F336640

General Info

Members Datasets Scaffolds Average Seq Length
224 146 448 296

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10304764|Ga0105245_103047642
Length 308
Sequence MAVQVNSPAVLELVDEDSELERLGTGFTFTEGPLWNPDGFLLFSDMPGDVRRRWDPESGVTEVANPSNKGNGMTFDLDGRLIVCEHVTSSVVRMDPDGTGSGREVIASHYGDKELNAPNDVVVKSDGAIYFSDPTYGRMPVFGIEREQDLDFQGVYRIPPGGGDTQLLADDFGQPNGLCFSTDESLLYVNDTEKAHIRVFDVLADGSIANSRVLADGIGTASLELGDLVDGMKLDERGNIWVTGPGGVCVFSAEGEHIGTVEVPEPVGNLNWARPPGGSTWNQLFIPATSSVYRIECKVSGNRLPYMR

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
88 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
89 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
90 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
91 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
92 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
93 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 26.34
Rhizosphere 70.09
Stem 0
Stem Tuber 0
Unclassified 5.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10304764 3300009098 Bacteria 1564
2 Ga0070658_10008061 3300005327 Bacteria 8472
3 Ga0070683_100091882 3300005329 Bacteria 2851
4 Ga0070690_100302221 3300005330 Unclassified 1148
5 Ga0070660_100013342 3300005339 Bacteria 5891
6 Ga0070671_100107169 3300005355 Bacteria 2346
7 Ga0070703_10014960 3300005406 Bacteria 2216
8 Ga0070709_10175845 3300005434 Bacteria 1500
9 Ga0070713_100063564 3300005436 Bacteria 3095
10 Ga0070710_10062236 3300005437 Bacteria 2128
11 Ga0070711_100083227 3300005439 Bacteria 2286
12 Ga0070711_100421214 3300005439 Bacteria 1088
13 Ga0070705_100045986 3300005440 Bacteria 2514
14 Ga0070694_100107894 3300005444 Bacteria 1979
15 Ga0070681_10164283 3300005458 Bacteria 2143
16 Ga0070706_100021289 3300005467 Bacteria 5972
17 Ga0070706_100026780 3300005467 Bacteria 5303
18 Ga0070706_100273940 3300005467 Bacteria 1575
19 Ga0070698_100015650 3300005471 Bacteria 8011
20 Ga0070698_100033052 3300005471 Bacteria 5359
21 Ga0070698_100201890 3300005471 Bacteria 1924
22 Ga0070699_100053182 3300005518 Bacteria 3505
23 Ga0070679_100207510 3300005530 Bacteria 1923
24 Ga0070684_100174721 3300005535 Bacteria 1952
25 Ga0070693_100147048 3300005547 Bacteria 1489
26 Ga0070665_100001176 3300005548 Bacteria 32073
27 Ga0070704_100008702 3300005549 Bacteria 6104
28 Ga0068855_100233940 3300005563 Bacteria 2056
29 Ga0081455_10091617 3300005937 Bacteria 2461
30 Ga0081540_1000499 3300005983 Bacteria 38575
31 Ga0081539_10007907 3300005985 Bacteria 9479
32 Ga0081539_10062512 3300005985 Bacteria 2035
33 Ga0070717_10076432 3300006028 Bacteria 2803
34 Ga0070717_10081956 3300006028 Bacteria 2710
35 Ga0075430_100078227 3300006846 Bacteria 2773
36 Ga0075434_100282959 3300006871 Unclassified 1678
37 Ga0111539_10494144 3300009094 Bacteria 1425
38 Ga0105245_10016106 3300009098 Bacteria 6514
39 Ga0114129_10058045 3300009147 Bacteria 5414
40 Ga0105243_10007847 3300009148 Bacteria 8204
41 Ga0105242_10109403 3300009176 Bacteria 2353
42 Ga0105249_10120508 3300009553 Bacteria 2492
