F336657

General Info

Members Datasets Scaffolds Average Seq Length
224 150 178 190

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10154396|Ga0105243_101543962
Length 203
Sequence VSVADTRPAAETPAFASAAQRLRSLTFRSDFSVREIAAPVSLAPEAIAFAGDVRPDAEGIDSEYGTGRFVLMHDDSEPDAWGGPWRIVCFAQAPLEPEIGIDPLLADVAWSWLVDALDARGAAFHSESGTATKTLSKGFGSLAAEGDGAQIELRSSWTPAGDLAAHIEAWAELVCMLAGLPPGSEGIAVFGPQRGASGRGMRG

Samples

Sample ID Description Type Environment
1 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
2 2643221546 Microbacterium sp. Root53 Isolate Unclassified
3 2643221553 Microbacterium sp. Root553 Isolate Unclassified
4 2643221566 Microbacterium sp. Root166 Isolate Unclassified
5 2643221575 Microbacterium sp. Root61 Isolate Unclassified
6 2643221597 Microbacterium sp. Root180 Isolate Unclassified
7 2643221630 Microbacterium sp. Root322 Isolate Unclassified
8 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
9 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
10 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
11 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
12 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
13 2773857759 Microbacterium sp. 1294 Isolate Unclassified
14 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
15 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
16 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
17 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
18 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
19 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
20 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
21 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
22 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
23 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
24 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
25 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
26 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
27 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
28 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
29 2919069694 Microbacterium sp. 1154 Isolate Unclassified
30 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
31 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
32 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
33 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
34 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
35 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
36 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
37 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
38 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
39 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
40 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
41 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
42 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
103 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
148 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
149 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
150 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.57
Metatranscriptomes 0.89
Isolates 20.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.89
Bulb 0
Endosphere 7.59
Nodule 0
Rhizoplane 11.61
Rhizosphere 44.2
Stem 0
Stem Tuber 0
