F336901

General Info

Members Datasets Scaffolds Average Seq Length
224 138 448 121

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10039334|Ga0307406_100393344
Length 133
Sequence MTQPSQPQPRDAQSIRTGSDLVPAARRAGENVVAAVRGEIDLHNSPELRNVLLNTLLGDANALPNRLVLNLEQVPYMDSSAIAVLVESLRKVQRGGGKIYLTNLQPRVKGLLEIARLNAIFVIVASEEEALKK

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.45
Rhizosphere 99.11
Stem 0
Stem Tuber 0
Unclassified 37.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10039334 3300031901 Bacteria 2934
2 Ga0065712_10434150 3300005290 Unclassified 700
3 Ga0070676_10437201 3300005328 Unclassified 917
4 Ga0070683_100079838 3300005329 Bacteria 3062
5 Ga0070683_100199328 3300005329 Bacteria 1901
6 Ga0070683_100680360 3300005329 Bacteria 985
7 Ga0070670_101247026 3300005331 Unclassified 680
8 Ga0070666_10120142 3300005335 Bacteria 1822
9 Ga0070687_100517077 3300005343 Bacteria 806
10 Ga0070661_100176037 3300005344 Unclassified 1626
11 Ga0070668_101129201 3300005347 Bacteria 708
12 Ga0070669_100390217 3300005353 Unclassified 1137
13 Ga0070669_100411513 3300005353 Unclassified 1108
14 Ga0070669_100848193 3300005353 Unclassified 778
15 Ga0070675_100095880 3300005354 Bacteria 2492
16 Ga0070671_100525809 3300005355 Bacteria 1019
17 Ga0070673_100040979 3300005364 Unclassified 3556
18 Ga0070673_101309806 3300005364 Unclassified 680
19 Ga0070688_100297087 3300005365 Bacteria 1166
20 Ga0070667_100028304 3300005367 Bacteria 4665
21 Ga0070667_100159168 3300005367 Bacteria 1988
22 Ga0070667_100217864 3300005367 Bacteria 1698
23 Ga0070667_100579262 3300005367 Unclassified 1033
24 Ga0070714_100114160 3300005435 Unclassified 2396
25 Ga0070700_101486964 3300005441 Unclassified 575
26 Ga0070700_101585960 3300005441 Unclassified 559
27 Ga0070662_100859224 3300005457 Bacteria 773
28 Ga0070684_100522809 3300005535 Bacteria 1100
29 Ga0070697_100867229 3300005536 Bacteria 800
30 Ga0068853_100313128 3300005539 Bacteria 1454
31 Ga0068853_100512578 3300005539 Bacteria 1133
32 Ga0068853_101361644 3300005539 Bacteria 686
33 Ga0068853_101507158 3300005539 Unclassified 651
34 Ga0070672_100774777 3300005543 Unclassified 843
35 Ga0070672_100991526 3300005543 Unclassified 744
36 Ga0070665_100000772 3300005548 Bacteria 42151
37 Ga0070665_101098320 3300005548 Unclassified 807
38 Ga0068855_100301480 3300005563 Bacteria 1774
39 Ga0068855_100848593 3300005563 Bacteria 968
40 Ga0068855_102225800 3300005563 Unclassified 550
41 Ga0068857_100043828 3300005577 Unclassified 3968
42 Ga0068857_100674064 3300005577 Unclassified 981
43 Ga0068854_100523256 3300005578 Bacteria 1002
44 Ga0068852_102498308 3300005616 Bacteria 537
45 Ga0068859_101356022 3300005617 Unclassified 784
46 Ga0068864_100031014 3300005618 Bacteria 4534
47 Ga0068864_101325850 3300005618 Bacteria 720
48 Ga0068851_10409627 3300005834 Unclassified 799
49 Ga0068863_100126845 3300005841 Bacteria 2435
50 Ga0068863_100520925 3300005841 Bacteria 1172
51 Ga0068858_100848150 3300005842 Unclassified 892
52 Ga0068860_100086970 3300005843 Bacteria 2975
53 Ga0068860_101231553 3300005843 Bacteria 769
54 Ga0068860_101421020 3300005843 Unclassified 715
55 Ga0097621_101093008 3300006237 Bacteria 748
56 Ga0097621_101692042 3300006237 Bacteria 602
57 Ga0068871_100965584 3300006358 Unclassified 792
58 Ga0068871_101663786 3300006358 Unclassified 605
