F336961

General Info

Members Datasets Scaffolds Average Seq Length
224 161 448 135

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0718371|Ga0395899_0718371_134_568
Length 132
Sequence VTDTPSPDNRSTDRPTVLFVCVHNAGRSQMAAGYLQHLAGDRIDVLSAGSQPAEQVNRVAVQAMAEEGIDIVQASDVVITMGCGDECPYFPGKRYEDWQLDDPAGQGIDAVRPIRDEIRRRVERLIDELLPA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
96 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
152 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
153 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 2643221576 Nocardioides sp. Root614 Isolate Unclassified
156 2643221590 Nocardioides sp. Root682 Isolate Unclassified
157 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
158 2738541305 Nocardioides sp. CF167 Isolate Unclassified
159 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
160 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
161 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 0.89
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.54
Nodule 0
Rhizoplane 7.59
Rhizosphere 63.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0718371 3300037312 Bacteria 625
2 JGI25160J50197_1075149 3300003354 Bacteria 637
3 Ga0006562J51391_1102668 3300003578 Bacteria 2020
4 Ga0006562J51391_1102670 3300003578 Bacteria 980
5 Ga0070658_10005971 3300005327 Bacteria 9873
6 Ga0070683_100003971 3300005329 Bacteria 12112
7 Ga0070690_100112521 3300005330 Bacteria 1818
8 Ga0068869_100215101 3300005334 Bacteria 1521
9 Ga0070682_100023807 3300005337 Bacteria 3639
10 Ga0070660_101682844 3300005339 Bacteria 540
11 Ga0070687_100124917 3300005343 Bacteria 1477
12 Ga0070692_10017618 3300005345 Bacteria 3419
13 Ga0070668_101988947 3300005347 Bacteria 536
14 Ga0070675_102010334 3300005354 Bacteria 533
15 Ga0070671_100854332 3300005355 Bacteria 794
16 Ga0070674_101470293 3300005356 Bacteria 612
17 Ga0070659_100051493 3300005366 Bacteria 3238
18 Ga0070667_100153367 3300005367 Bacteria 2025
19 Ga0070701_10346266 3300005438 Bacteria 927
20 Ga0070708_100338843 3300005445 Bacteria 1417
21 Ga0070708_101352086 3300005445 Bacteria 665
22 Ga0070662_100626745 3300005457 Bacteria 906
23 Ga0070707_100037644 3300005468 Bacteria 4618
24 Ga0070707_101470560 3300005468 Bacteria 648
25 Ga0070698_100003907 3300005471 Bacteria 16389
26 Ga0070684_100013360 3300005535 Bacteria 6617
27 Ga0070684_100356911 3300005535 Bacteria 1345
28 Ga0070665_101448016 3300005548 Bacteria 696
29 Ga0070704_100722886 3300005549 Bacteria 885
30 Ga0070664_100023874 3300005564 Bacteria 5052
31 Ga0068857_100041115 3300005577 Bacteria 4099
32 Ga0070702_100260175 3300005615 Bacteria 1181
33 Ga0070702_100662221 3300005615 Bacteria 791
34 Ga0068852_100652372 3300005616 Bacteria 1060
35 Ga0068852_100707021 3300005616 Bacteria 1018
36 Ga0068852_101885256 3300005616 Bacteria 620
37 Ga0068864_100196008 3300005618 Bacteria 1853
38 Ga0068866_10043685 3300005718 Bacteria 2238
39 Ga0068851_10125770 3300005834 Bacteria 1382
40 Ga0068860_100000331 3300005843 Bacteria 64294
41 Ga0068860_100981970 3300005843 Bacteria 862
