F336865

General Info

Members Datasets Scaffolds Average Seq Length
224 93 448 212

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10010442|Ga0265320_100104423
Length 220
Sequence MSAVDEGIVREYFEQNGFFVRQVRKYQVQARKKTSDEEIDLLVHNPAWRPGGRRPDFFLFANEMPFVHRAIVAVKPWHTDVFTPALLRGSPEKIFSFLEENVLREVSRLFAAEAGEAGEDAPMKVLVLPALPTAEPFRSQSVELLKARGVDAIISFRAMLLDLVDKVETNRSYGKSDALQVIRILKNYDLLKDTQLDLPTGSRSGRPRAEAVRPADAPAV

Samples

Sample ID Description Type Environment
1 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
35 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
38 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
41 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
90 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
91 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
92 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
93 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 0
Rhizosphere 94.64
Stem 0
Stem Tuber 0
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265320_10010442 3300031240 Bacteria 5533
2 rootH2_10014717 3300003320 Bacteria 6105
3 rootH2_10063276 3300003320 Bacteria 6711
4 rootL2_10049362 3300003322 Bacteria 4722
5 rootL2_10083363 3300003322 Bacteria 16621
6 rootH1_10134810 3300003323 Bacteria 1418
7 rootH1_10139279 3300003323 Bacteria 2254
8 Ga0070658_10052109 3300005327 Unclassified 3318
9 Ga0070683_100067582 3300005329 Bacteria 3329
10 Ga0068869_100000041 3300005334 Bacteria 52640
11 Ga0070680_100408772 3300005336 Bacteria 1157
12 Ga0068868_100042861 3300005338 Bacteria 3534
13 Ga0068868_100053624 3300005338 Bacteria 3177
14 Ga0070687_100393878 3300005343 Bacteria 906
15 Ga0070713_100006899 3300005436 Bacteria 7924
16 Ga0068867_100001369 3300005459 Bacteria 16832
17 Ga0070684_100172088 3300005535 Bacteria 1967
18 Ga0068857_100004718 3300005577 Bacteria 11545
19 Ga0068856_100002719 3300005614 Bacteria 18124
20 Ga0068856_100979440 3300005614 Bacteria 864
21 Ga0068864_100648632 3300005618 Bacteria 1028
22 Ga0070717_10000037 3300006028 Bacteria 121470
23 Ga0097621_100009556 3300006237 Bacteria 7047
24 Ga0068865_100012632 3300006881 Bacteria 5320
25 Ga0068865_100770212 3300006881 Bacteria 828
26 Ga0105243_10411715 3300009148 Bacteria 1258
27 Ga0163162_10927037 3300013306 Bacteria 983
28 Ga0163163_10207528 3300014325 Unclassified 2008
29 Ga0157376_10200118 3300014969 Bacteria 1837
30 Ga0207705_10067575 3300025909 Bacteria 2587
31 Ga0207707_10888434 3300025912 Bacteria 737
32 Ga0207700_10004940 3300025928 Bacteria 7924
33 Ga0207689_10000510 3300025942 Bacteria 36782
34 Ga0207667_10452841 3300025949 Bacteria 1304
35 Ga0207677_10171056 3300026023 Bacteria 1699
36 Ga0207702_10005263 3300026078 Bacteria 11358
37 Ga0207648_10001280 3300026089 Bacteria 28091
38 Ga0207676_10392133 3300026095 Bacteria 1295
39 Ga0207674_10054735 3300026116 Bacteria 4061
40 Ga0265337_1001822 3300028556 Bacteria 10221
41 Ga0265337_1003146 3300028556 Bacteria 7265
42 Ga0265337_1044864 3300028556 Unclassified 1260
43 Ga0265326_10049910 3300028558 Unclassified 1185