Unclassified 35.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10254580 3300003320 Bacteria 1303
2 Ga0006562J51391_1084319 3300003578 Bacteria 6460
3 Ga0006562J51391_1084321 3300003578 Bacteria 4030
4 Ga0070682_100979949 3300005337 Bacteria 700
5 Ga0070660_100125000 3300005339 Bacteria 2055
6 Ga0070691_10238146 3300005341 Bacteria 971
7 Ga0070659_100214575 3300005366 Bacteria 1587
8 Ga0070667_100834145 3300005367 Bacteria 857
9 Ga0068853_100180723 3300005539 Bacteria 1913
10 Ga0068857_100249406 3300005577 Bacteria 1627
11 Ga0075365_10008441 3300006038 Bacteria 5850
12 Ga0075363_100009456 3300006048 Bacteria 4583
13 Ga0075364_10006699 3300006051 Bacteria 6791
14 Ga0075364_10070222 3300006051 Bacteria 2305
15 Ga0075364_10111106 3300006051 Bacteria 1829
16 Ga0075364_10237362 3300006051 Bacteria 1238
17 Ga0075367_10002488 3300006178 Bacteria 8441
18 Ga0075370_10020695 3300006353 Bacteria 3599
19 Ga0105244_10031553 3300009036 Bacteria 2811
20 Ga0105243_10154396 3300009148 Bacteria 1972
21 Ga0105237_10647276 3300009545 Bacteria 1064
22 Ga0157370_10347837 3300013104 Bacteria 1366
23 Ga0157369_10125916 3300013105 Bacteria 2716
24 Ga0157369_10462255 3300013105 Bacteria 1314
25 Ga0171462_1003 3300013250 Bacteria 853796
26 Ga0157372_10024874 3300013307 Bacteria 6507
27 Ga0157380_10345003 3300014326 Bacteria 1391
28 Ga0163161_10357206 3300017792 Bacteria 1163
29 Ga0163161_10482811 3300017792 Bacteria 1006
30 Ga0209646_1000167 3300025246 Bacteria 87036
31 Ga0207655_1020938 3300025728 Bacteria 3340
32 Ga0207655_1022391 3300025728 Bacteria 3169
33 Ga0207647_10112952 3300025904 Bacteria 1605
34 Ga0207657_10147571 3300025919 Bacteria 1918
35 Ga0207709_10118181 3300025935 Bacteria 1785
36 Ga0207691_10733528 3300025940 Bacteria 832
37 Ga0207658_10953202 3300025986 Bacteria 782
38 Ga0207674_10165537 3300026116 Bacteria 2165
39 Ga0307408_100275039 3300031548 Bacteria 1400
40 Ga0307405_10195031 3300031731 Bacteria 1466
41 Ga0307405_10722907 3300031731 Bacteria 827
42 Ga0307413_10041255 3300031824 Bacteria 2701
43 Ga0307410_10945255 3300031852 Bacteria 741
44 Ga0307406_10000187 3300031901 Bacteria 36987
45 Ga0307406_10003749 3300031901 Bacteria 8262
46 Ga0307406_10009556 3300031901 Bacteria 5445
47 Ga0307406_10039141 3300031901 Bacteria 2940
48 Ga0307406_10094101 3300031901 Bacteria 2025
49 Ga0307406_10146690 3300031901 Bacteria 1678
50 Ga0307406_10338975 3300031901 Bacteria 1170
51 Ga0307406_10627715 3300031901 Bacteria 889
52 Ga0307407_10469904 3300031903 Bacteria 916
53 Ga0307409_100092581 3300031995 Bacteria 2481
54 Ga0307414_10009977 3300032004 Bacteria 5483
55 Ga0307414_10135630 3300032004 Bacteria 1919
56 Ga0307414_10256456 3300032004 Bacteria 1457
57 Ga0307414_11398425 3300032004 Bacteria 650
58 Ga0307415_100485849 3300032126 Bacteria 1076
59 Ga0395899_0186539 3300037312 Bacteria 1453
60 Ga0395898_0029926 3300037466 Bacteria 5451
61 Ga0395901_0170111 3300038443 Bacteria 2286
62 Ga0451841_0064670 3300041498 Bacteria 784
63 Ga0451841_0974390 3300041498 Bacteria 768
64 Ga0451853_1802017 3300041512 Bacteria 1131
65 Ga0439449_0174396 3300042007 Bacteria 803
66 Ga0466965_0056117 3300044683 Bacteria 1961
67 Ga0466963_0341463 3300044694 Bacteria 1054
68 Ga0466968_0043214 3300044735 Bacteria 1907
69 Ga0466970_0000059 3300044765 Bacteria 42863
70 Ga0466970_0096348 3300044765 Bacteria 1609
