F336550

General Info

Members Datasets Scaffolds Average Seq Length
224 130 225 131

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100052107|Ga0097621_1000521072
Length 151
Sequence LKPLCDPAGSEKRTEIQNQRLKPSKRIPTDGGQSFGHTPFDTLSSEGLPLAAESSPAAPAHRTEAGPARKNRGRVDIIRQTAGRGGKTVTVIKGFVGIGLPEKERLAKAMQKACGTGGTVKDGQIEIQGDKRTEVARILAEANFRPVFAGG

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
64 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
88 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.11
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000558 3300000545 Bacteria 2489
2 rootH1_10199567 3300003316 Bacteria 1330
3 rootH1_10199567 3300003323 Bacteria 1696
4 Ga0070683_100864335 3300005329 Unclassified 867
5 Ga0070666_10022620 3300005335 Bacteria 4084
6 Ga0070680_100839068 3300005336 Unclassified 792
7 Ga0070689_100274975 3300005340 Bacteria 1395
8 Ga0070688_100054854 3300005365 Unclassified 2498
9 Ga0070688_100250222 3300005365 Bacteria 1261
10 Ga0070713_100054357 3300005436 Bacteria 3322
11 Ga0070701_10601154 3300005438 Bacteria 728
12 Ga0070694_100357142 3300005444 Bacteria 1134
13 Ga0070681_10086468 3300005458 Bacteria 3088
14 Ga0070681_10340618 3300005458 Unclassified 1409
15 Ga0070681_11018741 3300005458 Bacteria 748
16 Ga0070707_101387736 3300005468 Unclassified 669
17 Ga0070698_100169067 3300005471 Bacteria 2128
18 Ga0070699_101338167 3300005518 Unclassified 657
19 Ga0070679_100091928 3300005530 Unclassified 3022
20 Ga0070679_100473398 3300005530 Unclassified 1197
21 Ga0070684_100605124 3300005535 Unclassified 1019
22 Ga0070686_100045591 3300005544 Bacteria 2762
23 Ga0070686_100455239 3300005544 Bacteria 985
24 Ga0070704_100632934 3300005549 Bacteria 943
25 Ga0068857_100779248 3300005577 Unclassified 912
26 Ga0068856_101370466 3300005614 Bacteria 722
27 Ga0068859_100070015 3300005617 Unclassified 3543
28 Ga0068859_101073388 3300005617 Bacteria 885
29 Ga0068859_102746114 3300005617 Unclassified 541
30 Ga0068863_100099516 3300005841 Bacteria 2763
31 Ga0068863_100187553 3300005841 Unclassified 1987
32 Ga0068863_100482020 3300005841 Unclassified 1220
33 Ga0068863_100736250 3300005841 Bacteria 981
34 Ga0068863_101008447 3300005841 Unclassified 835
35 Ga0068863_101372118 3300005841 Bacteria 714
36 Ga0070717_10401013 3300006028 Bacteria 1232
37 Ga0070712_100303814 3300006175 Bacteria 1292
38 Ga0070712_101207503 3300006175 Unclassified 658
39 Ga0097621_100052107 3300006237 Bacteria 3333
40 Ga0075430_100017728 3300006846 Bacteria 6061
41 Ga0075429_100402388 3300006880 Unclassified 1199
42 Ga0075436_100494323 3300006914 Bacteria 894
43 Ga0097620_100070014 3300006931 Unclassified 3543
44 Ga0097620_101073407 3300006931 Bacteria 885
45 Ga0097620_102745990 3300006931 Unclassified 541
46 Ga0075435_100608203 3300007076 Bacteria 948
47 Ga0105240_10071112 3300009093 Bacteria 4303
48 Ga0105240_10198633 3300009093 Bacteria 2352
49 Ga0111539_10206554 3300009094 Bacteria 2289
50 Ga0111539_11568379 3300009094 Bacteria 764
51 Ga0105245_10477699 3300009098 Unclassified 1259
52 Ga0105245_12434305 3300009098 Unclassified 577
53 Ga0105242_10206123 3300009176 Bacteria 1749
54 Ga0105248_11847207 3300009177 Unclassified 685
55 Ga0105248_12566261 3300009177 Unclassified 581
56 Ga0105246_10256815 3300011119 Bacteria 1390
57 Ga0157370_10100212 3300013104 Unclassified 2714