42 Ga0081539_10016361 3300005985 Bacteria 5304
43 Ga0075365_10008215 3300006038 Bacteria 5907
44 Ga0075365_10034025 3300006038 Bacteria 3288
45 Ga0075365_10131424 3300006038 Bacteria 1732
46 Ga0075365_10222689 3300006038 Bacteria 1324
47 Ga0075365_10275888 3300006038 Bacteria 1183
48 Ga0075365_10443525 3300006038 Bacteria 917
49 Ga0075365_10501804 3300006038 Bacteria 857
50 Ga0075365_10784774 3300006038 Bacteria 672
51 Ga0075368_10000076 3300006042 Bacteria 23743
52 Ga0075363_100010860 3300006048 Bacteria 4344
53 Ga0075363_100015172 3300006048 Bacteria 3781
54 Ga0075363_100183709 3300006048 Bacteria 1191
55 Ga0075363_101031312 3300006048 Bacteria 508
56 Ga0075364_10025853 3300006051 Bacteria 3740
57 Ga0075364_10154169 3300006051 Bacteria 1549
58 Ga0075364_10162717 3300006051 Bacteria 1507
59 Ga0075362_10188291 3300006177 Bacteria 1002
60 Ga0075367_10000503 3300006178 Bacteria 14710
61 Ga0075367_10054320 3300006178 Bacteria 2375
62 Ga0075367_10402354 3300006178 Bacteria 866
63 Ga0075369_10475294 3300006186 Bacteria 593
64 Ga0075370_10017993 3300006353 Bacteria 3827
65 Ga0075370_10060493 3300006353 Bacteria 2158
66 Ga0068871_100807599 3300006358 Bacteria 865
67 Ga0075434_100198034 3300006871 Bacteria 2028
68 Ga0075434_101153441 3300006871 Bacteria 787
69 Ga0068865_100082239 3300006881 Bacteria 2315
70 Ga0075436_100769983 3300006914 Bacteria 715
71 Ga0111539_13498156 3300009094 Bacteria 504
72 Ga0105245_10003252 3300009098 Bacteria 14568
73 Ga0105248_12181482 3300009177 Bacteria 630
74 Ga0105237_10169285 3300009545 Bacteria 2184
75 Ga0105237_10640357 3300009545 Bacteria 1070
76 Ga0105238_10563869 3300009551 Bacteria 1144
77 Ga0105239_10009770 3300010375 Bacteria 10784
78 Ga0105246_10066428 3300011119 Bacteria 2525
79 Ga0157369_10015384 3300013105 Bacteria 8626
80 Ga0157369_10134290 3300013105 Bacteria 2620
81 Ga0163162_10045982 3300013306 Bacteria 4375
82 Ga0163162_11859886 3300013306 Bacteria 689
83 Ga0157372_10035687 3300013307 Bacteria 5475
84 Ga0157372_10039155 3300013307 Bacteria 5233
85 Ga0157375_10041262 3300013308 Bacteria 4454
86 Ga0157375_10045090 3300013308 Bacteria 4290
87 Ga0163163_10058283 3300014325 Bacteria 3818
88 Ga0163163_10768252 3300014325 Bacteria 1027
89 Ga0157376_10518021 3300014969 Bacteria 1175
90 Ga0157376_12849298 3300014969 Bacteria 523
91 Ga0163161_10238283 3300017792 Bacteria 1414
92 Ga0163161_11145911 3300017792 Bacteria 670
93 Ga0207426_1014428 3300025302 Bacteria 2895
94 Ga0207642_10160856 3300025899 Bacteria 1205
95 Ga0207647_10051669 3300025904 Bacteria 2539
96 Ga0207671_10072592 3300025914 Bacteria 2569
97 Ga0207671_10406299 3300025914 Bacteria 1083
98 Ga0207662_10107397 3300025918 Bacteria 1737
99 Ga0207657_10134665 3300025919 Bacteria 2023
100 Ga0207646_10087549 3300025922 Bacteria 2787
101 Ga0207644_10857295 3300025931 Bacteria 761
102 Ga0207709_11241356 3300025935 Bacteria 615
103 Ga0207689_10218292 3300025942 Bacteria 1575
104 Ga0207658_10577103 3300025986 Bacteria 1008
105 Ga0207677_10245383 3300026023 Bacteria 1451
106 Ga0207678_11506215 3300026067 Bacteria 594