44 Ga0265319_1000188 3300028563 Bacteria 46993
45 Ga0265319_1000809 3300028563 Bacteria 20093
46 Ga0265319_1001714 3300028563 Bacteria 12649
47 Ga0265319_1003254 3300028563 Bacteria 8546
48 Ga0265319_1003289 3300028563 Bacteria 8499
49 Ga0265319_1037628 3300028563 Bacteria 1648
50 Ga0265319_1062040 3300028563 Bacteria 1211
51 Ga0265334_10003979 3300028573 Bacteria 6637
52 Ga0265334_10003988 3300028573 Bacteria 6629
53 Ga0265318_10000004 3300028577 Bacteria 319325
54 Ga0265318_10000129 3300028577 Bacteria 69613
55 Ga0265318_10000819 3300028577 Bacteria 20509
56 Ga0265318_10002336 3300028577 Bacteria 10182
57 Ga0265318_10002460 3300028577 Bacteria 9895
58 Ga0265318_10006471 3300028577 Bacteria 5397
59 Ga0265323_10000005 3300028653 Bacteria 196003
60 Ga0265323_10001806 3300028653 Bacteria 10164
61 Ga0265323_10002077 3300028653 Bacteria 9367
62 Ga0265323_10008634 3300028653 Bacteria 4195
63 Ga0265323_10009508 3300028653 Bacteria 3964
64 Ga0265323_10047981 3300028653 Unclassified 1526
65 Ga0265323_10050606 3300028653 Bacteria 1476
66 Ga0265323_10071997 3300028653 Bacteria 1180
67 Ga0265322_10000526 3300028654 Bacteria 14761
68 Ga0265322_10000994 3300028654 Bacteria 9833
69 Ga0265322_10006129 3300028654 Bacteria 3542
70 Ga0265322_10028285 3300028654 Bacteria 1602
71 Ga0265322_10041416 3300028654 Bacteria 1311
72 Ga0265336_10000623 3300028666 Bacteria 19512
73 Ga0265336_10073817 3300028666 Bacteria 1019
74 Ga0307515_10123622 3300028794 Bacteria 2909
75 Ga0265338_10002481 3300028800 Bacteria 27564
76 Ga0265338_10007935 3300028800 Bacteria 13003
77 Ga0265324_10001962 3300029957 Bacteria 11029
78 Ga0265324_10030850 3300029957 Bacteria 1880
79 Ga0265324_10063516 3300029957 Bacteria 1261
80 Ga0265330_10008730 3300031235 Bacteria 4859
81 Ga0265330_10017961 3300031235 Bacteria 3251
82 Ga0265330_10037021 3300031235 Bacteria 2173
83 Ga0265330_10095969 3300031235 Bacteria 1271
84 Ga0265328_10010111 3300031239 Bacteria 3812
85 Ga0265328_10027563 3300031239 Bacteria 2129
86 Ga0265320_10001041 3300031240 Bacteria 20583
87 Ga0265320_10001565 3300031240 Bacteria 16452
88 Ga0265320_10001768 3300031240 Bacteria 15311
89 Ga0265320_10016077 3300031240 Bacteria 4204
90 Ga0265320_10021100 3300031240 Bacteria 3513
91 Ga0265320_10029403 3300031240 Bacteria 2842
92 Ga0265320_10039181 3300031240 Bacteria 2371
93 Ga0265320_10042811 3300031240 Bacteria 2243
94 Ga0265320_10051246 3300031240 Bacteria 2003
95 Ga0265320_10116582 3300031240 Bacteria 1221
96 Ga0265320_10118622 3300031240 Bacteria 1208
97 Ga0265320_10201829 3300031240 Unclassified 888
98 Ga0265325_10006455 3300031241 Bacteria 7111
99 Ga0265329_10062150 3300031242 Bacteria 1182
100 Ga0265340_10009066 3300031247 Bacteria 5352
101 Ga0265331_10005726 3300031250 Bacteria 7451
102 Ga0265331_10045494 3300031250 Bacteria 2119
103 Ga0265331_10171312 3300031250 Bacteria 982
104 Ga0265327_10000204 3300031251 Bacteria 123713
105 Ga0265327_10000744 3300031251 Bacteria 50640
106 Ga0265327_10001250 3300031251 Bacteria 33884
107 Ga0265327_10014500 3300031251 Bacteria 5152