71 Ga0466957_0065562 3300044842 Bacteria 2237
72 Ga0466960_0035363 3300044901 Bacteria 2334
73 Ga0466960_0043707 3300044901 Bacteria 2133
74 Ga0466959_0108808 3300045049 Bacteria 1979
75 Ga0466967_0740892 3300045976 Bacteria 974
76 Ga0495627_005227 3300046453 Bacteria 5269
77 Ga0495650_0185367 3300046471 Bacteria 730
78 Ga0495654_0047077 3300046530 Bacteria 2121
79 Ga0495645_0047280 3300046543 Bacteria 3135
80 Ga0495635_0163180 3300046663 Bacteria 1516
81 Ga0495671_0054966 3300046692 Bacteria 1973
82 Ga0495615_0012771 3300048090 Bacteria 1740
83 Ga0496100_0107507 3300048903 Bacteria 1932
84 Ga0496100_0713165 3300048903 Bacteria 783
85 Ga0496101_0054127 3300048904 Bacteria 2897
86 Ga0496102_0152489 3300048905 Bacteria 2172
87 Ga0496103_0015255 3300048906 Bacteria 4569
88 Ga0496104_0056680 3300048907 Bacteria 3706
89 Ga0496104_0102349 3300048907 Bacteria 2743
90 Ga0496104_0490863 3300048907 Bacteria 1139
91 Ga0496105_0027107 3300048908 Bacteria 4678
92 Ga0496105_0474187 3300048908 Bacteria 985
93 Ga0496106_0209973 3300048909 Bacteria 1551
94 Ga0496108_0013265 3300048911 Bacteria 6717
95 Ga0496109_0035247 3300048912 Bacteria 4512
96 Ga0496109_0040178 3300048912 Bacteria 4236
97 Ga0496110_0066416 3300048913 Bacteria 3190
98 Ga0496110_0194793 3300048913 Bacteria 1840
99 Ga0496111_0208232 3300048914 Bacteria 1453
100 Ga0496112_0078662 3300048915 Bacteria 3261
101 Ga0496113_0106126 3300048916 Bacteria 2181
102 Ga0496114_0081323 3300048917 Bacteria 2736
103 Ga0496114_0144409 3300048917 Bacteria 2062
104 Ga0496114_0215794 3300048917 Bacteria 1683
105 Ga0496114_0318322 3300048917 Bacteria 1374
106 Ga0496114_0572538 3300048917 Bacteria 997
107 Ga0496115_0126372 3300048918 Bacteria 2106
108 Ga0496115_0293043 3300048918 Bacteria 1334
109 Ga0496116_0010001 3300048919 Bacteria 8008
110 Ga0496117_0000413 3300048920 Bacteria 71922
111 Ga0496117_0001712 3300048920 Bacteria 30358
112 Ga0496117_0025541 3300048920 Bacteria 4642
113 Ga0496117_0026108 3300048920 Bacteria 4575
114 Ga0496118_0003883 3300048921 Bacteria 18347
115 Ga0496118_0028561 3300048921 Bacteria 4695
116 Ga0496119_0002426 3300048922 Bacteria 20470
117 Ga0496119_0003224 3300048922 Bacteria 17071
118 Ga0496119_0003989 3300048922 Bacteria 14944
119 Ga0496119_0058108 3300048922 Bacteria 2333
120 Ga0496119_0135498 3300048922 Bacteria 1336
121 Ga0496120_0001021 3300048923 Bacteria 37451
122 Ga0496120_0006127 3300048923 Bacteria 9325
123 Ga0496121_0422573 3300048924 Bacteria 867
124 Ga0496122_0000054 3300048925 Bacteria 259135
125 Ga0496122_0004961 3300048925 Bacteria 16123
126 Ga0496122_0009423 3300048925 Bacteria 10292
127 Ga0496122_0033891 3300048925 Bacteria 4191
128 Ga0496122_0113508 3300048925 Bacteria 1770
129 Ga0496122_0133645 3300048925 Bacteria 1569
130 Ga0496122_0323701 3300048925 Bacteria 818
131 Ga0496123_0000039 3300048926 Bacteria 259107
132 Ga0496123_0013670 3300048926 Bacteria 6789
133 Ga0496123_0150762 3300048926 Bacteria 1255
134 Ga0496124_0012959 3300048927 Bacteria 8176
135 Ga0496124_0027037 3300048927 Bacteria 5160
136 Ga0496124_0080851 3300048927 Bacteria 2673
137 Ga0496124_0097548 3300048927 Bacteria 2386
138 Ga0496124_0098568 3300048927 Bacteria 2371
139 Ga0496125_0000061 3300048928 Bacteria 262739
140 Ga0496125_0000640 3300048928 Bacteria 58381