107 Ga0207702_10079855 3300026078 Bacteria 2837
108 Ga0207676_10005643 3300026095 Bacteria 8857
109 Ga0207674_10025496 3300026116 Bacteria 6304
110 Ga0207683_10059963 3300026121 Bacteria 3344
111 Ga0207698_11253129 3300026142 Bacteria 756
112 Ga0209813_10000988 3300027866 Bacteria 6376
113 Ga0268266_11184134 3300028379 Bacteria 739
114 Ga0268264_10000193 3300028381 Bacteria 126247
115 Ga0268264_10710544 3300028381 Bacteria 999
116 Ga0316182_1155519 3300030745 Bacteria 2597
117 Ga0307408_101430360 3300031548 Bacteria 652
118 Ga0307408_101778834 3300031548 Bacteria 589
119 Ga0307416_103264161 3300032002 Bacteria 543
120 Ga0307411_10015845 3300032005 Bacteria 4248
121 Ga0307415_100202483 3300032126 Bacteria 1576
122 Ga0307415_100640272 3300032126 Bacteria 952
123 Ga0316574_0039878 3300035398 Bacteria 2890
124 Ga0316574_0258102 3300035398 Bacteria 1113
125 Ga0395899_0302066 3300037312 Bacteria 1083
126 Ga0395900_0025938 3300037418 Bacteria 6001
127 Ga0395900_0295074 3300037418 Bacteria 1609
128 Ga0395898_0072017 3300037466 Bacteria 3339
129 Ga0395905_1237616 3300037471 Bacteria 650
130 Ga0436364_0427795 3300037853 Bacteria 837
131 Ga0395901_0048234 3300038443 Bacteria 4422
132 Ga0395901_0087010 3300038443 Bacteria 3267
133 Ga0451807_2428164 3300041486 Bacteria 1062
134 Ga0451853_0162579 3300041512 Bacteria 2472
135 Ga0439431_0014959 3300041997 Bacteria 1803
136 Ga0439445_0002794 3300042004 Bacteria 3897
137 Ga0439434_0027967 3300042435 Bacteria 1707
138 Ga0466965_0306317 3300044683 Bacteria 863
139 Ga0466965_0548339 3300044683 Bacteria 653
140 Ga0466965_0649543 3300044683 Bacteria 602
141 Ga0466965_0717438 3300044683 Bacteria 574
142 Ga0466966_0215262 3300044684 Bacteria 1161
143 Ga0466963_0093529 3300044694 Bacteria 2050
144 Ga0466963_0392174 3300044694 Bacteria 979
145 Ga0466970_0853699 3300044765 Bacteria 534
146 Ga0466960_0044122 3300044901 Bacteria 2124
147 Ga0466959_0428248 3300045049 Bacteria 898
148 Ga0466967_0857608 3300045976 Bacteria 903
149 Ga0496101_0005019 3300048904 Bacteria 8411
150 Ga0496102_0065343 3300048905 Bacteria 3334
151 Ga0496103_0072287 3300048906 Bacteria 2160
152 Ga0496104_0418243 3300048907 Bacteria 1252
153 Ga0496105_0100556 3300048908 Bacteria 2388
154 Ga0496107_0011107 3300048910 Bacteria 6265
155 Ga0496108_0056365 3300048911 Bacteria 3302
156 Ga0496109_1095791 3300048912 Bacteria 733
157 Ga0496110_0124105 3300048913 Bacteria 2329
158 Ga0496111_0010637 3300048914 Bacteria 6184
159 Ga0496111_0073164 3300048914 Bacteria 2495
160 Ga0496112_0087977 3300048915 Bacteria 3074
161 Ga0496113_0033135 3300048916 Bacteria 3759
162 Ga0496114_0050307 3300048917 Bacteria 3468
163 Ga0496114_0097927 3300048917 Bacteria 2499
164 Ga0496114_0319152 3300048917 Bacteria 1372
165 Ga0496117_0000255 3300048920 Bacteria 100069
166 Ga0496118_0003443 3300048921 Bacteria 19918
167 Ga0496120_0038338 3300048923 Bacteria 2836
168 Ga0496120_0323389 3300048923 Bacteria 700
169 Ga0496122_0021433 3300048925 Bacteria 5786
170 Ga0496123_0027556 3300048926 Bacteria 4229
171 Ga0496125_0000061 3300048928 Bacteria 262739
