F336539

General Info

Members Datasets Scaffolds Average Seq Length
224 165 448 145

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10002178|Ga0075368_100021782
Length 152
Sequence MAEKQPRSRRDAYKAFRTIPTRWMDNDIYGHMNNVVHYSLFDTAVNGWLIDQGVLDIHGGGAEQIGLVVETGCRYFAEMAFPDVVTAGLRVARLGTSSVRYEIGLFRNGEQEASAEGFFVHVYVDVATRRPAPLNPALRACLESIAAGPAPG

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
141 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
151 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
152 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
153 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
154 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
157 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
161 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
162 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
163 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
164 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
165 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 0
Isolates 2.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.61
Nodule 0
Rhizoplane 1.34
Rhizosphere 83.93
Stem 0
Stem Tuber 0
Unclassified 2.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10002178 3300006042 Bacteria 6342
2 JGI24736J21556_1012490 3300001904 Bacteria 1375
3 JGI24739J22299_10242090 3300001989 Unclassified 528
4 JGI24735J21928_10060616 3300002067 Bacteria 1087
5 rootH2_10144741 3300003320 Bacteria 1515
6 Ga0070683_100005329 3300005329 Bacteria 10720
7 Ga0070690_100658367 3300005330 Unclassified 800
8 Ga0070670_100163877 3300005331 Bacteria 1927
9 Ga0070677_10643347 3300005333 Bacteria 592
10 Ga0070666_10007164 3300005335 Bacteria 6873
11 Ga0070680_100087441 3300005336 Bacteria 2577
12 Ga0070682_100059677 3300005337 Bacteria 2410
13 Ga0070682_101522000 3300005337 Bacteria 576
14 Ga0070660_100011159 3300005339 Bacteria 6374
15 Ga0070691_10000244 3300005341 Bacteria 18593
16 Ga0070687_100084029 3300005343 Bacteria 1744
17 Ga0070661_100002207 3300005344 Bacteria 13385
18 Ga0070661_100034197 3300005344 Bacteria 3685
19 Ga0070661_100228936 3300005344 Bacteria 1428
20 Ga0070692_10682385 3300005345 Bacteria 689
21 Ga0070668_100007932 3300005347 Bacteria 7884
22 Ga0070675_100571467 3300005354 Bacteria 1024
23 Ga0070671_100015256 3300005355 Bacteria 6204
24 Ga0070674_100034644 3300005356 Bacteria 3374
25 Ga0070673_100009138 3300005364 Bacteria 6639
26 Ga0070659_100060200 3300005366 Bacteria 2999
27 Ga0070659_100228122 3300005366 Bacteria 1539
28 Ga0070667_100004870 3300005367 Bacteria 11240
29 Ga0070663_100146860 3300005455 Bacteria 1805
30 Ga0070678_100001477 3300005456 Bacteria 12538
31 Ga0070662_100001313 3300005457 Bacteria 15282
32 Ga0070662_100180395 3300005457 Bacteria 1664
33 Ga0068867_100002203 3300005459 Bacteria 13669
34 Ga0070679_100082912 3300005530 Bacteria 3196
35 Ga0070679_101057848 3300005530 Bacteria 756
36 Ga0068853_100204180 3300005539 Bacteria 1799
37 Ga0068853_100931725 3300005539 Bacteria 835
38 Ga0068853_101164726 3300005539 Bacteria 744