43 Ga0105239_10068946 3300010375 Bacteria 3886
44 Ga0157373_10095117 3300013100 Bacteria 2097
45 Ga0157374_10598310 3300013296 Bacteria 1113
46 Ga0163163_10461434 3300014325 Bacteria 1331
47 Ga0157376_10268875 3300014969 Bacteria 1600
48 Ga0207653_10005020 3300025885 Bacteria 4135
49 Ga0207705_10023043 3300025909 Bacteria 4441
50 Ga0207684_10093149 3300025910 Bacteria 2569
51 Ga0207693_10001920 3300025915 Bacteria 18192
52 Ga0207657_10027418 3300025919 Bacteria 5217
53 Ga0207646_10304127 3300025922 Bacteria 1441
54 Ga0207690_10361092 3300025932 Bacteria 1151
55 Ga0207686_10067164 3300025934 Bacteria 2293
56 Ga0207709_10016881 3300025935 Bacteria 4067
57 Ga0207665_10001869 3300025939 Bacteria 14192
58 Ga0207661_10012443 3300025944 Bacteria 6183
59 Ga0207677_10353270 3300026023 Bacteria 1232
60 Ga0207674_10238244 3300026116 Bacteria 1766
61 Ga0207675_100101499 3300026118 Bacteria 2711
62 Ga0268266_10007616 3300028379 Bacteria 9748
63 Ga0265337_1044986 3300028556 Unclassified 1258
64 Ga0265319_1005320 3300028563 Bacteria 6180
65 Ga0265319_1006869 3300028563 Bacteria 5197
66 Ga0265334_10025542 3300028573 Bacteria 2390
67 Ga0265318_10001232 3300028577 Bacteria 15562
68 Ga0265318_10003613 3300028577 Bacteria 7729
69 Ga0265318_10007386 3300028577 Bacteria 4972
70 Ga0265336_10009805 3300028666 Bacteria 3300
71 Ga0265338_10005680 3300028800 Bacteria 16151
72 Ga0265338_10037237 3300028800 Bacteria 4636
73 Ga0265338_10171002 3300028800 Bacteria 1666
74 Ga0265330_10000741 3300031235 Bacteria 20624
75 Ga0265332_10004250 3300031238 Bacteria 6771
76 Ga0265328_10012195 3300031239 Bacteria 3422
77 Ga0265328_10080582 3300031239 Unclassified 1200
78 Ga0265320_10056821 3300031240 Bacteria 1879
79 Ga0265320_10056901 3300031240 Bacteria 1877
80 Ga0265325_10002808 3300031241 Bacteria 11620
81 Ga0265325_10012438 3300031241 Bacteria 4866
82 Ga0265329_10016654 3300031242 Bacteria 2544
83 Ga0265340_10002375 3300031247 Bacteria 10712
84 Ga0265340_10109401 3300031247 Unclassified 1278
85 Ga0265339_10019570 3300031249 Bacteria 3972
86 Ga0265339_10054807 3300031249 Bacteria 2164
87 Ga0265331_10010752 3300031250 Bacteria 5036
88 Ga0265331_10069163 3300031250 Unclassified 1654
89 Ga0265327_10009374 3300031251 Bacteria 7074
90 Ga0265327_10038236 3300031251 Unclassified 2620
91 Ga0265327_10072122 3300031251 Bacteria 1726
92 Ga0265316_10097569 3300031344 Bacteria 2236
93 Ga0265342_10041365 3300031712 Unclassified 2791
94 Ga0307410_10408331 3300031852 Bacteria 1099
95 Ga0307416_100043183 3300032002 Bacteria 3528
96 Ga0307416_100424283 3300032002 Bacteria 1375
97 Ga0373944_0035455 3300035089 Bacteria 1521
98 Ga0373945_0120379 3300035116 Bacteria 1043
99 Ga0373943_0037253 3300035170 Bacteria 2334
100 Ga0373943_0069771 3300035170 Bacteria 1777
101 Ga0373946_0046193 3300035171 Bacteria 1804
102 Ga0373946_0073899 3300035171 Unclassified 1479
103 Ga0373935_0158012 3300035692 Bacteria 1543
104 Ga0373947_0022800 3300035725 Bacteria 3634
105 Ga0373947_0079910 3300035725 Bacteria 2022