172 Ga0501033_0165088 3300049570 Bacteria 1592
173 Ga0501034_0205622 3300049571 Bacteria 1925
174 Ga0501034_0756651 3300049571 Bacteria 867
175 Ga0501034_0952151 3300049571 Bacteria 744
176 Ga0501036_0003946 3300049572 Bacteria 11922
177 Ga0501037_0016705 3300049573 Bacteria 5400
178 Ga0501038_0015505 3300049574 Bacteria 6928
179 Ga0501039_0001112 3300049575 Bacteria 19777
180 Ga0501042_0008505 3300049578 Bacteria 6779
181 Ga0501043_0003518 3300049579 Bacteria 12884
182 Ga0501046_0007529 3300049580 Bacteria 9550
183 Ga0501047_0020862 3300049581 Bacteria 6293
184 Ga0501048_0020274 3300049582 Bacteria 4872
185 Ga0501070_0028756 3300049586 Bacteria 4660
186 Ga0501070_0569368 3300049586 Bacteria 905
187 Ga0501073_0087387 3300049589 Bacteria 2168
188 Ga0501223_034949 3300049663 Bacteria 978
189 Ga0501080_0038404 3300049742 Bacteria 4470
190 Ga0501035_0017094 3300049822 Bacteria 6683
191 Ga0501044_0083569 3300049823 Bacteria 3228
192 Ga0501212_045196 3300049851 Bacteria 736
193 nmdc:mga03n38_234349_c1 3300050490 Bacteria 963
194 nmdc:mga03n38_253416_c1 3300050490 Bacteria 930
195 nmdc:mga03n38_352994_c1 3300050490 Bacteria 800
196 nmdc:mga03n38_5840_c2 3300050490 Bacteria 3786
197 nmdc:mga03n38_81785_c1 3300050490 Bacteria 1519
198 nmdc:mga00v17_142541_c1 3300050491 Bacteria 1537
199 nmdc:mga00v17_429827_c1 3300050491 Bacteria 858
200 nmdc:mga00v17_45183_c1 3300050491 Bacteria 2660
201 nmdc:mga0yw44_172802_c1 3300050492 Bacteria 1419
202 nmdc:mga0yw44_480485_c1 3300050492 Bacteria 843
203 nmdc:mga0yw44_50668_c1 3300050492 Bacteria 2511
204 nmdc:mga0yw44_6463_c1 3300050492 Bacteria 5670
205 nmdc:mga06z11_3161_c1 3300050494 Bacteria 6357
206 nmdc:mga06z11_378253_c1 3300050494 Bacteria 850
207 nmdc:mga06z11_855499_c1 3300050494 Bacteria 554
208 nmdc:mga06z11_881989_c1 3300050494 Bacteria 545
209 nmdc:mga04h51_1768_c1 3300050495 Bacteria 5054
210 nmdc:mga07m45_35048_c1 3300050496 Bacteria 2791
211 nmdc:mga08y16_1417555_c1 3300050511 Bacteria 657
212 nmdc:mga0n895_154909_c1 3300050512 Bacteria 2322
213 nmdc:mga0rr50_979560_c1 3300050513 Bacteria 721
214 Ga0495655_0278284 3300053083 Bacteria 570
215 Ga0500554_019599 3300053102 Bacteria 1846
216 Ga0500593_000869 3300053117 Bacteria 11244
217 Ga0501082_0544696 3300060353 Bacteria 1015
218 2643889249 2643221576 Bacteria 5214352
219 2643958304 2643221590 Bacteria 5214697
220 2644197216 2643221635 Bacteria 2632343
221 2738868618 2738541305 Bacteria 4910150
222 2774400464 2773857763 Bacteria 4180068
223 2812330296 2811994874 Bacteria 5367947
224 2977252940 2977251589 Bacteria 2952848
225 Ga0395899_0718371
226 JGI25160J50197_1075149
227 Ga0006562J51391_1102668
228 Ga0006562J51391_1102670
229 Ga0070658_10005971
230 Ga0070683_100003971
231 Ga0070690_100112521
232 Ga0068869_100215101
233 Ga0070682_100023807
234 Ga0070660_101682844
235 Ga0070687_100124917
236 Ga0070692_10017618
237 Ga0070668_101988947
238 Ga0070675_102010334
239 Ga0070671_100854332
240 Ga0070674_101470293
241 Ga0070659_100051493
242 Ga0070667_100153367
243 Ga0070701_10346266
244 Ga0070708_100338843