58 Ga0157370_10469469 3300013104 Bacteria 1156
59 Ga0157369_10132618 3300013105 Bacteria 2639
60 Ga0157374_10052869 3300013296 Bacteria 3785
61 Ga0157374_11357590 3300013296 Unclassified 733
62 Ga0157378_12237192 3300013297 Unclassified 598
63 Ga0157372_10227395 3300013307 Bacteria 2163
64 Ga0157372_10281381 3300013307 Bacteria 1934
65 Ga0157375_10000048 3300013308 Bacteria 140600
66 Ga0163163_10088561 3300014325 Bacteria 3107
67 Ga0163163_10406181 3300014325 Bacteria 1420
68 Ga0163163_12521313 3300014325 Unclassified 572
69 Ga0157380_11935139 3300014326 Bacteria 651
70 Ga0157379_10604783 3300014968 Bacteria 1024
71 Ga0157379_12614735 3300014968 Unclassified 506
72 Ga0157376_10169009 3300014969 Bacteria 1989
73 Ga0157376_10224707 3300014969 Bacteria 1741
74 Ga0207680_10013661 3300025903 Unclassified 4178
75 Ga0207707_10312645 3300025912 Unclassified 1357
76 Ga0207695_10017122 3300025913 Bacteria 8449
77 Ga0207695_10242655 3300025913 Bacteria 1702
78 Ga0207693_10842446 3300025915 Unclassified 705
79 Ga0207660_10717320 3300025917 Unclassified 816
80 Ga0207700_10084321 3300025928 Bacteria 2490
81 Ga0207686_11217697 3300025934 Bacteria 617
82 Ga0207670_10032360 3300025936 Unclassified 3362
83 Ga0207711_10757812 3300025941 Bacteria 905
84 Ga0207661_10601472 3300025944 Bacteria 1009
85 Ga0207661_11639734 3300025944 Unclassified 588
86 Ga0207641_10071352 3300026088 Bacteria 2987
87 Ga0207641_10391067 3300026088 Bacteria 1334
88 Ga0207641_10484840 3300026088 Bacteria 1199
89 Ga0207641_10956806 3300026088 Unclassified 852
90 Ga0207674_10259303 3300026116 Bacteria 1686
91 Ga0207674_10342371 3300026116 Bacteria 1446
92 Ga0207674_10742762 3300026116 Bacteria 947
93 Ga0265337_1000467 3300028556 Bacteria 21420
94 Ga0265337_1011081 3300028556 Bacteria 3123
95 Ga0265337_1138327 3300028556 Bacteria 659
96 Ga0265319_1000236 3300028563 Bacteria 41417
97 Ga0265319_1019508 3300028563 Bacteria 2530
98 Ga0265319_1037694 3300028563 Bacteria 1646
99 Ga0265319_1096337 3300028563 Bacteria 931
100 Ga0265334_10027161 3300028573 Bacteria 2307
101 Ga0265334_10073939 3300028573 Bacteria 1265
102 Ga0265318_10000726 3300028577 Bacteria 22092
103 Ga0265323_10001373 3300028653 Bacteria 12052
104 Ga0265323_10098022 3300028653 Bacteria 973
105 Ga0265322_10029183 3300028654 Bacteria 1576
106 Ga0265336_10000631 3300028666 Bacteria 19394
107 Ga0265336_10015406 3300028666 Unclassified 2515
108 Ga0265336_10194858 3300028666 Bacteria 602
109 Ga0265338_10000158 3300028800 Bacteria 123828
110 Ga0265338_10003177 3300028800 Bacteria 23442
111 Ga0265338_10051700 3300028800 Bacteria 3696
112 Ga0265338_10089682 3300028800 Bacteria 2547
113 Ga0265338_10135412 3300028800 Bacteria 1938
114 Ga0265338_10477624 3300028800 Unclassified 880
115 Ga0265338_10491878 3300028800 Bacteria 864
116 Ga0265338_10689940 3300028800 Unclassified 705
117 Ga0265338_11183076 3300028800 Unclassified 513
118 Ga0265330_10038692 3300031235 Bacteria 2120
119 Ga0265320_10000733 3300031240 Bacteria 25084
120 Ga0265320_10001417 3300031240 Bacteria 17428
121 Ga0265320_10089167 3300031240 Bacteria 1430
122 Ga0265320_10198736 3300031240 Bacteria 895
123 Ga0265320_10417877 3300031240 Bacteria 592
124 Ga0265325_10063052 3300031241 Bacteria 1876
125 Ga0265329_10112947 3300031242 Bacteria 869
126 Ga0265340_10002475 3300031247 Bacteria 10493
127 Ga0265340_10005042 3300031247 Bacteria 7347