108 Ga0265327_10033362 3300031251 Bacteria 2869
109 Ga0265327_10155368 3300031251 Bacteria 1060
110 Ga0265316_10004494 3300031344 Bacteria 13859
111 Ga0265316_10005918 3300031344 Bacteria 11781
112 Ga0265316_10011006 3300031344 Bacteria 8206
113 Ga0265316_10036175 3300031344 Bacteria 3993
114 Ga0265316_10040094 3300031344 Bacteria 3756
115 Ga0265316_10042873 3300031344 Bacteria 3613
116 Ga0265316_10090285 3300031344 Bacteria 2338
117 Ga0265316_10099209 3300031344 Bacteria 2216
118 Ga0265316_10117606 3300031344 Bacteria 2009
119 Ga0265316_10148443 3300031344 Bacteria 1757
120 Ga0265316_10343727 3300031344 Bacteria 1081
121 Ga0307408_100000003 3300031548 Bacteria 618438
122 Ga0265313_10003290 3300031595 Bacteria 13270
123 Ga0265313_10003960 3300031595 Bacteria 11637
124 Ga0265313_10004069 3300031595 Bacteria 11396
125 Ga0265313_10007984 3300031595 Bacteria 7106
126 Ga0265313_10010637 3300031595 Bacteria 5794
127 Ga0265313_10034903 3300031595 Bacteria 2537
128 Ga0307508_10000026 3300031616 Bacteria 171622
129 Ga0265314_10001147 3300031711 Bacteria 30685
130 Ga0265314_10002416 3300031711 Bacteria 19166
131 Ga0265314_10002681 3300031711 Bacteria 17834
132 Ga0265314_10009229 3300031711 Bacteria 8357
133 Ga0265314_10028008 3300031711 Bacteria 4208
134 Ga0265314_10087141 3300031711 Bacteria 2042
135 Ga0265314_10093433 3300031711 Bacteria 1953
136 Ga0265314_10228607 3300031711 Unclassified 1081
137 Ga0265314_10248252 3300031711 Bacteria 1023
138 Ga0265314_10268976 3300031711 Bacteria 969
139 Ga0265342_10013434 3300031712 Bacteria 5493
140 Ga0265342_10018716 3300031712 Bacteria 4478
141 Ga0265342_10035999 3300031712 Bacteria 3026
142 Ga0265342_10037771 3300031712 Bacteria 2943
143 Ga0265342_10059640 3300031712 Bacteria 2253
144 Ga0265342_10300365 3300031712 Bacteria 846
145 Ga0307405_10123884 3300031731 Bacteria 1774
146 Ga0307413_10217860 3300031824 Bacteria 1392
147 Ga0307413_10317319 3300031824 Unclassified 1189
148 Ga0307410_10000039 3300031852 Bacteria 46194
149 Ga0307407_10020455 3300031903 Bacteria 3392
150 Ga0307409_100000018 3300031995 Bacteria 57233
151 Ga0307409_100740551 3300031995 Unclassified 986
152 Ga0307416_100000027 3300032002 Bacteria 172418
153 Ga0373933_0147162 3300035724 Bacteria 1490
154 Ga0395905_0000096 3300037471 Bacteria 146075
155 Ga0395905_0163770 3300037471 Bacteria 2090
156 Ga0439445_0007448 3300042004 Bacteria 2539
157 Ga0451577_0000076 3300042876 Bacteria 225346
158 Ga0451577_0011219 3300042876 Bacteria 8497
159 Ga0451577_0461897 3300042876 Bacteria 1153
160 Ga0451577_0548131 3300042876 Bacteria 1050
161 Ga0451577_0609286 3300042876 Bacteria 991
162 Ga0451577_0876739 3300042876 Bacteria 809
163 Ga0453683_0001898 3300044673 Bacteria 17074
164 Ga0466965_0380786 3300044683 Unclassified 777
165 Ga0453684_0010484 3300044712 Bacteria 15831
166 Ga0453684_0022460 3300044712 Bacteria 9355
167 Ga0453684_0076849 3300044712 Bacteria 4190
168 Ga0453684_0091118 3300044712 Bacteria 3764
169 Ga0453684_0457722 3300044712 Bacteria 1419