245 Ga0070708_101352086
246 Ga0070662_100626745
247 Ga0070707_100037644
248 Ga0070707_101470560
249 Ga0070698_100003907
250 Ga0070684_100013360
251 Ga0070684_100356911
252 Ga0070665_101448016
253 Ga0070704_100722886
254 Ga0070664_100023874
255 Ga0068857_100041115
256 Ga0070702_100260175
257 Ga0070702_100662221
258 Ga0068852_100652372
259 Ga0068852_100707021
260 Ga0068852_101885256
261 Ga0068864_100196008
262 Ga0068866_10043685
263 Ga0068851_10125770
264 Ga0068860_100000331
265 Ga0068860_100981970
266 Ga0081539_10016361
267 Ga0075365_10008215
268 Ga0075365_10034025
269 Ga0075365_10131424
270 Ga0075365_10222689
271 Ga0075365_10275888
272 Ga0075365_10443525
273 Ga0075365_10501804
274 Ga0075365_10784774
275 Ga0075368_10000076
276 Ga0075363_100010860
277 Ga0075363_100015172
278 Ga0075363_100183709
279 Ga0075363_101031312
280 Ga0075364_10025853
281 Ga0075364_10154169
282 Ga0075364_10162717
283 Ga0075362_10188291
284 Ga0075367_10000503
285 Ga0075367_10054320
286 Ga0075367_10402354
287 Ga0075369_10475294
288 Ga0075370_10017993
289 Ga0075370_10060493
290 Ga0068871_100807599
291 Ga0075434_100198034
292 Ga0075434_101153441
293 Ga0068865_100082239
294 Ga0075436_100769983
295 Ga0111539_13498156
296 Ga0105245_10003252
297 Ga0105248_12181482
298 Ga0105237_10169285
299 Ga0105237_10640357
300 Ga0105238_10563869
301 Ga0105239_10009770
302 Ga0105246_10066428
303 Ga0157369_10015384
304 Ga0157369_10134290
305 Ga0163162_10045982
306 Ga0163162_11859886
307 Ga0157372_10035687
308 Ga0157372_10039155
309 Ga0157375_10041262
310 Ga0157375_10045090
311 Ga0163163_10058283
312 Ga0163163_10768252
313 Ga0157376_10518021
314 Ga0157376_12849298
315 Ga0163161_10238283
316 Ga0163161_11145911
317 Ga0207426_1014428
318 Ga0207642_10160856
319 Ga0207647_10051669
320 Ga0207671_10072592
321 Ga0207671_10406299
322 Ga0207662_10107397
323 Ga0207657_10134665
324 Ga0207646_10087549
325 Ga0207644_10857295
326 Ga0207709_11241356
327 Ga0207689_10218292
328 Ga0207658_10577103
329 Ga0207677_10245383
330 Ga0207678_11506215
331 Ga0207702_10079855
332 Ga0207676_10005643
333 Ga0207674_10025496
334 Ga0207683_10059963
335 Ga0207698_11253129
336 Ga0209813_10000988
337 Ga0268266_11184134
338 Ga0268264_10000193
339 Ga0268264_10710544
340 Ga0316182_1155519
341 Ga0307408_101430360
342 Ga0307408_101778834
343 Ga0307416_103264161
344 Ga0307411_10015845
345 Ga0307415_100202483
346 Ga0307415_100640272
347 Ga0316574_0039878
348 Ga0316574_0258102
349 Ga0395899_0302066
350 Ga0395900_0025938
351 Ga0395900_0295074
352 Ga0395898_0072017
353 Ga0395905_1237616
354 Ga0436364_0427795
355 Ga0395901_0048234
356 Ga0395901_0087010
357 Ga0451807_2428164
358 Ga0451853_0162579
359 Ga0439431_0014959
360 Ga0439445_0002794
361 Ga0439434_0027967
362 Ga0466965_0306317
363 Ga0466965_0548339
364 Ga0466965_0649543
365 Ga0466965_0717438
366 Ga0466966_0215262
367 Ga0466963_0093529
368 Ga0466963_0392174
369 Ga0466970_0853699
370 Ga0466960_0044122
371 Ga0466959_0428248
372 Ga0466967_0857608
373 Ga0496101_0005019
374 Ga0496102_0065343
375 Ga0496103_0072287
376 Ga0496104_0418243
377 Ga0496105_0100556