59 Ga0075428_100791752 3300006844 Unclassified 1008
60 Ga0075428_101475089 3300006844 Bacteria 713
61 Ga0097620_101356123 3300006931 Unclassified 784
62 Ga0075435_100839887 3300007076 Bacteria 800
63 Ga0105240_10348947 3300009093 Unclassified 1679
64 Ga0105240_10676899 3300009093 Bacteria 1128
65 Ga0105240_11952877 3300009093 Bacteria 610
66 Ga0111539_10112062 3300009094 Bacteria 3200
67 Ga0111539_10330494 3300009094 Bacteria 1774
68 Ga0105245_10132273 3300009098 Bacteria 2341
69 Ga0105245_10759773 3300009098 Bacteria 1006
70 Ga0105245_11059459 3300009098 Unclassified 856
71 Ga0105241_10231428 3300009174 Unclassified 1558
72 Ga0105241_10721215 3300009174 Unclassified 912
73 Ga0105241_12392599 3300009174 Unclassified 527
74 Ga0105242_10454284 3300009176 Bacteria 1208
75 Ga0105248_10296540 3300009177 Bacteria 1820
76 Ga0105248_11362631 3300009177 Bacteria 802
77 Ga0105248_11365373 3300009177 Unclassified 802
78 Ga0105237_10397884 3300009545 Unclassified 1382
79 Ga0105238_10275460 3300009551 Bacteria 1663
80 Ga0105238_10449126 3300009551 Unclassified 1286
81 Ga0105238_11335189 3300009551 Bacteria 743
82 Ga0105249_10775810 3300009553 Bacteria 1022
83 Ga0105239_10075344 3300010375 Bacteria 3710
84 Ga0105239_10997154 3300010375 Bacteria 963
85 Ga0157373_10771732 3300013100 Bacteria 707
86 Ga0157371_10420787 3300013102 Bacteria 979
87 Ga0157369_10160549 3300013105 Unclassified 2372
88 Ga0157369_10276571 3300013105 Unclassified 1749
89 Ga0157369_10911717 3300013105 Bacteria 901
90 Ga0157374_10179238 3300013296 Unclassified 2069
91 Ga0157374_11641932 3300013296 Archaea 667
92 Ga0163162_10910067 3300013306 Bacteria 992
93 Ga0163162_11662624 3300013306 Unclassified 729
94 Ga0163162_13429208 3300013306 Bacteria 505
95 Ga0157372_10067032 3300013307 Bacteria 4033
96 Ga0157372_10096410 3300013307 Bacteria 3371
97 Ga0157372_10241081 3300013307 Bacteria 2098
98 Ga0157372_10319963 3300013307 Unclassified 1806
99 Ga0157372_10370446 3300013307 Bacteria 1669
100 Ga0157372_10460507 3300013307 Bacteria 1482
101 Ga0157372_10661302 3300013307 Bacteria 1216
102 Ga0157372_10891440 3300013307 Unclassified 1032
103 Ga0157372_10912281 3300013307 Bacteria 1019
104 Ga0157375_10556856 3300013308 Bacteria 1308
105 Ga0157375_10599879 3300013308 Unclassified 1260
106 Ga0157375_10727429 3300013308 Unclassified 1145
107 Ga0157375_12754095 3300013308 Unclassified 588
108 Ga0157375_13267954 3300013308 Unclassified 540
109 Ga0157379_10405654 3300014968 Unclassified 1253
110 Ga0206356_10665230 3300020070 Bacteria 601
111 Ga0207645_10562601 3300025907 Bacteria 774
112 Ga0207705_10813645 3300025909 Bacteria 725
113 Ga0207654_10142374 3300025911 Unclassified 1530
114 Ga0207695_10238166 3300025913 Unclassified 1722
115 Ga0207662_10603969 3300025918 Unclassified 764
116 Ga0207657_11246467 3300025919 Bacteria 564
117 Ga0207649_10101369 3300025920 Unclassified 1906
118 Ga0207649_11066305 3300025920 Bacteria 637
119 Ga0207681_10413212 3300025923 Bacteria 1092
120 Ga0207681_10555800 3300025923 Bacteria 945
121 Ga0207681_11071425 3300025923 Bacteria 677
122 Ga0207694_10501879 3300025924 Unclassified 1016
123 Ga0207694_10826398 3300025924 Bacteria 783
124 Ga0207650_10219727 3300025925 Unclassified 1529
125 Ga0207650_10460391 3300025925 Bacteria 1059
126 Ga0207659_10140423 3300025926 Unclassified 1875
127 Ga0207687_10081027 3300025927 Bacteria 2344