39 Ga0070672_100002938 3300005543 Bacteria 10970
40 Ga0070686_100276225 3300005544 Bacteria 1237
41 Ga0070686_100334194 3300005544 Bacteria 1133
42 Ga0070693_100563601 3300005547 Bacteria 817
43 Ga0070665_100003485 3300005548 Bacteria 16758
44 Ga0070665_100069158 3300005548 Bacteria 3539
45 Ga0070665_101266167 3300005548 Bacteria 748
46 Ga0070664_100026656 3300005564 Bacteria 4796
47 Ga0068857_100028285 3300005577 Bacteria 4946
48 Ga0068857_101242227 3300005577 Bacteria 722
49 Ga0068854_100003393 3300005578 Bacteria 9926
50 Ga0068854_100114494 3300005578 Bacteria 2039
51 Ga0068854_100144274 3300005578 Bacteria 1830
52 Ga0068856_100024997 3300005614 Bacteria 5821
53 Ga0068852_100029709 3300005616 Bacteria 4492
54 Ga0068852_101307383 3300005616 Bacteria 747
55 Ga0068852_101896688 3300005616 Bacteria 618
56 Ga0068859_100031767 3300005617 Bacteria 5303
57 Ga0068866_10007899 3300005718 Bacteria 4465
58 Ga0068851_10004800 3300005834 Bacteria 6117
59 Ga0068851_10005462 3300005834 Bacteria 5765
60 Ga0068863_100016220 3300005841 Bacteria 7147
61 Ga0068858_100010333 3300005842 Bacteria 8844
62 Ga0068860_100067178 3300005843 Bacteria 3407
63 Ga0081540_1007235 3300005983 Bacteria 7956
64 Ga0081539_10001557 3300005985 Bacteria 38200
65 Ga0075365_10016379 3300006038 Bacteria 4508
66 Ga0075365_10037315 3300006038 Bacteria 3154
67 Ga0075363_100014190 3300006048 Bacteria 3886
68 Ga0075363_100533203 3300006048 Unclassified 699
69 Ga0075362_10366773 3300006177 Bacteria 723
70 Ga0075369_10004548 3300006186 Bacteria 5134
71 Ga0097621_100008032 3300006237 Bacteria 7575
72 Ga0068871_100032610 3300006358 Bacteria 4117
73 Ga0068871_100989890 3300006358 Bacteria 783
74 Ga0068865_100007589 3300006881 Bacteria 6676
75 Ga0068865_102165665 3300006881 Bacteria 506
76 Ga0097620_100031773 3300006931 Bacteria 5303
77 Ga0105250_10101742 3300009092 Bacteria 1173
78 Ga0105240_10068003 3300009093 Bacteria 4414
79 Ga0105241_10021500 3300009174 Bacteria 4769
80 Ga0105237_10029266 3300009545 Bacteria 5602
81 Ga0105238_10005495 3300009551 Bacteria 12520
82 Ga0105246_10467854 3300011119 Bacteria 1063
83 Ga0105246_12503541 3300011119 Bacteria 508
84 Ga0157371_10705559 3300013102 Bacteria 755
85 Ga0157369_10238782 3300013105 Bacteria 1898
86 Ga0157372_10007723 3300013307 Bacteria 11432
87 Ga0163161_10411636 3300017792 Bacteria 1086
88 Ga0209563_104314 3300025230 Bacteria 2737
89 Ga0207656_10010310 3300025321 Bacteria 3497
90 Ga0207656_10186988 3300025321 Bacteria 996
91 Ga0207696_1066443 3300025711 Bacteria 1007
92 Ga0207682_10387613 3300025893 Bacteria 660
93 Ga0207642_10004170 3300025899 Bacteria 4645
94 Ga0207680_10014045 3300025903 Bacteria 4130
95 Ga0207647_10000619 3300025904 Bacteria 27673
96 Ga0207705_10084218 3300025909 Bacteria 2321
97 Ga0207705_10179485 3300025909 Bacteria 1597
98 Ga0207695_10008629 3300025913 Bacteria 12729
99 Ga0207671_10178036 3300025914 Bacteria 1654
100 Ga0207660_10109153 3300025917 Bacteria 2079
101 Ga0207657_10008323 3300025919 Bacteria 10555
102 Ga0207657_10010597 3300025919 Bacteria 9186