106 Ga0373925_0011766 3300037068 Bacteria 6332
107 Ga0373925_0064824 3300037068 Bacteria 2751
108 Ga0395899_0143483 3300037312 Bacteria 1697
109 Ga0395898_0476519 3300037466 Bacteria 1187
110 Ga0395905_0034957 3300037471 Bacteria 4717
111 Ga0395901_0450693 3300038443 Bacteria 1316
112 Ga0436365_1339243 3300039437 Bacteria 7314
113 Ga0451789_0287821 3300041443 Bacteria 1336
114 Ga0451795_1415627 3300041456 Unclassified 1367
115 Ga0451802_1873493 3300041460 Bacteria 1955
116 Ga0451807_1499648 3300041486 Bacteria 3196
117 Ga0451847_0846431 3300041503 Bacteria 3147
118 Ga0451849_1070086 3300041505 Bacteria 2821
119 Ga0451855_1102971 3300041511 Bacteria 3217
120 Ga0466966_0233641 3300044684 Bacteria 1109
121 Ga0466961_0189439 3300044693 Bacteria 1275
122 Ga0466963_0053252 3300044694 Bacteria 2687
123 Ga0466963_0086188 3300044694 Bacteria 2133
124 Ga0466963_0096815 3300044694 Bacteria 2016
125 Ga0466963_0133685 3300044694 Bacteria 1715
126 Ga0466971_0015135 3300044719 Bacteria 3394
127 Ga0466968_0013691 3300044735 Bacteria 3192
128 Ga0466957_0003689 3300044842 Bacteria 8455
129 Ga0466959_0020678 3300045049 Bacteria 4850
130 Ga0466967_0037140 3300045976 Bacteria 4165
131 Ga0466967_0126954 3300045976 Bacteria 2364
132 Ga0466967_0253904 3300045976 Bacteria 1680
133 Ga0466967_0429019 3300045976 Bacteria 1289
134 Ga0466967_0517673 3300045976 Bacteria 1172
135 Ga0495603_0109320 3300046455 Bacteria 1613
136 Ga0495590_0034239 3300046457 Bacteria 1774
137 Ga0495629_0093842 3300046459 Bacteria 2094
138 Ga0495641_0035902 3300046461 Bacteria 2332
139 Ga0495653_0113359 3300046463 Bacteria 1945
140 Ga0495582_0135004 3300046473 Bacteria 1396
141 Ga0495628_0220173 3300046516 Bacteria 1426
142 Ga0495652_0075346 3300046529 Bacteria 2803
143 Ga0495586_0017323 3300046535 Bacteria 3830
144 Ga0495658_0084285 3300046683 Bacteria 1871
145 Ga0495613_0271349 3300046689 Unclassified 1180
146 Ga0495604_0131344 3300047317 Bacteria 1800
147 Ga0495674_0016695 3300047319 Bacteria 6850
148 Ga0495674_0175472 3300047319 Bacteria 1786
149 Ga0495680_0136008 3300047322 Bacteria 1802
150 Ga0495680_0210364 3300047322 Bacteria 1393
151 Ga0496100_0013661 3300048903 Bacteria 4692
152 Ga0496100_0302805 3300048903 Bacteria 1197
153 Ga0496101_0003277 3300048904 Bacteria 10065
154 Ga0496101_0017247 3300048904 Bacteria 4895
155 Ga0496101_0026666 3300048904 Bacteria 4018
156 Ga0496101_0041581 3300048904 Bacteria 3278
157 Ga0496102_0073174 3300048905 Bacteria 3150
158 Ga0496102_0106956 3300048905 Bacteria 2604
159 Ga0496102_0263060 3300048905 Bacteria 1626
160 Ga0496104_0001596 3300048907 Bacteria 19511
161 Ga0496104_0034174 3300048907 Bacteria 4739
162 Ga0496104_0064387 3300048907 Bacteria 3477
163 Ga0496104_0235880 3300048907 Bacteria 1741
164 Ga0496104_0409004 3300048907 Bacteria 1269
165 Ga0496105_0003543 3300048908 Bacteria 11575
166 Ga0496105_0131623 3300048908 Bacteria 2062
167 Ga0496105_0151052 3300048908 Bacteria 1909
168 Ga0496105_0288395 3300048908 Bacteria 1322
169 Ga0496106_0018253 3300048909 Bacteria 5187