141 Ga0496125_0007492 3300048928 Bacteria 11609
142 Ga0496125_0009892 3300048928 Bacteria 9701
143 Ga0496125_0011812 3300048928 Bacteria 8703
144 Ga0496125_0048646 3300048928 Bacteria 3534
145 Ga0496125_0212461 3300048928 Bacteria 1255
146 Ga0496125_0388314 3300048928 Bacteria 820
147 Ga0496126_0002895 3300048929 Bacteria 22382
148 Ga0496126_0009186 3300048929 Bacteria 10546
149 Ga0496126_0025768 3300048929 Bacteria 5650
150 Ga0496126_0149308 3300048929 Bacteria 2004
151 Ga0496126_0477205 3300048929 Bacteria 1000
152 Ga0501032_0200738 3300049569 Bacteria 1301
153 Ga0501032_0203152 3300049569 Bacteria 1293
154 Ga0501033_0065459 3300049570 Bacteria 2674
155 Ga0501034_0007620 3300049571 Bacteria 11518
156 Ga0501034_0082789 3300049571 Bacteria 3211
157 Ga0501037_0237659 3300049573 Bacteria 1278
158 Ga0501038_0024459 3300049574 Bacteria 5389
159 Ga0501038_0025638 3300049574 Bacteria 5253
160 Ga0501039_0107742 3300049575 Bacteria 2177
161 Ga0501040_0344800 3300049576 Bacteria 1067
162 Ga0501043_0141241 3300049579 Bacteria 1886
163 Ga0501043_0213316 3300049579 Bacteria 1496
164 Ga0501043_0419901 3300049579 Bacteria 1008
165 Ga0501047_0157724 3300049581 Bacteria 2142
166 Ga0501070_0005916 3300049586 Bacteria 10432
167 Ga0501070_0523548 3300049586 Bacteria 951
168 Ga0501070_0545420 3300049586 Bacteria 929
169 Ga0501083_0004971 3300049744 Bacteria 9422
170 nmdc:mga03n38_14320_c1 3300050490 Bacteria 3036
171 nmdc:mga00v17_130757_c1 3300050491 Bacteria 1604
172 nmdc:mga00v17_180478_c1 3300050491 Bacteria 1362
173 nmdc:mga00v17_20501_c1 3300050491 Bacteria 3788
174 nmdc:mga00v17_7467_c1 3300050491 Bacteria 3061
175 nmdc:mga0yw44_82030_c1 3300050492 Bacteria 2023
176 nmdc:mga06z11_4915_c1 3300050494 Bacteria 5306
177 nmdc:mga04h51_62496_c1 3300050495 Bacteria 1280
178 nmdc:mga07m45_106998_c1 3300050496 Bacteria 1609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046530 Ga0495654_0047077 Ga0495654_0047077_1374_1916 163
2 3300017792 Ga0163161_10357206 Ga0163161_103572061 165
3 3300025940 Ga0207691_10733528 Ga0207691_107335281 165
4 3300042007 Ga0439449_0174396 Ga0439449_0174396_120_641 172
5 3300044694 Ga0466963_0341463 Ga0466963_0341463_18_545 172
6 3300045049 Ga0466959_0108808 Ga0466959_0108808_1442_1969 172
7 3300046543 Ga0495645_0047280 Ga0495645_0047280_1986_2504 172
8 3300048917 Ga0496114_0144409 Ga0496114_0144409_907_1425 172
9 3300005337 Ga0070682_100979949 Ga0070682_1009799491 173
10 3300031731 Ga0307405_10195031 Ga0307405_101950311 173
11 3300031824 Ga0307413_10041255 Ga0307413_100412552 173
12 3300031852 Ga0307410_10945255 Ga0307410_109452552 173
13 3300032126 Ga0307415_100485849 Ga0307415_1004858492 173
14 3300009545 Ga0105237_10647276 Ga0105237_106472762 175
15 3300013105 Ga0157369_10125916 Ga0157369_101259162 175
16 3300037312 Ga0395899_0186539 Ga0395899_0186539_540_1139 175
17 3300046663 Ga0495635_0163180 Ga0495635_0163180_459_1058 175
18 3300048917 Ga0496114_0318322 Ga0496114_0318322_152_679 175
19 3300005339 Ga0070660_100125000 Ga0070660_1001250003 176
20 3300005341 Ga0070691_10238146 Ga0070691_102381462 176
21 3300005366 Ga0070659_100214575 Ga0070659_1002145752 176
22 3300005539 Ga0068853_100180723 Ga0068853_1001807232 176
23 3300017792 Ga0163161_10482811 Ga0163161_104828112 176
24 3300025904 Ga0207647_10112952 Ga0207647_101129521 176