128 Ga0265340_10234142 3300031247 Bacteria 820
129 Ga0265331_10156839 3300031250 Bacteria 1033
130 Ga0265331_10472991 3300031250 Bacteria 563
131 Ga0265327_10001282 3300031251 Bacteria 33063
132 Ga0265327_10001745 3300031251 Bacteria 25747
133 Ga0265327_10509540 3300031251 Unclassified 518
134 Ga0265316_10121834 3300031344 Bacteria 1969
135 Ga0265316_10453410 3300031344 Bacteria 920
136 Ga0265316_10467187 3300031344 Bacteria 904
137 Ga0265316_10515002 3300031344 Unclassified 854
138 Ga0265316_10806072 3300031344 Unclassified 658
139 Ga0307408_100089220 3300031548 Unclassified 2324
140 Ga0265314_10000347 3300031711 Bacteria 64333
141 Ga0265314_10394874 3300031711 Bacteria 749
142 Ga0265342_10033537 3300031712 Bacteria 3156
143 Ga0307516_10468617 3300031730 Bacteria 915
144 Ga0307405_10414881 3300031731 Bacteria 1058
145 Ga0307413_10163852 3300031824 Bacteria 1565
146 Ga0307410_10000016 3300031852 Bacteria 72757
147 Ga0307407_10003156 3300031903 Bacteria 6674
148 Ga0307412_10037969 3300031911 Bacteria 3097
149 Ga0307409_100000034 3300031995 Bacteria 48281
150 Ga0307416_100000012 3300032002 Bacteria 296814
151 Ga0307411_10086217 3300032005 Bacteria 2178
152 Ga0373926_0090853 3300035083 Unclassified 1135
153 Ga0373940_0083564 3300035088 Bacteria 948
154 Ga0373936_0098313 3300035113 Bacteria 1233
155 Ga0373939_0087917 3300035114 Bacteria 1045
156 Ga0373939_0492266 3300035114 Unclassified 522
157 Ga0373945_0047391 3300035116 Unclassified 1571
158 Ga0373945_0350473 3300035116 Bacteria 640
159 Ga0373954_0120840 3300035118 Unclassified 1271
160 Ga0373956_0030874 3300035119 Bacteria 2344
161 Ga0373946_0077612 3300035171 Bacteria 1448
162 Ga0373946_0200046 3300035171 Unclassified 956
163 Ga0373931_0164554 3300035691 Unclassified 1303
164 Ga0373935_0328143 3300035692 Bacteria 1087
165 Ga0373935_0555121 3300035692 Unclassified 837
166 Ga0373927_0035954 3300035695 Bacteria 3222
167 Ga0373933_0016906 3300035724 Bacteria 4088
168 Ga0373933_0259653 3300035724 Bacteria 1120
169 Ga0373933_1086578 3300035724 Unclassified 527
170 Ga0373947_0516049 3300035725 Unclassified 812
171 Ga0373937_0002215 3300036401 Bacteria 16242
172 Ga0373937_1939675 3300036401 Unclassified 535
173 Ga0373925_0003142 3300037068 Bacteria 12959
174 Ga0373925_0231010 3300037068 Bacteria 1479
175 Ga0373925_0977853 3300037068 Unclassified 697
176 Ga0395905_0000250 3300037471 Bacteria 80488
177 Ga0451577_0053136 3300042876 Bacteria 3617
178 Ga0451577_0783490 3300042876 Unclassified 862
179 Ga0451577_1752317 3300042876 Unclassified 546
180 Ga0453683_1053605 3300044673 Unclassified 541
181 Ga0453684_0811029 3300044712 Bacteria 1009
182 Ga0453684_0895924 3300044712 Bacteria 950
183 Ga0453684_1327872 3300044712 Unclassified 749
184 Ga0466957_1323635 3300044842 Bacteria 523
185 Ga0451576_0112103 3300045051 Bacteria 2839
186 Ga0451576_0268951 3300045051 Bacteria 1782
187 Ga0451576_0333496 3300045051 Bacteria 1588
188 Ga0451576_0424101 3300045051 Unclassified 1396
189 Ga0451576_0682551 3300045051 Bacteria 1079
190 Ga0451576_2263802 3300045051 Unclassified 557
191 Ga0495629_0045835 3300046459 Unclassified 3067
192 Ga0495651_0398794 3300046462 Unclassified 899
193 Ga0495653_0335115 3300046463 Bacteria 977
194 Ga0495639_0385574 3300046475 Unclassified 706
195 Ga0495618_0001837 3300046514 Bacteria 13992