170 Ga0453684_0910182 3300044712 Unclassified 941
171 Ga0466959_0088319 3300045049 Unclassified 2229
172 Ga0451576_0000075 3300045051 Bacteria 247981
173 Ga0451576_0000445 3300045051 Bacteria 93977
174 Ga0451576_0000456 3300045051 Bacteria 92664
175 Ga0451576_0004026 3300045051 Bacteria 19541
176 Ga0451576_0173918 3300045051 Bacteria 2248
177 Ga0466967_0007357 3300045976 Bacteria 7931
178 Ga0501032_0002638 3300049569 Bacteria 13985
179 Ga0501032_0003688 3300049569 Bacteria 11631
180 Ga0501032_0023542 3300049569 Bacteria 4252
181 Ga0501033_0003213 3300049570 Bacteria 13530
182 Ga0501033_0003285 3300049570 Bacteria 13368
183 Ga0501036_0258218 3300049572 Bacteria 1460
184 Ga0501036_0304189 3300049572 Bacteria 1333
185 Ga0501037_0054489 3300049573 Bacteria 2924
186 Ga0501038_0068074 3300049574 Bacteria 3027
187 Ga0501038_0112685 3300049574 Bacteria 2252
188 Ga0501043_0138335 3300049579 Bacteria 1907
189 Ga0501043_0380648 3300049579 Bacteria 1068
190 Ga0501046_0000253 3300049580 Bacteria 54924
191 Ga0501046_0045050 3300049580 Bacteria 3506
192 Ga0501046_0050714 3300049580 Bacteria 3277
193 Ga0501047_0033965 3300049581 Bacteria 4924
194 Ga0501047_0035918 3300049581 Bacteria 4787
195 Ga0501047_0060681 3300049581 Bacteria 3649
196 Ga0501047_0064144 3300049581 Bacteria 3543
197 Ga0501047_0347782 3300049581 Bacteria 1319
198 Ga0501048_0048317 3300049582 Bacteria 3035
199 Ga0501048_0086028 3300049582 Bacteria 2217
200 Ga0501048_0220554 3300049582 Bacteria 1345
201 Ga0501070_0110284 3300049586 Bacteria 2274
202 Ga0501070_0116103 3300049586 Bacteria 2211
203 Ga0501070_0183977 3300049586 Bacteria 1719
204 Ga0501243_010130 3300049675 Bacteria 1469
205 Ga0501080_0111507 3300049742 Bacteria 2536
206 Ga0501080_0125613 3300049742 Bacteria 2376
207 Ga0501080_0183269 3300049742 Bacteria 1926
208 Ga0501083_0001344 3300049744 Bacteria 16683
209 Ga0501083_0004310 3300049744 Bacteria 10023
210 Ga0501083_0071212 3300049744 Bacteria 2312
211 Ga0501083_0137973 3300049744 Bacteria 1597
212 Ga0501035_0001373 3300049822 Bacteria 25060
213 Ga0501035_0004287 3300049822 Bacteria 13543
214 Ga0501035_0036613 3300049822 Bacteria 4446
215 Ga0501035_0038780 3300049822 Bacteria 4313
216 Ga0501044_0000582 3300049823 Bacteria 44288
217 Ga0501044_0014749 3300049823 Bacteria 8425
218 Ga0501044_0028467 3300049823 Bacteria 5897
219 Ga0501044_0045735 3300049823 Bacteria 4534
220 Ga0500593_180837 3300053117 Bacteria 783
221 Ga0500568_0001869 3300053139 Bacteria 12967
222 Ga0500588_0194133 3300053146 Bacteria 750
223 Ga0466962_0059998 3300061719 Bacteria 1816
224 2788437783 2786546940 Bacteria 6396474
225 Ga0265320_10010442
226 rootH2_10014717
227 rootH2_10063276
228 rootL2_10049362
229 rootL2_10083363
230 rootH1_10134810
231 rootH1_10139279
232 Ga0070658_10052109
233 Ga0070683_100067582
234 Ga0068869_100000041
235 Ga0070680_100408772
236 Ga0068868_100042861
237 Ga0068868_100053624
238 Ga0070687_100393878
239 Ga0070713_100006899
240 Ga0068867_100001369
241 Ga0070684_100172088
242 Ga0068857_100004718
243 Ga0068856_100002719