25 3300025919 Ga0207657_10147571 Ga0207657_101475712 176
26 3300031731 Ga0307405_10722907 Ga0307405_107229072 176
27 3300031901 Ga0307406_10039141 Ga0307406_100391412 176
28 3300031995 Ga0307409_100092581 Ga0307409_1000925813 176
29 3300032004 Ga0307414_10256456 Ga0307414_102564562 176
30 3300041512 Ga0451853_1802017 Ga0451853_1802017_519_1052 176
31 3300048903 Ga0496100_0713165 Ga0496100_0713165_73_606 176
32 3300048907 Ga0496104_0102349 Ga0496104_0102349_88_621 176
33 3300048907 Ga0496104_0490863 Ga0496104_0490863_107_640 176
34 3300048908 Ga0496105_0027107 Ga0496105_0027107_2404_2937 176
35 3300048908 Ga0496105_0474187 Ga0496105_0474187_85_618 176
36 3300048911 Ga0496108_0013265 Ga0496108_0013265_29_562 176
37 3300048912 Ga0496109_0035247 Ga0496109_0035247_1985_2518 176
38 3300048913 Ga0496110_0194793 Ga0496110_0194793_1157_1690 176
39 3300048914 Ga0496111_0208232 Ga0496111_0208232_252_785 176
40 3300048917 Ga0496114_0081323 Ga0496114_0081323_1416_1949 176
41 3300048918 Ga0496115_0293043 Ga0496115_0293043_96_629 176
42 iso_pu_bacteria 2808606368 2808885609 176
43 iso_pu_bacteria 2906799679 2906802992 176
44 iso_pu_bacteria 2995726249 2995728021 177
45 3300006051 Ga0075364_10111106 Ga0075364_101111062 178
46 3300013307 Ga0157372_10024874 Ga0157372_100248744 178
47 3300048903 Ga0496100_0107507 Ga0496100_0107507_208_795 178
48 3300048904 Ga0496101_0054127 Ga0496101_0054127_558_1145 178
49 3300048905 Ga0496102_0152489 Ga0496102_0152489_1260_1847 178
50 3300048906 Ga0496103_0015255 Ga0496103_0015255_3091_3678 178
51 3300048907 Ga0496104_0056680 Ga0496104_0056680_1412_1999 178
52 3300048909 Ga0496106_0209973 Ga0496106_0209973_617_1204 178
53 3300048912 Ga0496109_0040178 Ga0496109_0040178_2683_3270 178
54 3300048913 Ga0496110_0066416 Ga0496110_0066416_948_1535 178
55 3300048915 Ga0496112_0078662 Ga0496112_0078662_796_1383 178
56 3300048916 Ga0496113_0106126 Ga0496113_0106126_1387_1974 178
57 3300048917 Ga0496114_0215794 Ga0496114_0215794_651_1238 178
58 3300048918 Ga0496115_0126372 Ga0496115_0126372_532_1119 178
59 3300048922 Ga0496119_0135498 Ga0496119_0135498_339_923 178
60 3300048925 Ga0496122_0113508 Ga0496122_0113508_750_1337 178
61 3300049586 Ga0501070_0005916 Ga0501070_0005916_3954_4541 178
62 3300050491 nmdc:mga00v17_130757_c1 nmdc:mga00v17_130757_c1_79_669 178
63 iso_pu_bacteria 2870628048 2870630319 178
64 3300003320 rootH2_10254580 rootH2_102545802 179
65 3300003578 Ga0006562J51391_1084319 Ga0006562J51391_10843193 179
66 3300003578 Ga0006562J51391_1084321 Ga0006562J51391_10843212 179
67 3300005367 Ga0070667_100834145 Ga0070667_1008341452 179
68 3300005577 Ga0068857_100249406 Ga0068857_1002494062 179
69 3300006038 Ga0075365_10008441 Ga0075365_100084414 179
70 3300006048 Ga0075363_100009456 Ga0075363_1000094563 179
71 3300006051 Ga0075364_10006699 Ga0075364_100066994 179
72 3300006051 Ga0075364_10070222 Ga0075364_100702222 179
73 3300006051 Ga0075364_10237362 Ga0075364_102373622 179
74 3300006178 Ga0075367_10002488 Ga0075367_100024882 179
75 3300006353 Ga0075370_10020695 Ga0075370_100206954 179
76 3300009036 Ga0105244_10031553 Ga0105244_100315533 179
77 3300009148 Ga0105243_10154396 Ga0105243_101543962 179
78 3300013104 Ga0157370_10347837 Ga0157370_103478372 179
79 3300013105 Ga0157369_10462255 Ga0157369_104622552 179