170 Ga0496106_0027219 3300048909 Bacteria 4258
171 Ga0496106_0138796 3300048909 Bacteria 1911
172 Ga0496106_0197277 3300048909 Bacteria 1601
173 Ga0496107_0023895 3300048910 Bacteria 4320
174 Ga0496107_0032257 3300048910 Bacteria 3743
175 Ga0496107_0136726 3300048910 Bacteria 1810
176 Ga0496108_0002298 3300048911 Bacteria 15310
177 Ga0496108_0016513 3300048911 Bacteria 6025
178 Ga0496108_0017478 3300048911 Bacteria 5868
179 Ga0496108_0676967 3300048911 Bacteria 896
180 Ga0496109_0004319 3300048912 Bacteria 11870
181 Ga0496109_0006151 3300048912 Bacteria 10089
182 Ga0496109_0020182 3300048912 Bacteria 5887
183 Ga0496109_0057116 3300048912 Bacteria 3561
184 Ga0496110_0005746 3300048913 Bacteria 9742
185 Ga0496110_0042837 3300048913 Bacteria 3951
186 Ga0496110_0084998 3300048913 Bacteria 2825
187 Ga0496110_0256133 3300048913 Bacteria 1593
188 Ga0496111_0001932 3300048914 Bacteria 12266
189 Ga0496111_0082376 3300048914 Bacteria 2350
190 Ga0496111_0223281 3300048914 Bacteria 1399
191 Ga0496111_0546339 3300048914 Bacteria 851
192 Ga0496112_0005810 3300048915 Bacteria 10736
193 Ga0496112_0044914 3300048915 Bacteria 4330
194 Ga0496112_0056627 3300048915 Bacteria 3859
195 Ga0496112_0096461 3300048915 Bacteria 2927
196 Ga0496112_0107348 3300048915 Bacteria 2762
197 Ga0496112_0120132 3300048915 Bacteria 2598
198 Ga0496113_0071374 3300048916 Bacteria 2641
199 Ga0496114_0092868 3300048917 Bacteria 2565
200 Ga0496114_0117469 3300048917 Bacteria 2285
201 Ga0496115_0000975 3300048918 Bacteria 20795
202 Ga0496115_0092324 3300048918 Bacteria 2475
203 Ga0496115_0135337 3300048918 Bacteria 2032
204 Ga0496115_0314027 3300048918 Bacteria 1283
205 Ga0496115_0392239 3300048918 Unclassified 1127
206 Ga0496122_0006124 3300048925 Bacteria 14005
207 Ga0496122_0091520 3300048925 Bacteria 2071
208 Ga0496123_0009147 3300048926 Bacteria 8960
209 Ga0496123_0035744 3300048926 Bacteria 3535
210 Ga0501036_0306397 3300049572 Bacteria 1328
211 Ga0501040_0043780 3300049576 Bacteria 3052
212 Ga0501048_0135271 3300049582 Bacteria 1742
213 Ga0501067_0002403 3300049583 Bacteria 10346
214 Ga0501068_0077247 3300049584 Bacteria 2039
215 Ga0501069_0000800 3300049585 Bacteria 14826
216 Ga0501071_0181349 3300049587 Bacteria 1578
217 Ga0501072_0204251 3300049588 Bacteria 1575
218 nmdc:mga0qj67_130279_c1 3300050509 Bacteria 2037
219 nmdc:mga0n895_291328_c1 3300050512 Unclassified 1655
220 Ga0495595_0049501 3300053084 Bacteria 1944
221 Ga0495619_0028920 3300053085 Bacteria 3577
222 Ga0501084_0116716 3300054114 Bacteria 2244
223 Ga0530510_0121703 3300061734 Bacteria 1916
224 Ga0530510_0485564 3300061734 Bacteria 936
225 Ga0105245_10304764
226 Ga0070658_10008061
227 Ga0070683_100091882
228 Ga0070690_100302221
229 Ga0070660_100013342
230 Ga0070671_100107169
231 Ga0070703_10014960
232 Ga0070709_10175845
233 Ga0070713_100063564
234 Ga0070710_10062236
235 Ga0070711_100083227
236 Ga0070711_100421214
237 Ga0070705_100045986
238 Ga0070694_100107894
239 Ga0070681_10164283
240 Ga0070706_100021289