196 Ga0495630_0016140 3300046517 Bacteria 5458
197 Ga0495630_0835460 3300046517 Bacteria 703
198 Ga0495630_0849480 3300046517 Unclassified 696
199 Ga0495666_0059811 3300046526 Unclassified 1822
200 Ga0495586_0000615 3300046535 Bacteria 20579
201 Ga0495586_0105060 3300046535 Bacteria 1570
202 Ga0495586_0118321 3300046535 Bacteria 1479
203 Ga0495586_0550388 3300046535 Bacteria 666
204 Ga0495667_0032735 3300046559 Bacteria 3481
205 Ga0495667_0189139 3300046559 Bacteria 1320
206 Ga0495634_0001227 3300046642 Bacteria 23610
207 Ga0495635_0029996 3300046663 Bacteria 3781
208 Ga0495635_0035848 3300046663 Bacteria 3440
209 Ga0495657_0002918 3300046675 Bacteria 14176
210 Ga0495647_0036195 3300046681 Bacteria 1857
211 Ga0495647_0179042 3300046681 Bacteria 922
212 Ga0495647_0413058 3300046681 Unclassified 621
213 Ga0495658_0107912 3300046683 Bacteria 1671
214 Ga0495658_0628953 3300046683 Unclassified 687
215 Ga0495613_0000662 3300046689 Bacteria 27289
216 Ga0495674_0537227 3300047319 Bacteria 932
217 Ga0495676_0592047 3300047321 Unclassified 723
218 Ga0495680_0032055 3300047322 Unclassified 4270
219 Ga0495680_0070550 3300047322 Bacteria 2663
220 Ga0501046_0235511 3300049580 Bacteria 1351
221 Ga0501047_0403081 3300049581 Bacteria 1200
222 Ga0501047_0656007 3300049581 Bacteria 868
223 Ga0501073_0345093 3300049589 Unclassified 1028
224 nmdc:mga09592_56389_c1 3300050508 Unclassified 3320
225 nmdc:mga0qj67_29434_c1 3300050509 Bacteria 4266

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10227395 Ga0157372_102273953 112
2 3300014325 Ga0163163_10406181 Ga0163163_104061813 117
3 3300042876 Ga0451577_0053136 Ga0451577_0053136_194_550 117
4 3300042876 Ga0451577_0783490 Ga0451577_0783490_224_586 117
5 3300044712 Ga0453684_0811029 Ga0453684_0811029_369_764 117
6 3300045051 Ga0451576_0333496 Ga0451576_0333496_161_556 117
7 3300028563 Ga0265319_1000236 Ga0265319_100023623 120
8 3300028577 Ga0265318_10000726 Ga0265318_1000072621 120
9 3300028654 Ga0265322_10029183 Ga0265322_100291832 120
10 3300028800 Ga0265338_10477624 Ga0265338_104776242 120
11 3300031240 Ga0265320_10000733 Ga0265320_1000073322 120
12 3300031711 Ga0265314_10000347 Ga0265314_1000034744 120
13 3300042876 Ga0451577_1752317 Ga0451577_1752317_104_478 121
14 3300046535 Ga0495586_0105060 Ga0495586_0105060_657_1031 121
15 3300005841 Ga0068863_100187553 Ga0068863_1001875532 122
16 3300044712 Ga0453684_1327872 Ga0453684_1327872_105_500 122
17 3300049589 Ga0501073_0345093 Ga0501073_0345093_475_864 122
18 3300011119 Ga0105246_10256815 Ga0105246_102568152 123
19 3300044842 Ga0466957_1323635 Ga0466957_1323635_132_503 123
20 3300005436 Ga0070713_100054357 Ga0070713_1000543573 124
21 3300006028 Ga0070717_10401013 Ga0070717_104010132 124
22 3300025928 Ga0207700_10084321 Ga0207700_100843213 124
23 3300025944 Ga0207661_10601472 Ga0207661_106014722 124
24 3300028563 Ga0265319_1037694 Ga0265319_10376942 124
25 3300031247 Ga0265340_10005042 Ga0265340_100050427 124
26 3300031251 Ga0265327_10001282 Ga0265327_1000128222 124
27 3300031731 Ga0307405_10414881 Ga0307405_104148811 124
28 3300031824 Ga0307413_10163852 Ga0307413_101638523 124
29 3300031852 Ga0307410_10000016 Ga0307410_1000001645 124
30 3300031903 Ga0307407_10003156 Ga0307407_100031566 124
31 3300031911 Ga0307412_10037969 Ga0307412_100379692 124
32 3300031995 Ga0307409_100000034 Ga0307409_10000003425 124