128 Ga0207664_10097004 3300025929 Bacteria 2428
129 Ga0207644_10364653 3300025931 Bacteria 1176
130 Ga0207690_11043061 3300025932 Archaea 681
131 Ga0207686_11456169 3300025934 Unclassified 564
132 Ga0207670_10551444 3300025936 Bacteria 942
133 Ga0207669_11013465 3300025937 Unclassified 698
134 Ga0207691_10384729 3300025940 Bacteria 1198
135 Ga0207711_10319959 3300025941 Bacteria 1433
136 Ga0207661_10442629 3300025944 Bacteria 1183
137 Ga0207661_10935114 3300025944 Bacteria 799
138 Ga0207667_10534966 3300025949 Bacteria 1186
139 Ga0207667_11699770 3300025949 Unclassified 598
140 Ga0207651_10191165 3300025960 Unclassified 1633
141 Ga0207668_10733715 3300025972 Bacteria 870
142 Ga0207658_10018677 3300025986 Bacteria 4793
143 Ga0207658_10082347 3300025986 Bacteria 2471
144 Ga0207658_10755264 3300025986 Bacteria 881
145 Ga0207703_10692063 3300026035 Unclassified 969
146 Ga0207641_10025333 3300026088 Bacteria 4891
147 Ga0207648_11390263 3300026089 Bacteria 660
148 Ga0207648_11722174 3300026089 Bacteria 588
149 Ga0207648_12167616 3300026089 Unclassified 516
150 Ga0207676_10102430 3300026095 Bacteria 2377
151 Ga0207676_10625440 3300026095 Bacteria 1037
152 Ga0207676_11306420 3300026095 Bacteria 720
153 Ga0207674_10003625 3300026116 Bacteria 18829
154 Ga0207675_101285135 3300026118 Archaea 752
155 Ga0207698_10529328 3300026142 Bacteria 1151
156 Ga0207698_10867335 3300026142 Unclassified 908
157 Ga0207698_11916305 3300026142 Bacteria 607
158 Ga0207428_10791692 3300027907 Bacteria 674
159 Ga0268266_10010104 3300028379 Bacteria 8274
160 Ga0268265_10391988 3300028380 Bacteria 1281
161 Ga0268264_10363639 3300028381 Unclassified 1381
162 Ga0268264_10705141 3300028381 Bacteria 1003
163 Ga0268264_11845092 3300028381 Bacteria 614
164 Ga0265313_10045075 3300031595 Bacteria 2149
165 Ga0307405_10058395 3300031731 Bacteria 2428
166 Ga0307405_11713187 3300031731 Bacteria 557
167 Ga0307410_10118629 3300031852 Unclassified 1926
168 Ga0307410_10371239 3300031852 Bacteria 1149
169 Ga0307410_10398543 3300031852 Unclassified 1111
170 Ga0307406_11454824 3300031901 Unclassified 602
171 Ga0307407_10170706 3300031903 Bacteria 1432
172 Ga0307416_103397360 3300032002 Unclassified 533
173 Ga0307414_10565102 3300032004 Bacteria 1016
174 Ga0307414_10950077 3300032004 Unclassified 790
175 Ga0307414_11141618 3300032004 Bacteria 720
176 Ga0307411_10501939 3300032005 Bacteria 1026
177 Ga0373946_0242282 3300035171 Bacteria 877
178 Ga0373935_1023446 3300035692 Unclassified 614
179 Ga0373927_0938398 3300035695 Bacteria 571
180 Ga0373947_0048700 3300035725 Bacteria 2543
181 Ga0373937_2142409 3300036401 Bacteria 505
182 Ga0373925_0868944 3300037068 Bacteria 743
183 Ga0395899_0793163 3300037312 Unclassified 586
184 Ga0395898_1946226 3300037466 Bacteria 508
185 Ga0395905_0403956 3300037471 Unclassified 1261
186 Ga0395905_0538119 3300037471 Bacteria 1069
187 Ga0395901_0342111 3300038443 Bacteria 1545
188 Ga0395901_1789307 3300038443 Bacteria 564
189 Ga0451807_0254384 3300041486 Archaea 571
190 Ga0451853_0610413 3300041512 Unclassified 638
191 Ga0453684_0221070 3300044712 Bacteria 2194
192 Ga0495639_0195213 3300046475 Bacteria 989
193 Ga0495608_0763749 3300046511 Unclassified 572
194 Ga0495608_0813802 3300046511 Unclassified 551
195 Ga0495618_0209347 3300046514 Bacteria 1233