103 Ga0207657_10038843 3300025919 Bacteria 4233
104 Ga0207649_10008064 3300025920 Bacteria 5734
105 Ga0207649_10033719 3300025920 Bacteria 3062
106 Ga0207694_10005058 3300025924 Bacteria 10201
107 Ga0207694_10542998 3300025924 Bacteria 975
108 Ga0207650_10948644 3300025925 Unclassified 731
109 Ga0207659_10619440 3300025926 Bacteria 923
110 Ga0207687_10016246 3300025927 Bacteria 4888
111 Ga0207687_11495592 3300025927 Bacteria 580
112 Ga0207644_10015504 3300025931 Bacteria 5117
113 Ga0207690_10023763 3300025932 Bacteria 3830
114 Ga0207690_10358638 3300025932 Bacteria 1154
115 Ga0207706_10001593 3300025933 Bacteria 22538
116 Ga0207706_10082295 3300025933 Bacteria 2829
117 Ga0207706_10095356 3300025933 Bacteria 2617
118 Ga0207706_11447262 3300025933 Unclassified 562
119 Ga0207669_10044679 3300025937 Bacteria 2605
120 Ga0207704_10020542 3300025938 Bacteria 3497
121 Ga0207704_11945709 3300025938 Bacteria 506
122 Ga0207691_10003013 3300025940 Bacteria 16442
123 Ga0207711_10006554 3300025941 Bacteria 9803
124 Ga0207661_10009079 3300025944 Bacteria 7124
125 Ga0207679_10129359 3300025945 Bacteria 2023
126 Ga0207679_10915180 3300025945 Unclassified 802
127 Ga0207679_11064830 3300025945 Bacteria 742
128 Ga0207679_11527613 3300025945 Bacteria 612
129 Ga0207667_10006500 3300025949 Bacteria 14140
130 Ga0207651_10047429 3300025960 Bacteria 2896
131 Ga0207668_10004832 3300025972 Bacteria 7932
132 Ga0207668_10705893 3300025972 Bacteria 887
133 Ga0207640_10048712 3300025981 Bacteria 2741
134 Ga0207640_10127789 3300025981 Bacteria 1832
135 Ga0207640_10187863 3300025981 Bacteria 1555
136 Ga0207658_10210082 3300025986 Bacteria 1630
137 Ga0207677_10049060 3300026023 Bacteria 2846
138 Ga0207703_10159914 3300026035 Bacteria 1972
139 Ga0207639_10041497 3300026041 Bacteria 3443
140 Ga0207639_10690456 3300026041 Bacteria 946
141 Ga0207678_10309565 3300026067 Bacteria 1358
142 Ga0207678_11148183 3300026067 Bacteria 688
143 Ga0207702_10024116 3300026078 Bacteria 5047
144 Ga0207702_10027988 3300026078 Bacteria 4683
145 Ga0207648_10007835 3300026089 Bacteria 10427
146 Ga0207676_10194019 3300026095 Bacteria 1789
147 Ga0207674_10024091 3300026116 Bacteria 6509
148 Ga0207674_10655231 3300026116 Bacteria 1014
149 Ga0207683_10004023 3300026121 Bacteria 12713
150 Ga0207698_10002029 3300026142 Bacteria 11940
151 Ga0207698_10066815 3300026142 Bacteria 2832
152 Ga0207698_10600125 3300026142 Bacteria 1085
153 Ga0207698_11202761 3300026142 Bacteria 772
154 Ga0209813_10032100 3300027866 Bacteria 1554
155 Ga0268266_10004305 3300028379 Bacteria 13699
156 Ga0268266_10451274 3300028379 Bacteria 1222
157 Ga0268265_11214111 3300028380 Bacteria 752
158 Ga0307405_10456194 3300031731 Bacteria 1015
159 Ga0307413_10013412 3300031824 Bacteria 4119
160 Ga0307407_10212460 3300031903 Bacteria 1303
161 Ga0307409_100112504 3300031995 Bacteria 2286
162 Ga0307414_10027810 3300032004 Bacteria 3659
163 Ga0307411_10011412 3300032005 Bacteria 4795
164 Ga0307411_11675374 3300032005 Bacteria 588
165 Ga0307415_100651555 3300032126 Bacteria 944
166 Ga0373931_0025467 3300035691 Bacteria 3005
