316596_1029084 3300033541 Bacteria 1430
118 Ga0316596_1030672 3300033541 Unclassified 1395
119 Ga0316596_1033782 3300033541 Bacteria 1334
120 Ga0316596_1037038 3300033541 Bacteria 1276
121 Ga0316596_1057777 3300033541 Bacteria 1033
122 Ga0316596_1059478 3300033541 Bacteria 1018
123 Ga0316596_1119854 3300033541 Bacteria 716
124 Ga0316596_1195920 3300033541 Unclassified 561
125 Ga0316596_1216071 3300033541 Bacteria 536
126 Ga0316574_0002148 3300035398 Bacteria 9774
127 Ga0316574_0005690 3300035398 Bacteria 6671
128 Ga0316574_0020815 3300035398 Bacteria 3886
129 Ga0316574_0054456 3300035398 Bacteria 2499
130 Ga0316574_0099968 3300035398 Bacteria 1856
131 Ga0316582_0003226 3300036647 Bacteria 7939
132 Ga0316582_0009166 3300036647 Bacteria 5357
133 Ga0316582_0027574 3300036647 Bacteria 3432
134 Ga0316582_0056238 3300036647 Unclassified 2509
135 Ga0316582_0086406 3300036647 Bacteria 2057
136 Ga0316582_0185620 3300036647 Bacteria 1415
137 Ga0316582_0515706 3300036647 Bacteria 824
138 Ga0316582_0688285 3300036647 Unclassified 702
139 Ga0316584_0006192 3300036712 Bacteria 8097
140 Ga0316584_0007219 3300036712 Bacteria 7581
141 Ga0316584_0012977 3300036712 Bacteria 5885
142 Ga0316584_0013743 3300036712 Bacteria 5739
143 Ga0316584_0021109 3300036712 Bacteria 4728
144 Ga0316584_0043081 3300036712 Bacteria 3365
145 Ga0316584_0054895 3300036712 Bacteria 2983
146 Ga0316584_0387914 3300036712 Bacteria 997
147 Ga0316584_0586273 3300036712 Bacteria 775
148 Ga0316584_0708654 3300036712 Bacteria 689
149 Ga0316584_0891099 3300036712 Bacteria 599
150 Ga0316581_0017019 3300037588 Bacteria 2095
151 Ga0316581_0065058 3300037588 Unclassified 1120
152 Ga0316581_0117848 3300037588 Bacteria 818
153 Ga0316581_0138448 3300037588 Bacteria 750
154 Ga0316581_0208635 3300037588 Bacteria 601
155 Ga0400484_26132 3300038725 Bacteria 3772
156 Ga0400490_42710 3300038726 Bacteria 3239
157 Ga0400490_44059 3300038726 Bacteria 11300
158 Ga0400490_60356 3300038726 Bacteria 41641
159 Ga0400491_20024 3300038727 Bacteria 1352
160 Ga0400485_18090 3300038735 Bacteria 18221
161 Ga0400485_20188 3300038735 Bacteria 8564
162 Ga0400488_02825 3300038741 Unclassified 1637
163 Ga0400488_11546 3300038741 Bacteria 2354
164 Ga0400488_11821 3300038741 Bacteria 2624
165 Ga0400488_29202 3300038741 Bacteria 1033
166 Ga0400488_39688 3300038741 Bacteria 20560
167 Ga0400486_09877 3300038742 Unclassified 3175
168 Ga0400486_18506 3300038742 Bacteria 13436
169 Ga0400486_24144 3300038742 Bacteria 114817
170 Ga0400486_24273 3300038742 Bacteria 4084
171 Ga0400483_048228 3300039062 Bacteria 1010
172 Ga0400483_053197 3300039062 Bacteria 1224
173 Ga0400483_082421 3300039062 Bacteria 22526
174 Ga0400483_082577 3300039062 Bacteria 7340
175 Ga0400483_116445 3300039062 Bacteria 78991
176 Ga0400483_188636 3300039062 Bacteria 2793
177 Ga0400483_245555 3300039062 Unclassified 1480
178 Ga0400483_249476 3300039062 Bacteria 40072
179 Ga0400483_281320 3300039062 Bacteria 1701