378 Ga0496107_0011107
379 Ga0496108_0056365
380 Ga0496109_1095791
381 Ga0496110_0124105
382 Ga0496111_0010637
383 Ga0496111_0073164
384 Ga0496112_0087977
385 Ga0496113_0033135
386 Ga0496114_0050307
387 Ga0496114_0097927
388 Ga0496114_0319152
389 Ga0496117_0000255
390 Ga0496118_0003443
391 Ga0496120_0038338
392 Ga0496120_0323389
393 Ga0496122_0021433
394 Ga0496123_0027556
395 Ga0496125_0000061
396 Ga0501033_0165088
397 Ga0501034_0205622
398 Ga0501034_0756651
399 Ga0501034_0952151
400 Ga0501036_0003946
401 Ga0501037_0016705
402 Ga0501038_0015505
403 Ga0501039_0001112
404 Ga0501042_0008505
405 Ga0501043_0003518
406 Ga0501046_0007529
407 Ga0501047_0020862
408 Ga0501048_0020274
409 Ga0501070_0028756
410 Ga0501070_0569368
411 Ga0501073_0087387
412 Ga0501223_034949
413 Ga0501080_0038404
414 Ga0501035_0017094
415 Ga0501044_0083569
416 Ga0501212_045196
417 nmdc:mga03n38_234349_c1
418 nmdc:mga03n38_253416_c1
419 nmdc:mga03n38_352994_c1
420 nmdc:mga03n38_5840_c2
421 nmdc:mga03n38_81785_c1
422 nmdc:mga00v17_142541_c1
423 nmdc:mga00v17_429827_c1
424 nmdc:mga00v17_45183_c1
425 nmdc:mga0yw44_172802_c1
426 nmdc:mga0yw44_480485_c1
427 nmdc:mga0yw44_50668_c1
428 nmdc:mga0yw44_6463_c1
429 nmdc:mga06z11_3161_c1
430 nmdc:mga06z11_378253_c1
431 nmdc:mga06z11_855499_c1
432 nmdc:mga06z11_881989_c1
433 nmdc:mga04h51_1768_c1
434 nmdc:mga07m45_35048_c1
435 nmdc:mga08y16_1417555_c1
436 nmdc:mga0n895_154909_c1
437 nmdc:mga0rr50_979560_c1
438 Ga0495655_0278284
439 Ga0500554_019599
440 Ga0500593_000869
441 Ga0501082_0544696
442 2643889249
443 2643958304
444 2644197216
445 2738868618
446 2774400464
447 2812330296
448 2977252940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

17

126

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t38-assembly1.cif.gz_B corynebacterium glutamicum thioredoxin-dependent arsenate reductase cg_arsc1' 0.9575 2 128
3t38-assembly1.cif.gz_A corynebacterium glutamicum thioredoxin-dependent arsenate reductase cg_arsc1' 0.9358 2 128
2fxi-assembly1.cif.gz_A arsenate reductase (arsc from pi258) c10s/c15a double mutant with sulfate in its active site 0.923 2 122
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.9205 2 121
2cd7-assembly1.cif.gz_A staphylococcus aureus pi258 arsenate reductase (arsc) h62q mutant 0.9182 2 122
ID Description Score Start End Superfamily
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9918 2 128 3.40.50.2300
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9545 2 128 3.40.50.2300
3t38B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9526 2 128 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9126 2 123 3.40.50.2300
3t38B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8988 2 128 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4R5EHX5-F1-model_v4 Arsenate reductase ArsC 1.005 2 127 GO:0046685
AF-A0A7K2VT40-F1-model_v4 Phosphotyrosine protein phosphatase 1.004 2 124 GO:0046685
AF-A0A222T0L0-F1-model_v4 Phosphotyrosine protein phosphatase 1.003 2 121 GO:0046685
AF-A0A1Q9SQB6-F1-model_v4 deleted 1.003 2 125
AF-A0A4R3BQN4-F1-model_v4 deleted 1.002 2 124

Map