167 Ga0395899_0009484 3300037312 Bacteria 7471
168 Ga0395898_0046070 3300037466 Bacteria 4283
169 Ga0436364_0918378 3300037853 Bacteria 708
170 Ga0395901_0022295 3300038443 Bacteria 6489
171 Ga0436361_0929477 3300039447 Bacteria 841
172 Ga0451837_1695533 3300041494 Bacteria 549
173 Ga0466972_0021361 3300044658 Bacteria 3227
174 Ga0466963_0165226 3300044694 Bacteria 1542
175 Ga0466960_0009013 3300044901 Bacteria 4102
176 Ga0466958_0034988 3300045836 Bacteria 3000
177 Ga0466958_0596236 3300045836 Bacteria 718
178 Ga0495638_0015850 3300046460 Bacteria 5050
179 Ga0495638_0066689 3300046460 Bacteria 2211
180 Ga0495638_0287141 3300046460 Bacteria 892
181 Ga0495583_0053219 3300046506 Bacteria 1838
182 Ga0495671_0322644 3300046692 Bacteria 742
183 Ga0496100_1667612 3300048903 Bacteria 504
184 Ga0496108_0472363 3300048911 Bacteria 1096
185 Ga0496109_0806012 3300048912 Bacteria 877
186 Ga0501033_0001476 3300049570 Bacteria 20814
187 Ga0501034_0006349 3300049571 Bacteria 12735
188 Ga0501034_0242902 3300049571 Bacteria 1746
189 Ga0501039_0393140 3300049575 Bacteria 1089
190 Ga0501040_0106346 3300049576 Bacteria 1961
191 Ga0501046_0978794 3300049580 Bacteria 588
192 Ga0501047_0334512 3300049581 Bacteria 1352
193 Ga0501238_012063 3300049671 Bacteria 1166
194 Ga0501252_000362 3300049682 Bacteria 3311
195 Ga0501080_0254850 3300049742 Bacteria 1600
196 Ga0501083_0218329 3300049744 Bacteria 1242
197 Ga0501035_0003877 3300049822 Bacteria 14269
198 nmdc:mga0yw44_200457_c1 3300050492 Bacteria 1318
199 nmdc:mga0yw44_8086_c1 3300050492 Bacteria 5220
200 nmdc:mga0yw44_83737_c1 3300050492 Bacteria 2004
201 nmdc:mga06z11_14668_c1 3300050494 Bacteria 3478
202 nmdc:mga04h51_754_c1 3300050495 Bacteria 7485
203 nmdc:mga08y16_321503_c1 3300050511 Bacteria 1593
204 nmdc:mga0sz30_124976_c1 3300050516 Bacteria 1132
205 Ga0500610_0047070 3300053079 Bacteria 2241
206 Ga0500556_0011060 3300053104 Bacteria 2664
207 Ga0500658_0386867 3300053134 Bacteria 641
208 Ga0500577_0406215 3300053142 Bacteria 596
209 Ga0500604_0093197 3300053151 Bacteria 986
210 Ga0500604_0233238 3300053151 Bacteria 636
211 Ga0500616_0080787 3300053153 Bacteria 1634
212 Ga0500627_0155572 3300053158 Bacteria 1032
213 Ga0500627_0286035 3300053158 Bacteria 722
214 Ga0500627_0482798 3300053158 Bacteria 518
215 Ga0500611_213642 3300053727 Bacteria 549
216 Ga0501084_0128216 3300054114 Bacteria 2135
217 Ga0501084_1044850 3300054114 Bacteria 686
218 Ga0501082_0000027 3300060353 Bacteria 100915
219 2837651495 2837651117 Bacteria 3772164
220 2837679251 2837678835 Bacteria 5252418
221 2883580762 2883577096 Bacteria 4709178
222 2937846274 2937843397 Bacteria 5256375
223 2996311088 2996310559 Bacteria 6357320
224 8054568118 8054563764 Bacteria 5592885
225 Ga0075368_10002178
226 JGI24736J21556_1012490
227 JGI24739J22299_10242090
228 JGI24735J21928_10060616
229 rootH2_10144741
230 Ga0070683_100005329
231 Ga0070690_100658367
232 Ga0070670_100163877
233 Ga0070677_10643347
234 Ga0070666_10007164
235 Ga0070680_100087441
236 Ga0070682_100059677
237 Ga0070682_101522000