180 Ga0400489_41187 3300039093 Bacteria 53371
181 Ga0400489_55736 3300039093 Bacteria 1068
182 Ga0400489_56070 3300039093 Bacteria 7030
183 Ga0400487_09496 3300039110 Bacteria 2943
184 Ga0400487_26004 3300039110 Bacteria 6472
185 Ga0451577_0000035 3300042876 Bacteria 373467
186 Ga0451577_0000398 3300042876 Bacteria 79644
187 Ga0451577_0010923 3300042876 Bacteria 8628
188 Ga0451577_0023390 3300042876 Bacteria 5637
189 Ga0451577_0054487 3300042876 Bacteria 3570
190 Ga0451577_0197401 3300042876 Bacteria 1816
191 Ga0451577_0827730 3300042876 Bacteria 835
192 Ga0453683_0000014 3300044673 Bacteria 364381
193 Ga0453683_0000068 3300044673 Bacteria 164042
194 Ga0453683_0016007 3300044673 Bacteria 4845
195 Ga0453683_0138037 3300044673 Bacteria 1538
196 Ga0453683_0361370 3300044673 Bacteria 933
197 Ga0453683_0477165 3300044673 Bacteria 808
198 Ga0453683_0784746 3300044673 Bacteria 627
199 Ga0453684_0000097 3300044712 Bacteria 377772
200 Ga0453684_0001180 3300044712 Bacteria 80973
201 Ga0453684_0001583 3300044712 Bacteria 62833
202 Ga0453684_0006292 3300044712 Bacteria 22714
203 Ga0453684_0011865 3300044712 Bacteria 14512
204 Ga0453684_0213891 3300044712 Unclassified 2238
205 Ga0453684_0229647 3300044712 Bacteria 2143
206 Ga0453684_0434422 3300044712 Bacteria 1464
207 Ga0453684_0783748 3300044712 Bacteria 1029
208 Ga0451576_0036577 3300045051 Bacteria 5203
209 Ga0451576_0048535 3300045051 Bacteria 4458
210 Ga0451576_0057496 3300045051 Bacteria 4066
211 Ga0451576_0134921 3300045051 Unclassified 2574
212 Ga0451576_0155341 3300045051 Unclassified 2387
213 Ga0501036_1259526 3300049572 Bacteria 602
214 Ga0501043_1199342 3300049579 Unclassified 533
215 Ga0501048_0355539 3300049582 Bacteria 1045
216 Ga0501071_0129045 3300049587 Unclassified 1878
217 Ga0501075_0200327 3300049591 Bacteria 1523
218 nmdc:mga05p37_241988_c1 3300050507 Bacteria 2169
219 nmdc:mga05p37_3865_c1 3300050507 Bacteria 17523
220 nmdc:mga06r32_150243_c1 3300050510 Unclassified 2307
221 nmdc:mga08x19_421_c1 3300050514 Bacteria 29460
222 nmdc:mga08x19_97387_c1 3300050514 Bacteria 1948
223 Ga0501084_0536744 3300054114 Unclassified 989
224 Ga0530510_0331675 3300061734 Bacteria 1141
225 Ga0453683_0156110
226 Ga0070690_100120810
227 Ga0070713_100550869
228 Ga0070711_100000230
229 Ga0070694_100147440
230 Ga0070694_101192777
231 Ga0070706_100141684
232 Ga0070686_100052159
233 Ga0070704_100516462
234 Ga0081538_10050045
235 Ga0075364_10415905
236 Ga0070715_10072678
237 Ga0075428_100992078
238 Ga0075431_100199222
239 Ga0075433_10783893
240 Ga0075434_100823652
241 Ga0075429_100977163
242 Ga0075436_100000350
243 Ga0075436_100016972
244 Ga0075435_100099873
245 Ga0075435_101248199
246 Ga0105240_10818120
247 Ga0114129_10019891
248 Ga0114129_10231073
249 Ga0105241_10590788
250 Ga0105241_11034523
251 Ga0105238_10856048
252 Ga0157370_10006835
253 Ga0157378_10504684
254 Ga0157378_10733551
255 Ga0163163_10452868
256 Ga0154015_1496968