33 3300032002 Ga0307416_100000012 Ga0307416_100000012246 124
34 3300032005 Ga0307411_10086217 Ga0307411_100862173 124
35 3300037068 Ga0373925_0231010 Ga0373925_0231010_726_1100 124
36 3300049580 Ga0501046_0235511 Ga0501046_0235511_453_842 124
37 3300049581 Ga0501047_0403081 Ga0501047_0403081_410_799 124
38 3300049581 Ga0501047_0656007 Ga0501047_0656007_349_738 124
39 3300005365 Ga0070688_100054854 Ga0070688_1000548542 125
40 3300005535 Ga0070684_100605124 Ga0070684_1006051242 125
41 3300005614 Ga0068856_101370466 Ga0068856_1013704661 125
42 3300006175 Ga0070712_100303814 Ga0070712_1003038142 125
43 3300006914 Ga0075436_100494323 Ga0075436_1004943231 125
44 3300009094 Ga0111539_10206554 Ga0111539_102065542 125
45 3300013296 Ga0157374_10052869 Ga0157374_100528693 125
46 3300025936 Ga0207670_10032360 Ga0207670_100323601 125
47 3300028573 Ga0265334_10027161 Ga0265334_100271612 125
48 3300028653 Ga0265323_10001373 Ga0265323_1000137310 125
49 3300028666 Ga0265336_10194858 Ga0265336_101948582 125
50 3300028800 Ga0265338_10135412 Ga0265338_101354123 125
51 3300031242 Ga0265329_10112947 Ga0265329_101129472 125
52 3300031344 Ga0265316_10121834 Ga0265316_101218343 125
53 3300031712 Ga0265342_10033537 Ga0265342_100335373 125
54 3300031730 Ga0307516_10468617 Ga0307516_104686172 125
55 3300037068 Ga0373925_0977853 Ga0373925_0977853_249_641 125
56 3300003316 rootH1_10199567 rootH1_101995672 127
57 3300005335 Ga0070666_10022620 Ga0070666_100226203 127
58 3300005617 Ga0068859_100070015 Ga0068859_1000700153 127
59 3300006880 Ga0075429_100402388 Ga0075429_1004023882 127
60 3300006931 Ga0097620_100070014 Ga0097620_1000700143 127
61 3300013296 Ga0157374_11357590 Ga0157374_113575902 127
62 3300013308 Ga0157375_10000048 Ga0157375_10000048103 127
63 3300014969 Ga0157376_10169009 Ga0157376_101690093 127
64 3300025903 Ga0207680_10013661 Ga0207680_100136612 127
65 3300025934 Ga0207686_11217697 Ga0207686_112176971 127
66 3300025941 Ga0207711_10757812 Ga0207711_107578121 127
67 3300026116 Ga0207674_10259303 Ga0207674_102593031 127
68 3300036401 Ga0373937_1939675 Ga0373937_1939675_49_450 127
69 3300045051 Ga0451576_0112103 Ga0451576_0112103_2362_2751 127
70 3300045051 Ga0451576_2263802 Ga0451576_2263802_141_524 127
71 3300050508 nmdc:mga09592_56389_c1 nmdc:mga09592_56389_c1_1121_1528 127
72 3300005458 Ga0070681_11018741 Ga0070681_110187412 128
73 3300005841 Ga0068863_100736250 Ga0068863_1007362501 128
74 3300009177 Ga0105248_11847207 Ga0105248_118472071 128
75 3300013104 Ga0157370_10469469 Ga0157370_104694692 128
76 3300013105 Ga0157369_10132618 Ga0157369_101326183 128
77 3300014968 Ga0157379_12614735 Ga0157379_126147351 128
78 3300026088 Ga0207641_10391067 Ga0207641_103910673 128
79 3300026116 Ga0207674_10742762 Ga0207674_107427622 128
80 3300028556 Ga0265337_1011081 Ga0265337_10110811 128
81 3300028800 Ga0265338_10689940 Ga0265338_106899401 128
82 3300028800 Ga0265338_11183076 Ga0265338_111830761 128
83 3300031240 Ga0265320_10001417 Ga0265320_100014172 128
84 3300031240 Ga0265320_10089167 Ga0265320_100891671 128
85 3300031241 Ga0265325_10063052 Ga0265325_100630522 128
86 3300031251 Ga0265327_10509540 Ga0265327_105095401 128
87 3300031344 Ga0265316_10806072 Ga0265316_108060721 128
88 3300035691 Ga0373931_0164554 Ga0373931_0164554_181_567 128
89 3300037471 Ga0395905_0000250 Ga0395905_0000250_17677_18072 128