244 Ga0068856_100979440
245 Ga0068864_100648632
246 Ga0070717_10000037
247 Ga0097621_100009556
248 Ga0068865_100012632
249 Ga0068865_100770212
250 Ga0105243_10411715
251 Ga0163162_10927037
252 Ga0163163_10207528
253 Ga0157376_10200118
254 Ga0207705_10067575
255 Ga0207707_10888434
256 Ga0207700_10004940
257 Ga0207689_10000510
258 Ga0207667_10452841
259 Ga0207677_10171056
260 Ga0207702_10005263
261 Ga0207648_10001280
262 Ga0207676_10392133
263 Ga0207674_10054735
264 Ga0265337_1001822
265 Ga0265337_1003146
266 Ga0265337_1044864
267 Ga0265326_10049910
268 Ga0265319_1000188
269 Ga0265319_1000809
270 Ga0265319_1001714
271 Ga0265319_1003254
272 Ga0265319_1003289
273 Ga0265319_1037628
274 Ga0265319_1062040
275 Ga0265334_10003979
276 Ga0265334_10003988
277 Ga0265318_10000004
278 Ga0265318_10000129
279 Ga0265318_10000819
280 Ga0265318_10002336
281 Ga0265318_10002460
282 Ga0265318_10006471
283 Ga0265323_10000005
284 Ga0265323_10001806
285 Ga0265323_10002077
286 Ga0265323_10008634
287 Ga0265323_10009508
288 Ga0265323_10047981
289 Ga0265323_10050606
290 Ga0265323_10071997
291 Ga0265322_10000526
292 Ga0265322_10000994
293 Ga0265322_10006129
294 Ga0265322_10028285
295 Ga0265322_10041416
296 Ga0265336_10000623
297 Ga0265336_10073817
298 Ga0307515_10123622
299 Ga0265338_10002481
300 Ga0265338_10007935
301 Ga0265324_10001962
302 Ga0265324_10030850
303 Ga0265324_10063516
304 Ga0265330_10008730
305 Ga0265330_10017961
306 Ga0265330_10037021
307 Ga0265330_10095969
308 Ga0265328_10010111
309 Ga0265328_10027563
310 Ga0265320_10001041
311 Ga0265320_10001565
312 Ga0265320_10001768
313 Ga0265320_10016077
314 Ga0265320_10021100
315 Ga0265320_10029403
316 Ga0265320_10039181
317 Ga0265320_10042811
318 Ga0265320_10051246
319 Ga0265320_10116582
320 Ga0265320_10118622
321 Ga0265320_10201829
322 Ga0265325_10006455
323 Ga0265329_10062150
324 Ga0265340_10009066
325 Ga0265331_10005726
326 Ga0265331_10045494
327 Ga0265331_10171312
328 Ga0265327_10000204
329 Ga0265327_10000744
330 Ga0265327_10001250
331 Ga0265327_10014500
332 Ga0265327_10033362
333 Ga0265327_10155368
334 Ga0265316_10004494
335 Ga0265316_10005918
336 Ga0265316_10011006
337 Ga0265316_10036175
338 Ga0265316_10040094
339 Ga0265316_10042873
340 Ga0265316_10090285
341 Ga0265316_10099209
342 Ga0265316_10117606
343 Ga0265316_10148443
344 Ga0265316_10343727
345 Ga0307408_100000003
346 Ga0265313_10003290
347 Ga0265313_10003960
348 Ga0265313_10004069
349 Ga0265313_10007984
350 Ga0265313_10010637
351 Ga0265313_10034903
352 Ga0307508_10000026
353 Ga0265314_10001147
354 Ga0265314_10002416
355 Ga0265314_10002681
356 Ga0265314_10009229
357 Ga0265314_10028008
358 Ga0265314_10087141
359 Ga0265314_10093433
360 Ga0265314_10228607
361 Ga0265314_10248252
362 Ga0265314_10268976
363 Ga0265342_10013434
364 Ga0265342_10018716
365 Ga0265342_10035999
366 Ga0265342_10037771
367 Ga0265342_10059640
368 Ga0265342_10300365
369 Ga0307405_10123884
370 Ga0307413_10217860
371 Ga0307413_10317319
372 Ga0307410_10000039
373 Ga0307407_10020455
374 Ga0307409_100000018