196 Ga0495630_0000483 3300046517 Bacteria 29587
197 Ga0495666_0069468 3300046526 Unclassified 1676
198 Ga0495665_0131427 3300046531 Unclassified 1310
199 Ga0495586_0614610 3300046535 Bacteria 628
200 Ga0495634_0465122 3300046642 Unclassified 745
201 Ga0495634_0761369 3300046642 Bacteria 554
202 Ga0495635_0152542 3300046663 Unclassified 1573
203 Ga0495599_0516300 3300046678 Unclassified 702
204 Ga0495613_0002425 3300046689 Bacteria 14076
205 Ga0495624_0028825 3300046690 Unclassified 3624
206 Ga0495600_0476736 3300046809 Bacteria 769
207 Ga0495581_0079337 3300047315 Bacteria 1900
208 Ga0495581_0105943 3300047315 Bacteria 1634
209 Ga0495674_0124861 3300047319 Unclassified 2172
210 Ga0495674_0282421 3300047319 Unclassified 1360
211 Ga0495675_0205092 3300047444 Bacteria 1199
212 Ga0495684_0002085 3300047471 Bacteria 16076
213 Ga0495684_0084626 3300047471 Bacteria 2406
214 Ga0495684_0408783 3300047471 Unclassified 951
215 Ga0501034_0001929 3300049571 Bacteria 26275
216 Ga0501034_0040241 3300049571 Bacteria 4732
217 Ga0501080_0078110 3300049742 Bacteria 3079
218 Ga0501083_0141418 3300049744 Bacteria 1576
219 Ga0501044_0042647 3300049823 Unclassified 4718
220 nmdc:mga08y16_346676_c1 3300050511 Bacteria 1526
221 nmdc:mga08y16_650426_c1 3300050511 Unclassified 1058
222 nmdc:mga0n895_1899601_c1 3300050512 Bacteria 554
223 nmdc:mga0rr50_791351_c1 3300050513 Bacteria 809
224 Ga0501082_0330653 3300060353 Bacteria 1328
225 Ga0307406_10039334
226 Ga0065712_10434150
227 Ga0070676_10437201
228 Ga0070683_100079838
229 Ga0070683_100199328
230 Ga0070683_100680360
231 Ga0070670_101247026
232 Ga0070666_10120142
233 Ga0070687_100517077
234 Ga0070661_100176037
235 Ga0070668_101129201
236 Ga0070669_100390217
237 Ga0070669_100411513
238 Ga0070669_100848193
239 Ga0070675_100095880
240 Ga0070671_100525809
241 Ga0070673_100040979
242 Ga0070673_101309806
243 Ga0070688_100297087
244 Ga0070667_100028304
245 Ga0070667_100159168
246 Ga0070667_100217864
247 Ga0070667_100579262
248 Ga0070714_100114160
249 Ga0070700_101486964
250 Ga0070700_101585960
251 Ga0070662_100859224
252 Ga0070684_100522809
253 Ga0070697_100867229
254 Ga0068853_100313128
255 Ga0068853_100512578
256 Ga0068853_101361644
257 Ga0068853_101507158
258 Ga0070672_100774777
259 Ga0070672_100991526
260 Ga0070665_100000772
261 Ga0070665_101098320
262 Ga0068855_100301480
263 Ga0068855_100848593
264 Ga0068855_102225800
265 Ga0068857_100043828
266 Ga0068857_100674064
267 Ga0068854_100523256
268 Ga0068852_102498308
269 Ga0068859_101356022
270 Ga0068864_100031014
271 Ga0068864_101325850
272 Ga0068851_10409627
273 Ga0068863_100126845
274 Ga0068863_100520925
275 Ga0068858_100848150
276 Ga0068860_100086970
277 Ga0068860_101231553
278 Ga0068860_101421020
279 Ga0097621_101093008
280 Ga0097621_101692042
281 Ga0068871_100965584
282 Ga0068871_101663786
283 Ga0075428_100791752
284 Ga0075428_101475089
285 Ga0097620_101356123
286 Ga0075435_100839887
287 Ga0105240_10348947
288 Ga0105240_10676899
289 Ga0105240_11952877
290 Ga0111539_10112062
291 Ga0111539_10330494
292 Ga0105245_10132273
293 Ga0105245_10759773
294 Ga0105245_11059459
295 Ga0105241_10231428
296 Ga0105241_10721215
297 Ga0105241_12392599
298 Ga0105242_10454284
299 Ga0105248_10296540
300 Ga0105248_11362631
301 Ga0105248_11365373
302 Ga0105237_10397884
303 Ga0105238_10275460
304 Ga0105238_10449126
305 Ga0105238_11335189