241 Ga0070706_100026780
242 Ga0070706_100273940
243 Ga0070698_100015650
244 Ga0070698_100033052
245 Ga0070698_100201890
246 Ga0070699_100053182
247 Ga0070679_100207510
248 Ga0070684_100174721
249 Ga0070693_100147048
250 Ga0070665_100001176
251 Ga0070704_100008702
252 Ga0068855_100233940
253 Ga0081455_10091617
254 Ga0081540_1000499
255 Ga0081539_10007907
256 Ga0081539_10062512
257 Ga0070717_10076432
258 Ga0070717_10081956
259 Ga0075430_100078227
260 Ga0075434_100282959
261 Ga0111539_10494144
262 Ga0105245_10016106
263 Ga0114129_10058045
264 Ga0105243_10007847
265 Ga0105242_10109403
266 Ga0105249_10120508
267 Ga0105239_10068946
268 Ga0157373_10095117
269 Ga0157374_10598310
270 Ga0163163_10461434
271 Ga0157376_10268875
272 Ga0207653_10005020
273 Ga0207705_10023043
274 Ga0207684_10093149
275 Ga0207693_10001920
276 Ga0207657_10027418
277 Ga0207646_10304127
278 Ga0207690_10361092
279 Ga0207686_10067164
280 Ga0207709_10016881
281 Ga0207665_10001869
282 Ga0207661_10012443
283 Ga0207677_10353270
284 Ga0207674_10238244
285 Ga0207675_100101499
286 Ga0268266_10007616
287 Ga0265337_1044986
288 Ga0265319_1005320
289 Ga0265319_1006869
290 Ga0265334_10025542
291 Ga0265318_10001232
292 Ga0265318_10003613
293 Ga0265318_10007386
294 Ga0265336_10009805
295 Ga0265338_10005680
296 Ga0265338_10037237
297 Ga0265338_10171002
298 Ga0265330_10000741
299 Ga0265332_10004250
300 Ga0265328_10012195
301 Ga0265328_10080582
302 Ga0265320_10056821
303 Ga0265320_10056901
304 Ga0265325_10002808
305 Ga0265325_10012438
306 Ga0265329_10016654
307 Ga0265340_10002375
308 Ga0265340_10109401
309 Ga0265339_10019570
310 Ga0265339_10054807
311 Ga0265331_10010752
312 Ga0265331_10069163
313 Ga0265327_10009374
314 Ga0265327_10038236
315 Ga0265327_10072122
316 Ga0265316_10097569
317 Ga0265342_10041365
318 Ga0307410_10408331
319 Ga0307416_100043183
320 Ga0307416_100424283
321 Ga0373944_0035455
322 Ga0373945_0120379
323 Ga0373943_0037253
324 Ga0373943_0069771
325 Ga0373946_0046193
326 Ga0373946_0073899
327 Ga0373935_0158012
328 Ga0373947_0022800
329 Ga0373947_0079910
330 Ga0373925_0011766
331 Ga0373925_0064824
332 Ga0395899_0143483
333 Ga0395898_0476519
334 Ga0395905_0034957
335 Ga0395901_0450693
336 Ga0436365_1339243
337 Ga0451789_0287821
338 Ga0451795_1415627
339 Ga0451802_1873493
340 Ga0451807_1499648
341 Ga0451847_0846431
342 Ga0451849_1070086
343 Ga0451855_1102971
344 Ga0466966_0233641
345 Ga0466961_0189439
346 Ga0466963_0053252
347 Ga0466963_0086188
348 Ga0466963_0096815
349 Ga0466963_0133685
350 Ga0466971_0015135
351 Ga0466968_0013691
352 Ga0466957_0003689
353 Ga0466959_0020678
354 Ga0466967_0037140
355 Ga0466967_0126954
356 Ga0466967_0253904
357 Ga0466967_0429019
358 Ga0466967_0517673
359 Ga0495603_0109320
360 Ga0495590_0034239
361 Ga0495629_0093842
362 Ga0495641_0035902
363 Ga0495653_0113359
364 Ga0495582_0135004
365 Ga0495628_0220173
366 Ga0495652_0075346
367 Ga0495586_0017323
368 Ga0495658_0084285
369 Ga0495613_0271349
370 Ga0495604_0131344
371 Ga0495674_0016695
372 Ga0495674_0175472