90 3300044673 Ga0453683_1053605 Ga0453683_1053605_76_462 128
91 3300005444 Ga0070694_100357142 Ga0070694_1003571422 129
92 3300005471 Ga0070698_100169067 Ga0070698_1001690673 129
93 3300005518 Ga0070699_101338167 Ga0070699_1013381671 129
94 3300005544 Ga0070686_100045591 Ga0070686_1000455912 129
95 3300005549 Ga0070704_100632934 Ga0070704_1006329342 129
96 3300005617 Ga0068859_101073388 Ga0068859_1010733881 129
97 3300005617 Ga0068859_102746114 Ga0068859_1027461141 129
98 3300005841 Ga0068863_101372118 Ga0068863_1013721182 129
99 3300006175 Ga0070712_101207503 Ga0070712_1012075031 129
100 3300006846 Ga0075430_100017728 Ga0075430_1000177286 129
101 3300006931 Ga0097620_101073407 Ga0097620_1010734071 129
102 3300006931 Ga0097620_102745990 Ga0097620_1027459901 129
103 3300009093 Ga0105240_10071112 Ga0105240_100711124 129
104 3300013104 Ga0157370_10100212 Ga0157370_101002124 129
105 3300014325 Ga0163163_10088561 Ga0163163_100885612 129
106 3300014969 Ga0157376_10224707 Ga0157376_102247074 129
107 3300025913 Ga0207695_10242655 Ga0207695_102426552 129
108 3300025915 Ga0207693_10842446 Ga0207693_108424461 129
109 3300026088 Ga0207641_10484840 Ga0207641_104848402 129
110 3300028556 Ga0265337_1000467 Ga0265337_100046719 129
111 3300028573 Ga0265334_10073939 Ga0265334_100739391 129
112 3300028666 Ga0265336_10000631 Ga0265336_100006315 129
113 3300028800 Ga0265338_10003177 Ga0265338_100031779 129
114 3300031240 Ga0265320_10198736 Ga0265320_101987362 129
115 3300031247 Ga0265340_10002475 Ga0265340_100024752 129
116 3300031247 Ga0265340_10234142 Ga0265340_102341421 129
117 3300031250 Ga0265331_10156839 Ga0265331_101568392 129
118 3300031548 Ga0307408_100089220 Ga0307408_1000892206 129
119 3300031711 Ga0265314_10394874 Ga0265314_103948742 129
120 3300035083 Ga0373926_0090853 Ga0373926_0090853_334_723 129
121 3300035088 Ga0373940_0083564 Ga0373940_0083564_412_801 129
122 3300035113 Ga0373936_0098313 Ga0373936_0098313_145_534 129
123 3300035114 Ga0373939_0087917 Ga0373939_0087917_99_488 129
124 3300035116 Ga0373945_0047391 Ga0373945_0047391_825_1214 129
125 3300035116 Ga0373945_0350473 Ga0373945_0350473_141_530 129
126 3300035118 Ga0373954_0120840 Ga0373954_0120840_62_451 129
127 3300035119 Ga0373956_0030874 Ga0373956_0030874_1349_1738 129
128 3300035171 Ga0373946_0077612 Ga0373946_0077612_974_1363 129
129 3300035171 Ga0373946_0200046 Ga0373946_0200046_58_447 129
130 3300035692 Ga0373935_0328143 Ga0373935_0328143_402_791 129
131 3300035692 Ga0373935_0555121 Ga0373935_0555121_180_569 129
132 3300035695 Ga0373927_0035954 Ga0373927_0035954_2281_2670 129
133 3300035724 Ga0373933_0016906 Ga0373933_0016906_2966_3355 129
134 3300035725 Ga0373947_0516049 Ga0373947_0516049_192_581 129
135 3300036401 Ga0373937_0002215 Ga0373937_0002215_5706_6095 129
136 3300037068 Ga0373925_0003142 Ga0373925_0003142_8487_8876 129
137 3300045051 Ga0451576_0682551 Ga0451576_0682551_328_720 129
138 3300046459 Ga0495629_0045835 Ga0495629_0045835_196_585 129
139 3300046462 Ga0495651_0398794 Ga0495651_0398794_397_786 129
140 3300046475 Ga0495639_0385574 Ga0495639_0385574_282_677 129
141 3300046514 Ga0495618_0001837 Ga0495618_0001837_12791_13180 129
142 3300046517 Ga0495630_0016140 Ga0495630_0016140_937_1326 129
143 3300046517 Ga0495630_0849480 Ga0495630_0849480_118_513 129
144 3300046526 Ga0495666_0059811 Ga0495666_0059811_420_809 129