257 Ga0207654_10652390
258 Ga0207695_10996135
259 Ga0207693_10852527
260 Ga0207663_10000168
261 Ga0207665_11177782
262 Ga0265760_10357970
263 Ga0265316_10700844
264 Ga0316575_10000970
265 Ga0316575_10014567
266 Ga0316575_10100759
267 Ga0316575_10187654
268 Ga0316575_10287491
269 Ga0316579_10005297
270 Ga0316579_10038397
271 Ga0316579_10053792
272 Ga0316579_10200037
273 Ga0316579_10230629
274 Ga0316579_10242892
275 Ga0316579_10370359
276 Ga0316579_10518039
277 Ga0316576_10004712
278 Ga0316576_10060280
279 Ga0316576_10121993
280 Ga0316576_10131991
281 Ga0316576_10311056
282 Ga0316576_10380099
283 Ga0316576_10412949
284 Ga0316576_10457997
285 Ga0316576_10481193
286 Ga0316578_10005396
287 Ga0316578_10019488
288 Ga0316578_10045633
289 Ga0316578_10202100
290 Ga0316578_10273374
291 Ga0316578_10388490
292 Ga0316577_10007674
293 Ga0316577_10018099
294 Ga0316577_10048891
295 Ga0316577_10060203
296 Ga0316577_10072583
297 Ga0316577_10077751
298 Ga0316577_10087907
299 Ga0316577_10093855
300 Ga0316583_10000533
301 Ga0316583_10003223
302 Ga0316583_10016210
303 Ga0316585_10016999
304 Ga0316585_10095156
305 Ga0316585_10171414
306 Ga0316585_10207710
307 Ga0316585_10229499
308 Ga0316580_10016129
309 Ga0316593_10008162
310 Ga0316593_10021681
311 Ga0316593_10044550
312 Ga0316593_10048624
313 Ga0316593_10065159
314 Ga0316593_10079020
315 Ga0316593_10079553
316 Ga0316593_10094825
317 Ga0316593_10127572
318 Ga0316593_10129785
319 Ga0316593_10134666
320 Ga0316593_10168830
321 Ga0316593_10262972
322 Ga0316593_10450598
323 Ga0316592_1001894
324 Ga0316592_1006246
325 Ga0316592_1050336
326 Ga0316592_1136450
327 Ga0316592_1179276
328 Ga0316586_1003743
329 Ga0316588_1002270
330 Ga0316588_1014560
331 Ga0316588_1036602
332 Ga0316588_1043100
333 Ga0316588_1107658
334 Ga0316588_1144340
335 Ga0316588_1170192
336 Ga0316588_1175566
337 Ga0316587_1111033
338 Ga0316596_1003879
339 Ga0316596_1008891
340 Ga0316596_1016976
341 Ga0316596_1029084
342 Ga0316596_1030672
343 Ga0316596_1033782
344 Ga0316596_1037038
345 Ga0316596_1057777
346 Ga0316596_1059478
347 Ga0316596_1119854
348 Ga0316596_1195920
349 Ga0316596_1216071
350 Ga0316574_0002148
351 Ga0316574_0005690
352 Ga0316574_0020815
353 Ga0316574_0054456
354 Ga0316574_0099968
355 Ga0316582_0003226
356 Ga0316582_0009166
357 Ga0316582_0027574
358 Ga0316582_0056238
359 Ga0316582_0086406
360 Ga0316582_0185620
361 Ga0316582_0515706
362 Ga0316582_0688285
363 Ga0316584_0006192
364 Ga0316584_0007219
365 Ga0316584_0012977
366 Ga0316584_0013743
367 Ga0316584_0021109
368 Ga0316584_0043081
369 Ga0316584_0054895
370 Ga0316584_0387914
371 Ga0316584_0586273
372 Ga0316584_0708654
373 Ga0316584_0891099
374 Ga0316581_0017019
375 Ga0316581_0065058
376 Ga0316581_0117848
377 Ga0316581_0138448
378 Ga0316581_0208635
379 Ga0400484_26132
380 Ga0400490_42710
381 Ga0400490_44059
382 Ga0400490_60356
383 Ga0400491_20024
384 Ga0400485_18090
385 Ga0400485_20188
386 Ga0400488_02825
387 Ga0400488_11546
388 Ga0400488_11821