80 3300013250 Ga0171462_1003 Ga0171462_1003439 179
81 3300014326 Ga0157380_10345003 Ga0157380_103450032 179
82 3300025246 Ga0209646_1000167 Ga0209646_100016766 179
83 3300025728 Ga0207655_1020938 Ga0207655_10209383 179
84 3300025728 Ga0207655_1022391 Ga0207655_10223913 179
85 3300025935 Ga0207709_10118181 Ga0207709_101181812 179
86 3300025986 Ga0207658_10953202 Ga0207658_109532021 179
87 3300026116 Ga0207674_10165537 Ga0207674_101655373 179
88 3300031548 Ga0307408_100275039 Ga0307408_1002750392 179
89 3300031901 Ga0307406_10000187 Ga0307406_1000018721 179
90 3300031901 Ga0307406_10003749 Ga0307406_100037494 179
91 3300031901 Ga0307406_10009556 Ga0307406_100095565 179
92 3300031901 Ga0307406_10094101 Ga0307406_100941013 179
93 3300031901 Ga0307406_10146690 Ga0307406_101466902 179
94 3300031901 Ga0307406_10338975 Ga0307406_103389752 179
95 3300031901 Ga0307406_10627715 Ga0307406_106277152 179
96 3300031903 Ga0307407_10469904 Ga0307407_104699042 179
97 3300032004 Ga0307414_10009977 Ga0307414_100099772 179
98 3300032004 Ga0307414_10135630 Ga0307414_101356302 179
99 3300032004 Ga0307414_11398425 Ga0307414_113984251 179
100 3300037466 Ga0395898_0029926 Ga0395898_0029926_2882_3463 179
101 3300038443 Ga0395901_0170111 Ga0395901_0170111_1229_1810 179
102 3300041498 Ga0451841_0064670 Ga0451841_0064670_161_742 179
103 3300041498 Ga0451841_0974390 Ga0451841_0974390_28_618 179
104 3300044683 Ga0466965_0056117 Ga0466965_0056117_783_1373 179
105 3300044735 Ga0466968_0043214 Ga0466968_0043214_614_1204 179
106 3300044765 Ga0466970_0000059 Ga0466970_0000059_36910_37491 179
107 3300044765 Ga0466970_0096348 Ga0466970_0096348_272_862 179
108 3300044842 Ga0466957_0065562 Ga0466957_0065562_237_818 179
109 3300044901 Ga0466960_0035363 Ga0466960_0035363_1295_1885 179
110 3300044901 Ga0466960_0043707 Ga0466960_0043707_177_767 179
111 3300045976 Ga0466967_0740892 Ga0466967_0740892_17_598 179
112 3300046453 Ga0495627_005227 Ga0495627_005227_3227_3808 179
113 3300046471 Ga0495650_0185367 Ga0495650_0185367_92_682 179
114 3300046692 Ga0495671_0054966 Ga0495671_0054966_673_1263 179
115 3300048090 Ga0495615_0012771 Ga0495615_0012771_133_723 179
116 3300048917 Ga0496114_0572538 Ga0496114_0572538_151_732 179
117 3300048919 Ga0496116_0010001 Ga0496116_0010001_6635_7222 179
118 3300048920 Ga0496117_0000413 Ga0496117_0000413_48489_49085 179
119 3300048920 Ga0496117_0001712 Ga0496117_0001712_26173_26754 179
120 3300048920 Ga0496117_0025541 Ga0496117_0025541_1462_2049 179
121 3300048920 Ga0496117_0026108 Ga0496117_0026108_2324_2920 179
122 3300048921 Ga0496118_0003883 Ga0496118_0003883_11579_12166 179
123 3300048921 Ga0496118_0028561 Ga0496118_0028561_2837_3418 179
124 3300048922 Ga0496119_0002426 Ga0496119_0002426_15301_15846 179
125 3300048922 Ga0496119_0003224 Ga0496119_0003224_11165_11755 179
126 3300048922 Ga0496119_0003989 Ga0496119_0003989_3862_4449 179
127 3300048922 Ga0496119_0058108 Ga0496119_0058108_731_1312 179
128 3300048923 Ga0496120_0001021 Ga0496120_0001021_16924_17514 179
129 3300048923 Ga0496120_0006127 Ga0496120_0006127_2035_2631 179
130 3300048924 Ga0496121_0422573 Ga0496121_0422573_110_691 179
131 3300048925 Ga0496122_0000054 Ga0496122_0000054_88870_89457 179
132 3300048925 Ga0496122_0004961 Ga0496122_0004961_9267_9848 179
133 3300048925 Ga0496122_0009423 Ga0496122_0009423_4629_5225 179