145 3300046535 Ga0495586_0000615 Ga0495586_0000615_3546_3935 129
146 3300046559 Ga0495667_0032735 Ga0495667_0032735_2695_3084 129
147 3300046559 Ga0495667_0189139 Ga0495667_0189139_147_542 129
148 3300046642 Ga0495634_0001227 Ga0495634_0001227_1699_2088 129
149 3300046663 Ga0495635_0029996 Ga0495635_0029996_3074_3463 129
150 3300046663 Ga0495635_0035848 Ga0495635_0035848_1217_1612 129
151 3300046675 Ga0495657_0002918 Ga0495657_0002918_9098_9493 129
152 3300046681 Ga0495647_0036195 Ga0495647_0036195_822_1211 129
153 3300046681 Ga0495647_0179042 Ga0495647_0179042_426_821 129
154 3300046681 Ga0495647_0413058 Ga0495647_0413058_142_531 129
155 3300046683 Ga0495658_0107912 Ga0495658_0107912_1195_1590 129
156 3300046683 Ga0495658_0628953 Ga0495658_0628953_40_429 129
157 3300046689 Ga0495613_0000662 Ga0495613_0000662_12671_13060 129
158 3300047319 Ga0495674_0537227 Ga0495674_0537227_485_874 129
159 3300047321 Ga0495676_0592047 Ga0495676_0592047_217_606 129
160 3300047322 Ga0495680_0032055 Ga0495680_0032055_1724_2113 129
161 3300047322 Ga0495680_0070550 Ga0495680_0070550_1329_1724 129
162 3300050509 nmdc:mga0qj67_29434_c1 nmdc:mga0qj67_29434_c1_2395_2790 129
163 3300005329 Ga0070683_100864335 Ga0070683_1008643352 130
164 3300005336 Ga0070680_100839068 Ga0070680_1008390683 130
165 3300005458 Ga0070681_10086468 Ga0070681_100864682 130
166 3300005530 Ga0070679_100091928 Ga0070679_1000919284 130
167 3300005530 Ga0070679_100473398 Ga0070679_1004733982 130
168 3300005577 Ga0068857_100779248 Ga0068857_1007792482 130
169 3300005841 Ga0068863_101008447 Ga0068863_1010084472 130
170 3300009098 Ga0105245_12434305 Ga0105245_124343052 130
171 3300009176 Ga0105242_10206123 Ga0105242_102061232 130
172 3300009177 Ga0105248_12566261 Ga0105248_125662612 130
173 3300013297 Ga0157378_12237192 Ga0157378_122371921 130
174 3300013307 Ga0157372_10281381 Ga0157372_102813812 130
175 3300025912 Ga0207707_10312645 Ga0207707_103126452 130
176 3300025917 Ga0207660_10717320 Ga0207660_107173202 130
177 3300025944 Ga0207661_11639734 Ga0207661_116397342 130
178 3300026088 Ga0207641_10956806 Ga0207641_109568062 130
179 3300026116 Ga0207674_10342371 Ga0207674_103423712 130
180 3300045051 Ga0451576_0424101 Ga0451576_0424101_101_493 130
181 3300005458 Ga0070681_10340618 Ga0070681_103406182 131
182 3300005468 Ga0070707_101387736 Ga0070707_1013877362 131
183 3300005841 Ga0068863_100099516 Ga0068863_1000995164 131
184 3300005841 Ga0068863_100482020 Ga0068863_1004820202 131
185 3300006237 Ga0097621_100052107 Ga0097621_1000521072 131
186 3300007076 Ga0075435_100608203 Ga0075435_1006082031 131
187 3300009093 Ga0105240_10198633 Ga0105240_101986333 131
188 3300009094 Ga0111539_11568379 Ga0111539_115683791 131
189 3300009098 Ga0105245_10477699 Ga0105245_104776992 131
190 3300014325 Ga0163163_12521313 Ga0163163_125213131 131
191 3300014326 Ga0157380_11935139 Ga0157380_119351391 131
192 3300014968 Ga0157379_10604783 Ga0157379_106047832 131
193 3300025913 Ga0207695_10017122 Ga0207695_100171222 131
194 3300026088 Ga0207641_10071352 Ga0207641_100713524 131
195 3300028556 Ga0265337_1138327 Ga0265337_11383271 131
196 3300028563 Ga0265319_1096337 Ga0265319_10963372 131
197 3300028666 Ga0265336_10015406 Ga0265336_100154064 131
198 3300028800 Ga0265338_10000158 Ga0265338_1000015841 131
199 3300028800 Ga0265338_10051700 Ga0265338_100517004 131