373 Ga0495680_0136008
374 Ga0495680_0210364
375 Ga0496100_0013661
376 Ga0496100_0302805
377 Ga0496101_0003277
378 Ga0496101_0017247
379 Ga0496101_0026666
380 Ga0496101_0041581
381 Ga0496102_0073174
382 Ga0496102_0106956
383 Ga0496102_0263060
384 Ga0496104_0001596
385 Ga0496104_0034174
386 Ga0496104_0064387
387 Ga0496104_0235880
388 Ga0496104_0409004
389 Ga0496105_0003543
390 Ga0496105_0131623
391 Ga0496105_0151052
392 Ga0496105_0288395
393 Ga0496106_0018253
394 Ga0496106_0027219
395 Ga0496106_0138796
396 Ga0496106_0197277
397 Ga0496107_0023895
398 Ga0496107_0032257
399 Ga0496107_0136726
400 Ga0496108_0002298
401 Ga0496108_0016513
402 Ga0496108_0017478
403 Ga0496108_0676967
404 Ga0496109_0004319
405 Ga0496109_0006151
406 Ga0496109_0020182
407 Ga0496109_0057116
408 Ga0496110_0005746
409 Ga0496110_0042837
410 Ga0496110_0084998
411 Ga0496110_0256133
412 Ga0496111_0001932
413 Ga0496111_0082376
414 Ga0496111_0223281
415 Ga0496111_0546339
416 Ga0496112_0005810
417 Ga0496112_0044914
418 Ga0496112_0056627
419 Ga0496112_0096461
420 Ga0496112_0107348
421 Ga0496112_0120132
422 Ga0496113_0071374
423 Ga0496114_0092868
424 Ga0496114_0117469
425 Ga0496115_0000975
426 Ga0496115_0092324
427 Ga0496115_0135337
428 Ga0496115_0314027
429 Ga0496115_0392239
430 Ga0496122_0006124
431 Ga0496122_0091520
432 Ga0496123_0009147
433 Ga0496123_0035744
434 Ga0501036_0306397
435 Ga0501040_0043780
436 Ga0501048_0135271
437 Ga0501067_0002403
438 Ga0501068_0077247
439 Ga0501069_0000800
440 Ga0501071_0181349
441 Ga0501072_0204251
442 nmdc:mga0qj67_130279_c1
443 nmdc:mga0n895_291328_c1
444 Ga0495595_0049501
445 Ga0495619_0028920
446 Ga0501084_0116716
447 Ga0530510_0121703
448 Ga0530510_0485564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

29

290

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8645 2 278
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8625 2 278
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.8552 1 282
8dk0-assembly1.cif.gz_A crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma-valerolactone 0.834 20 284
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.8304 1 282
ID Description Score Start End Superfamily
af_A0A1D6MZQ1_4_154_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8665 32 132 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8645 2 278 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8392 1 282 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8229 1 282 2.120.10.30
af_A1Z9D7_705_999_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8168 26 219 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A2V7ULR1-F1-model_v4 Gluconolactonase 0.9622 22 136 GO:0016787
AF-A0A529HQS4-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9599 22 155 GO:0016787
AF-A0A537YCQ9-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9552 24 169 GO:0016787
AF-A0A526PWH6-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9552 22 141 GO:0016787
AF-A0A382MUD6-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9543 8 155 GO:0016787

Map