306 Ga0105249_10775810
307 Ga0105239_10075344
308 Ga0105239_10997154
309 Ga0157373_10771732
310 Ga0157371_10420787
311 Ga0157369_10160549
312 Ga0157369_10276571
313 Ga0157369_10911717
314 Ga0157374_10179238
315 Ga0157374_11641932
316 Ga0163162_10910067
317 Ga0163162_11662624
318 Ga0163162_13429208
319 Ga0157372_10067032
320 Ga0157372_10096410
321 Ga0157372_10241081
322 Ga0157372_10319963
323 Ga0157372_10370446
324 Ga0157372_10460507
325 Ga0157372_10661302
326 Ga0157372_10891440
327 Ga0157372_10912281
328 Ga0157375_10556856
329 Ga0157375_10599879
330 Ga0157375_10727429
331 Ga0157375_12754095
332 Ga0157375_13267954
333 Ga0157379_10405654
334 Ga0206356_10665230
335 Ga0207645_10562601
336 Ga0207705_10813645
337 Ga0207654_10142374
338 Ga0207695_10238166
339 Ga0207662_10603969
340 Ga0207657_11246467
341 Ga0207649_10101369
342 Ga0207649_11066305
343 Ga0207681_10413212
344 Ga0207681_10555800
345 Ga0207681_11071425
346 Ga0207694_10501879
347 Ga0207694_10826398
348 Ga0207650_10219727
349 Ga0207650_10460391
350 Ga0207659_10140423
351 Ga0207687_10081027
352 Ga0207664_10097004
353 Ga0207644_10364653
354 Ga0207690_11043061
355 Ga0207686_11456169
356 Ga0207670_10551444
357 Ga0207669_11013465
358 Ga0207691_10384729
359 Ga0207711_10319959
360 Ga0207661_10442629
361 Ga0207661_10935114
362 Ga0207667_10534966
363 Ga0207667_11699770
364 Ga0207651_10191165
365 Ga0207668_10733715
366 Ga0207658_10018677
367 Ga0207658_10082347
368 Ga0207658_10755264
369 Ga0207703_10692063
370 Ga0207641_10025333
371 Ga0207648_11390263
372 Ga0207648_11722174
373 Ga0207648_12167616
374 Ga0207676_10102430
375 Ga0207676_10625440
376 Ga0207676_11306420
377 Ga0207674_10003625
378 Ga0207675_101285135
379 Ga0207698_10529328
380 Ga0207698_10867335
381 Ga0207698_11916305
382 Ga0207428_10791692
383 Ga0268266_10010104
384 Ga0268265_10391988
385 Ga0268264_10363639
386 Ga0268264_10705141
387 Ga0268264_11845092
388 Ga0265313_10045075
389 Ga0307405_10058395
390 Ga0307405_11713187
391 Ga0307410_10118629
392 Ga0307410_10371239
393 Ga0307410_10398543
394 Ga0307406_11454824
395 Ga0307407_10170706
396 Ga0307416_103397360
397 Ga0307414_10565102
398 Ga0307414_10950077
399 Ga0307414_11141618
400 Ga0307411_10501939
401 Ga0373946_0242282
402 Ga0373935_1023446
403 Ga0373927_0938398
404 Ga0373947_0048700
405 Ga0373937_2142409
406 Ga0373925_0868944
407 Ga0395899_0793163
408 Ga0395898_1946226
409 Ga0395905_0403956
410 Ga0395905_0538119
411 Ga0395901_0342111
412 Ga0395901_1789307
413 Ga0451807_0254384
414 Ga0451853_0610413
415 Ga0453684_0221070
416 Ga0495639_0195213
417 Ga0495608_0763749
418 Ga0495608_0813802
419 Ga0495618_0209347
420 Ga0495630_0000483
421 Ga0495666_0069468
422 Ga0495665_0131427
423 Ga0495586_0614610
424 Ga0495634_0465122
425 Ga0495634_0761369
426 Ga0495635_0152542
427 Ga0495599_0516300
428 Ga0495613_0002425
429 Ga0495624_0028825
430 Ga0495600_0476736
431 Ga0495581_0079337
432 Ga0495581_0105943
433 Ga0495674_0124861
434 Ga0495674_0282421
435 Ga0495675_0205092
436 Ga0495684_0002085
437 Ga0495684_0084626
438 Ga0495684_0408783
439 Ga0501034_0001929
440 Ga0501034_0040241
441 Ga0501080_0078110
442 Ga0501083_0141418
443 Ga0501044_0042647
444 nmdc:mga08y16_346676_c1
445 nmdc:mga08y16_650426_c1
446 nmdc:mga0n895_1899601_c1
447 nmdc:mga0rr50_791351_c1
448 Ga0501082_0330653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