200 3300028800 Ga0265338_10491878 Ga0265338_104918782 131
201 3300031250 Ga0265331_10472991 Ga0265331_104729911 131
202 3300031251 Ga0265327_10001745 Ga0265327_100017454 131
203 3300035724 Ga0373933_0259653 Ga0373933_0259653_229_624 131
204 3300035724 Ga0373933_1086578 Ga0373933_1086578_99_494 131
205 3300044712 Ga0453684_0895924 Ga0453684_0895924_16_411 131
206 3300045051 Ga0451576_0268951 Ga0451576_0268951_241_636 131
207 3300046463 Ga0495653_0335115 Ga0495653_0335115_436_834 131
208 3300046517 Ga0495630_0835460 Ga0495630_0835460_202_597 131
209 3300046535 Ga0495586_0118321 Ga0495586_0118321_553_948 131
210 3300046535 Ga0495586_0550388 Ga0495586_0550388_200_595 131
211 3300005340 Ga0070689_100274975 Ga0070689_1002749752 132
212 3300005365 Ga0070688_100250222 Ga0070688_1002502221 132
213 3300005438 Ga0070701_10601154 Ga0070701_106011541 132
214 3300005544 Ga0070686_100455239 Ga0070686_1004552393 132
215 3300028563 Ga0265319_1019508 Ga0265319_10195084 132
216 3300028653 Ga0265323_10098022 Ga0265323_100980222 132
217 3300028800 Ga0265338_10089682 Ga0265338_100896822 132
218 3300031344 Ga0265316_10453410 Ga0265316_104534102 132
219 3300031344 Ga0265316_10467187 Ga0265316_104671872 132
220 3300035114 Ga0373939_0492266 Ga0373939_0492266_27_425 132
221 3300000545 CNXas_1000558 CNXas_10005584 133
222 3300031235 Ga0265330_10038692 Ga0265330_100386922 133
223 3300031240 Ga0265320_10417877 Ga0265320_104178771 133
224 3300031344 Ga0265316_10515002 Ga0265316_105150022 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01253

SUI1

Translation initiation factor SUI1

71

145

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1r-assembly1.cif.gz_A nmr solution structure of the product of the e. coli ycih gene. 0.7947 52 133
5jb3-assembly1.cif.gz_1 cryo-em structure of a full archaeal ribosomal translation initiation complex in the p-remote conformation 0.7763 51 130
1d1r-assembly1.cif.gz_A nmr solution structure of the product of the e. coli ycih gene. 0.7706 52 133
5jb3-assembly1.cif.gz_1 cryo-em structure of a full archaeal ribosomal translation initiation complex in the p-remote conformation 0.7431 51 130
6zvj-assembly1.cif.gz_N structure of a human abce1-bound 43s pre-initiation complex - state ii 0.7402 51 133
ID Description Score Start End Superfamily
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.9061 52 133 3.30.780.10
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8956 52 133 3.30.780.10
af_A0A1D8PCL3_418_494_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8718 56 125 3.30.780.10
4mo0A00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8235 56 130 3.30.780.10
1d1rA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.7947 52 133 3.30.780.10
ID Description Score Start End GO Terms
AF-A0A1W1IAL9-F1-model_v4 SUI1 domain-containing protein 0.9864 73 133 GO:0003743
AF-A0A354BK08-F1-model_v4 Translation initiation factor 0.9672 61 133 GO:0003743
AF-A0A5C7QIT1-F1-model_v4 Translation initiation factor Sui1 0.9594 56 133 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A381S1K9-F1-model_v4 SUI1 domain-containing protein 0.9495 56 133 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A7S8FCV6-F1-model_v4 SUI1 domain-containing protein 0.9477 47 133 GO:0003743

Feature Viewer

pLDDT pTM Quality
73.9 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map