238 Ga0070660_100011159
239 Ga0070691_10000244
240 Ga0070687_100084029
241 Ga0070661_100002207
242 Ga0070661_100034197
243 Ga0070661_100228936
244 Ga0070692_10682385
245 Ga0070668_100007932
246 Ga0070675_100571467
247 Ga0070671_100015256
248 Ga0070674_100034644
249 Ga0070673_100009138
250 Ga0070659_100060200
251 Ga0070659_100228122
252 Ga0070667_100004870
253 Ga0070663_100146860
254 Ga0070678_100001477
255 Ga0070662_100001313
256 Ga0070662_100180395
257 Ga0068867_100002203
258 Ga0070679_100082912
259 Ga0070679_101057848
260 Ga0068853_100204180
261 Ga0068853_100931725
262 Ga0068853_101164726
263 Ga0070672_100002938
264 Ga0070686_100276225
265 Ga0070686_100334194
266 Ga0070693_100563601
267 Ga0070665_100003485
268 Ga0070665_100069158
269 Ga0070665_101266167
270 Ga0070664_100026656
271 Ga0068857_100028285
272 Ga0068857_101242227
273 Ga0068854_100003393
274 Ga0068854_100114494
275 Ga0068854_100144274
276 Ga0068856_100024997
277 Ga0068852_100029709
278 Ga0068852_101307383
279 Ga0068852_101896688
280 Ga0068859_100031767
281 Ga0068866_10007899
282 Ga0068851_10004800
283 Ga0068851_10005462
284 Ga0068863_100016220
285 Ga0068858_100010333
286 Ga0068860_100067178
287 Ga0081540_1007235
288 Ga0081539_10001557
289 Ga0075365_10016379
290 Ga0075365_10037315
291 Ga0075363_100014190
292 Ga0075363_100533203
293 Ga0075362_10366773
294 Ga0075369_10004548
295 Ga0097621_100008032
296 Ga0068871_100032610
297 Ga0068871_100989890
298 Ga0068865_100007589
299 Ga0068865_102165665
300 Ga0097620_100031773
301 Ga0105250_10101742
302 Ga0105240_10068003
303 Ga0105241_10021500
304 Ga0105237_10029266
305 Ga0105238_10005495
306 Ga0105246_10467854
307 Ga0105246_12503541
308 Ga0157371_10705559
309 Ga0157369_10238782
310 Ga0157372_10007723
311 Ga0163161_10411636
312 Ga0209563_104314
313 Ga0207656_10010310
314 Ga0207656_10186988
315 Ga0207696_1066443
316 Ga0207682_10387613
317 Ga0207642_10004170
318 Ga0207680_10014045
319 Ga0207647_10000619
320 Ga0207705_10084218
321 Ga0207705_10179485
322 Ga0207695_10008629
323 Ga0207671_10178036
324 Ga0207660_10109153
325 Ga0207657_10008323
326 Ga0207657_10010597
327 Ga0207657_10038843
328 Ga0207649_10008064
329 Ga0207649_10033719
330 Ga0207694_10005058
331 Ga0207694_10542998
332 Ga0207650_10948644
333 Ga0207659_10619440
334 Ga0207687_10016246
335 Ga0207687_11495592
336 Ga0207644_10015504
337 Ga0207690_10023763
338 Ga0207690_10358638
339 Ga0207706_10001593
340 Ga0207706_10082295
341 Ga0207706_10095356
342 Ga0207706_11447262
343 Ga0207669_10044679
344 Ga0207704_10020542
345 Ga0207704_11945709
346 Ga0207691_10003013
347 Ga0207711_10006554
348 Ga0207661_10009079
349 Ga0207679_10129359
350 Ga0207679_10915180
351 Ga0207679_11064830
352 Ga0207679_11527613
353 Ga0207667_10006500
354 Ga0207651_10047429
355 Ga0207668_10004832
356 Ga0207668_10705893
357 Ga0207640_10048712
358 Ga0207640_10127789
359 Ga0207640_10187863
360 Ga0207658_10210082
361 Ga0207677_10049060
362 Ga0207703_10159914
363 Ga0207639_10041497
364 Ga0207639_10690456
365 Ga0207678_10309565
366 Ga0207678_11148183
367 Ga0207702_10024116
368 Ga0207702_10027988