134 3300048925 Ga0496122_0033891 Ga0496122_0033891_1709_2290 179
135 3300048925 Ga0496122_0133645 Ga0496122_0133645_432_1028 179
136 3300048925 Ga0496122_0323701 Ga0496122_0323701_167_748 179
137 3300048926 Ga0496123_0000039 Ga0496123_0000039_88870_89457 179
138 3300048926 Ga0496123_0013670 Ga0496123_0013670_942_1538 179
139 3300048926 Ga0496123_0150762 Ga0496123_0150762_655_1236 179
140 3300048927 Ga0496124_0012959 Ga0496124_0012959_2506_3096 179
141 3300048927 Ga0496124_0027037 Ga0496124_0027037_841_1428 179
142 3300048927 Ga0496124_0080851 Ga0496124_0080851_1383_1979 179
143 3300048927 Ga0496124_0097548 Ga0496124_0097548_486_1082 179
144 3300048927 Ga0496124_0098568 Ga0496124_0098568_929_1510 179
145 3300048928 Ga0496125_0000061 Ga0496125_0000061_127862_128449 179
146 3300048928 Ga0496125_0000640 Ga0496125_0000640_14635_15216 179
147 3300048928 Ga0496125_0007492 Ga0496125_0007492_10606_11193 179
148 3300048928 Ga0496125_0009892 Ga0496125_0009892_6294_6890 179
149 3300048928 Ga0496125_0011812 Ga0496125_0011812_6798_7379 179
150 3300048928 Ga0496125_0048646 Ga0496125_0048646_2487_3068 179
151 3300048928 Ga0496125_0212461 Ga0496125_0212461_645_1226 179
152 3300048928 Ga0496125_0388314 Ga0496125_0388314_24_605 179
153 3300048929 Ga0496126_0002895 Ga0496126_0002895_20764_21360 179
154 3300048929 Ga0496126_0009186 Ga0496126_0009186_8152_8739 179
155 3300048929 Ga0496126_0025768 Ga0496126_0025768_4773_5354 179
156 3300048929 Ga0496126_0149308 Ga0496126_0149308_820_1401 179
157 3300048929 Ga0496126_0477205 Ga0496126_0477205_84_665 179
158 3300049569 Ga0501032_0200738 Ga0501032_0200738_542_1093 179
159 3300049569 Ga0501032_0203152 Ga0501032_0203152_207_797 179
160 3300049570 Ga0501033_0065459 Ga0501033_0065459_1156_1707 179
161 3300049571 Ga0501034_0007620 Ga0501034_0007620_10399_10980 179
162 3300049571 Ga0501034_0082789 Ga0501034_0082789_2583_3164 179
163 3300049573 Ga0501037_0237659 Ga0501037_0237659_341_931 179
164 3300049574 Ga0501038_0024459 Ga0501038_0024459_4109_4690 179
165 3300049574 Ga0501038_0025638 Ga0501038_0025638_998_1579 179
166 3300049575 Ga0501039_0107742 Ga0501039_0107742_1379_1969 179
167 3300049576 Ga0501040_0344800 Ga0501040_0344800_59_649 179
168 3300049579 Ga0501043_0141241 Ga0501043_0141241_1154_1744 179
169 3300049579 Ga0501043_0213316 Ga0501043_0213316_19_600 179
170 3300049579 Ga0501043_0419901 Ga0501043_0419901_290_841 179
171 3300049581 Ga0501047_0157724 Ga0501047_0157724_416_967 179
172 3300049586 Ga0501070_0523548 Ga0501070_0523548_270_851 179
173 3300049586 Ga0501070_0545420 Ga0501070_0545420_191_781 179
174 3300049744 Ga0501083_0004971 Ga0501083_0004971_4072_4623 179
175 3300050490 nmdc:mga03n38_14320_c1 nmdc:mga03n38_14320_c1_1794_2363 179
176 3300050491 nmdc:mga00v17_180478_c1 nmdc:mga00v17_180478_c1_382_972 179
177 3300050491 nmdc:mga00v17_20501_c1 nmdc:mga00v17_20501_c1_236_805 179
178 3300050491 nmdc:mga00v17_7467_c1 nmdc:mga00v17_7467_c1_1288_1869 179
179 3300050492 nmdc:mga0yw44_82030_c1 nmdc:mga0yw44_82030_c1_457_1026 179
180 3300050494 nmdc:mga06z11_4915_c1 nmdc:mga06z11_4915_c1_1878_2447 179
181 3300050495 nmdc:mga04h51_62496_c1 nmdc:mga04h51_62496_c1_306_875 179
182 3300050496 nmdc:mga07m45_106998_c1 nmdc:mga07m45_106998_c1_919_1488 179
183 iso_pu_bacteria 2643221542 2643733620 179