22

130

0.95

PF13466

STAS_2

STAS domain

35

118

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.9198 11 118
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.9055 11 118
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8815 12 112
4qtp-assembly3.cif.gz_C crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis 0.8799 14 118
1sbo-assembly1.cif.gz_A solution structure of putative anti sigma factor antagonist from thermotoga maritima (tm1442) 0.8769 14 116
ID Description Score Start End Superfamily
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9164 11 118 3.30.750.24
af_A0A0N7KGR6_2_88_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9112 52 118 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8938 12 114 3.30.750.24
af_A0A0R0K006_14_112_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8874 39 118 3.30.750.24
af_I1KA21_504_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8809 18 118 3.30.750.24
ID Description Score Start End GO Terms
AF-R5G6E2-F1-model_v4 deleted 0.9411 14 118
AF-A0A7C6M4U0-F1-model_v4 Anti-sigma factor antagonist 0.938 14 115 GO:0016020
GO:0043856
AF-A0A1F8ULF0-F1-model_v4 Anti-sigma factor antagonist 0.9364 14 118 GO:0043856
AF-U5F9K9-F1-model_v4 Anti-sigma factor antagonist 0.9355 14 114 GO:0043856
AF-C0GDZ9-F1-model_v4 Anti-sigma F factor antagonist (Stage II sporulation protein) 0.9333 12 118 GO:0030435
GO:0043856
GO:0045152

Map