375 Ga0307409_100740551
376 Ga0307416_100000027
377 Ga0373933_0147162
378 Ga0395905_0000096
379 Ga0395905_0163770
380 Ga0439445_0007448
381 Ga0451577_0000076
382 Ga0451577_0011219
383 Ga0451577_0461897
384 Ga0451577_0548131
385 Ga0451577_0609286
386 Ga0451577_0876739
387 Ga0453683_0001898
388 Ga0466965_0380786
389 Ga0453684_0010484
390 Ga0453684_0022460
391 Ga0453684_0076849
392 Ga0453684_0091118
393 Ga0453684_0457722
394 Ga0453684_0910182
395 Ga0466959_0088319
396 Ga0451576_0000075
397 Ga0451576_0000445
398 Ga0451576_0000456
399 Ga0451576_0004026
400 Ga0451576_0173918
401 Ga0466967_0007357
402 Ga0501032_0002638
403 Ga0501032_0003688
404 Ga0501032_0023542
405 Ga0501033_0003213
406 Ga0501033_0003285
407 Ga0501036_0258218
408 Ga0501036_0304189
409 Ga0501037_0054489
410 Ga0501038_0068074
411 Ga0501038_0112685
412 Ga0501043_0138335
413 Ga0501043_0380648
414 Ga0501046_0000253
415 Ga0501046_0045050
416 Ga0501046_0050714
417 Ga0501047_0033965
418 Ga0501047_0035918
419 Ga0501047_0060681
420 Ga0501047_0064144
421 Ga0501047_0347782
422 Ga0501048_0048317
423 Ga0501048_0086028
424 Ga0501048_0220554
425 Ga0501070_0110284
426 Ga0501070_0116103
427 Ga0501070_0183977
428 Ga0501243_010130
429 Ga0501080_0111507
430 Ga0501080_0125613
431 Ga0501080_0183269
432 Ga0501083_0001344
433 Ga0501083_0004310
434 Ga0501083_0071212
435 Ga0501083_0137973
436 Ga0501035_0001373
437 Ga0501035_0004287
438 Ga0501035_0036613
439 Ga0501035_0038780
440 Ga0501044_0000582
441 Ga0501044_0014749
442 Ga0501044_0028467
443 Ga0501044_0045735
444 Ga0500593_180837
445 Ga0500568_0001869
446 Ga0500588_0194133
447 Ga0466962_0059998
448 2788437783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oft-assembly1.cif.gz_A crystal structure of sula from pseudomonas aeruginosa 0.5721 126 156
1v93-assembly1.cif.gz_A 5,10-methylenetetrahydrofolate reductase from thermus thermophilus hb8 0.5613 86 154
8dk3-assembly1.cif.gz_B cryoem structure of pseudomonas aeruginosa pa14 jetc atpase domain bound to dna and cwhd domain of jeta 0.4946 69 156
4hxg-assembly2.cif.gz_G pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.4928 123 156
4hxf-assembly1.cif.gz_B acylaminoacyl peptidase in complex with z-gly-gly-phe-chloromethyl ketone 0.4878 123 156
ID Description Score Start End Superfamily
af_Q57865_1_131_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6 88 157 3.40.50.720
1oftD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5728 126 156 3.40.50.300
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.5646 89 154 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.5613 86 154 3.20.20.220
af_Q54YA0_16_151_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.5387 126 156 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A349ND02-F1-model_v4 Uncharacterized protein 0.8229 4 177
AF-A0A349ND02-F1-model_v4 Uncharacterized protein 0.8056 4 177
AF-A0A388PNY7-F1-model_v4 Uncharacterized protein 0.7561 1 204
AF-A0A349WGP9-F1-model_v4 Uncharacterized protein 0.746 3 153
AF-A0A388PNY7-F1-model_v4 Uncharacterized protein 0.7458 1 204

Map