389 Ga0400488_29202
390 Ga0400488_39688
391 Ga0400486_09877
392 Ga0400486_18506
393 Ga0400486_24144
394 Ga0400486_24273
395 Ga0400483_048228
396 Ga0400483_053197
397 Ga0400483_082421
398 Ga0400483_082577
399 Ga0400483_116445
400 Ga0400483_188636
401 Ga0400483_245555
402 Ga0400483_249476
403 Ga0400483_281320
404 Ga0400489_41187
405 Ga0400489_55736
406 Ga0400489_56070
407 Ga0400487_09496
408 Ga0400487_26004
409 Ga0451577_0000035
410 Ga0451577_0000398
411 Ga0451577_0010923
412 Ga0451577_0023390
413 Ga0451577_0054487
414 Ga0451577_0197401
415 Ga0451577_0827730
416 Ga0453683_0000014
417 Ga0453683_0000068
418 Ga0453683_0016007
419 Ga0453683_0138037
420 Ga0453683_0361370
421 Ga0453683_0477165
422 Ga0453683_0784746
423 Ga0453684_0000097
424 Ga0453684_0001180
425 Ga0453684_0001583
426 Ga0453684_0006292
427 Ga0453684_0011865
428 Ga0453684_0213891
429 Ga0453684_0229647
430 Ga0453684_0434422
431 Ga0453684_0783748
432 Ga0451576_0036577
433 Ga0451576_0048535
434 Ga0451576_0057496
435 Ga0451576_0134921
436 Ga0451576_0155341
437 Ga0501036_1259526
438 Ga0501043_1199342
439 Ga0501048_0355539
440 Ga0501071_0129045
441 Ga0501075_0200327
442 nmdc:mga05p37_241988_c1
443 nmdc:mga05p37_3865_c1
444 nmdc:mga06r32_150243_c1
445 nmdc:mga08x19_421_c1
446 nmdc:mga08x19_97387_c1
447 Ga0501084_0536744
448 Ga0530510_0331675

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01245

Ribosomal_L19

Ribosomal protein L19

3

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sj6-assembly1.cif.gz_S cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.8869 1 100
6ppf-assembly1.cif.gz_P bacterial 45srbga ribosomal particle class b 0.8815 2 104
6ppf-assembly1.cif.gz_P bacterial 45srbga ribosomal particle class b 0.8735 2 104
5dm7-assembly1.cif.gz_M crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.8706 1 102
6pvk-assembly1.cif.gz_P bacterial 45srbga ribosomal particle class a 0.8677 2 104
ID Description Score Start End Superfamily
af_I1N0B6_91_236_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.8402 4 102 2.30.30.790
af_P9WHC9_4_113_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.8301 6 114 2.30.30.790
af_P9WHC9_4_113_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.8157 6 114 2.30.30.790
af_Q8W463_117_224_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.8132 2 101 2.30.30.790
af_C0P2I3_122_238_2.30.30.790 Mainly Beta;Roll;SH3 type barrels.; 0.8086 4 105 2.30.30.790
ID Description Score Start End GO Terms
AF-A0A1Q7S5A4-F1-model_v4 50S ribosomal protein L19 0.9855 3 91 GO:0003735
GO:0006412
GO:0022625
AF-A0A7C0Y7D4-F1-model_v4 50S ribosomal protein L19 0.9662 3 90 GO:0003735
GO:0006412
GO:0022625
AF-A0A7Y2P8R7-F1-model_v4 50S ribosomal protein L19 0.9655 1 89 GO:0003735
GO:0006412
GO:0022625
AF-A0A1Q7S5A4-F1-model_v4 50S ribosomal protein L19 0.9641 3 91 GO:0003735
GO:0006412
GO:0022625
AF-A0A2X1PMP6-F1-model_v4 50S ribosomal protein L19 0.9558 1 95 GO:0003735
GO:0006412
GO:0022625

Map