184 iso_pu_bacteria 2643221546 2643752083 179
185 iso_pu_bacteria 2643221553 2643785825 179
186 iso_pu_bacteria 2643221566 2643848333 179
187 iso_pu_bacteria 2643221575 2643885487 179
188 iso_pu_bacteria 2643221597 2643995774 179
189 iso_pu_bacteria 2643221630 2644170195 179
190 iso_pu_bacteria 2643221724 2644680228 179
191 iso_pu_bacteria 2728369380 2730229679 179
192 iso_pu_bacteria 2747842429 2747951759 179
193 iso_pu_bacteria 2757320536 2758226170 179
194 iso_pu_bacteria 2773857758 2774380487 179
195 iso_pu_bacteria 2773857759 2774384477 179
196 iso_pu_bacteria 2773857763 2774399574 179
197 iso_pu_bacteria 2808606306 2808631230 179
198 iso_pu_bacteria 2808606447 2809227295 179
199 iso_pu_bacteria 2811994872 2812323075 179
200 iso_pu_bacteria 2821268502 2821269973 179
201 iso_pu_bacteria 2833709550 2833710916 179
202 iso_pu_bacteria 2852632344 2852633324 179
203 iso_pu_bacteria 2852663356 2852665303 179
204 iso_pu_bacteria 2857720070 2857721138 179
205 iso_pu_bacteria 2857723135 2857723849 179
206 iso_pu_bacteria 2904509784 2904512057 179
207 iso_pu_bacteria 2908678064 2908680974 179
208 iso_pu_bacteria 2919069694 2919072556 179
209 iso_pu_bacteria 2928090899 2928092213 179
210 iso_pu_bacteria 2945968032 2945971801 179
211 iso_pu_bacteria 2946041624 2946044255 179
212 iso_pu_bacteria 2946080515 2946080900 179
213 iso_pu_bacteria 2974294766 2974297114 179
214 iso_pu_bacteria 2974324384 2974326651 179
215 iso_pu_bacteria 2977228692 2977231350 179
216 iso_pu_bacteria 2977236895 2977240131 179
217 iso_pu_bacteria 2977251589 2977253935 179
218 iso_pu_bacteria 2977264416 2977266573 179
219 iso_pu_bacteria 2984542743 2984545596 179
220 iso_pu_bacteria 2984580707 2984581013 179
221 iso_pu_bacteria 8004182704 8004185122 179
222 iso_pu_bacteria 8004212874 8004214270 179
223 iso_pu_bacteria 8016254467 8016257607 179
224 iso_pu_bacteria 8045830549 8045831551 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11452

DUF3000

Protein of unknown function (DUF3000)

11

188

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.6048 82 128
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.5684 76 118
8d8l-assembly1.cif.gz_J yeast mitochondrial small subunit assembly intermediate (state 3) 0.5508 88 157
4fpq-assembly1.cif.gz_A structure of a fungal protein 0.534 67 155
1ufl-assembly1.cif.gz_A crystal structure of tt1020 from thermus thermophilus hb8 0.4952 67 154
ID Description Score Start End Superfamily
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9135 2 169 3.30.1460.10
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8544 2 169 3.30.1460.10
af_F1RC56_67_147_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6962 13 36 3.30.160.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.6435 87 130 3.30.300.20
af_P40959_128_273_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.6262 9 38 3.30.1520.10
ID Description Score Start End GO Terms
AF-A0A2S9QRD6-F1-model_v4 Enoyl-CoA hydratase 0.9624 2 162
AF-A0A3N9Y730-F1-model_v4 DUF3000 domain-containing protein 0.9488 2 157
AF-A0A1P8UCJ5-F1-model_v4 Enoyl-CoA hydratase 0.9391 2 177
AF-A0A7W9FCH9-F1-model_v4 DUF3000 family protein 0.9375 2 179
AF-A0A429H9D6-F1-model_v4 deleted 0.9373 2 125

Feature Viewer

pLDDT pTM Quality
87.91 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map