369 Ga0207648_10007835
370 Ga0207676_10194019
371 Ga0207674_10024091
372 Ga0207674_10655231
373 Ga0207683_10004023
374 Ga0207698_10002029
375 Ga0207698_10066815
376 Ga0207698_10600125
377 Ga0207698_11202761
378 Ga0209813_10032100
379 Ga0268266_10004305
380 Ga0268266_10451274
381 Ga0268265_11214111
382 Ga0307405_10456194
383 Ga0307413_10013412
384 Ga0307407_10212460
385 Ga0307409_100112504
386 Ga0307414_10027810
387 Ga0307411_10011412
388 Ga0307411_11675374
389 Ga0307415_100651555
390 Ga0373931_0025467
391 Ga0395899_0009484
392 Ga0395898_0046070
393 Ga0436364_0918378
394 Ga0395901_0022295
395 Ga0436361_0929477
396 Ga0451837_1695533
397 Ga0466972_0021361
398 Ga0466963_0165226
399 Ga0466960_0009013
400 Ga0466958_0034988
401 Ga0466958_0596236
402 Ga0495638_0015850
403 Ga0495638_0066689
404 Ga0495638_0287141
405 Ga0495583_0053219
406 Ga0495671_0322644
407 Ga0496100_1667612
408 Ga0496108_0472363
409 Ga0496109_0806012
410 Ga0501033_0001476
411 Ga0501034_0006349
412 Ga0501034_0242902
413 Ga0501039_0393140
414 Ga0501040_0106346
415 Ga0501046_0978794
416 Ga0501047_0334512
417 Ga0501238_012063
418 Ga0501252_000362
419 Ga0501080_0254850
420 Ga0501083_0218329
421 Ga0501035_0003877
422 nmdc:mga0yw44_200457_c1
423 nmdc:mga0yw44_8086_c1
424 nmdc:mga0yw44_83737_c1
425 nmdc:mga06z11_14668_c1
426 nmdc:mga04h51_754_c1
427 nmdc:mga08y16_321503_c1
428 nmdc:mga0sz30_124976_c1
429 Ga0500610_0047070
430 Ga0500556_0011060
431 Ga0500658_0386867
432 Ga0500577_0406215
433 Ga0500604_0093197
434 Ga0500604_0233238
435 Ga0500616_0080787
436 Ga0500627_0155572
437 Ga0500627_0286035
438 Ga0500627_0482798
439 Ga0500611_213642
440 Ga0501084_0128216
441 Ga0501084_1044850
442 Ga0501082_0000027
443 2837651495
444 2837679251
445 2883580762
446 2937846274
447 2996311088
448 8054568118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

29

114

0.97

PF13279

4HBT_2

Thioesterase-like superfamily

21

142

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o6t-assembly3.cif.gz_K crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221). 0.9754 5 143
5byu-assembly2.cif.gz_E crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.9486 13 137
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9431 14 122
5byu-assembly1.cif.gz_A crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila 0.9401 15 138
3qy3-assembly1.cif.gz_A pa2801 protein, a putative thioesterase from pseudomonas aeruginosa 0.9365 15 139
ID Description Score Start End Superfamily
2av9A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.975 5 142 3.10.129.10
af_O07408_6_147_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9537 5 140 3.10.129.10
af_Q9DCP4_49_221_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9477 8 140 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9431 14 122 3.10.129.10
2av9A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9413 5 142 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7H0GF81-F1-model_v4 deleted 0.9946 18 143
AF-A0A2D9SG28-F1-model_v4 Thioesterase 0.992 3 142 GO:0047617
AF-A0A3D5ZHK7-F1-model_v4 Thioesterase 0.992 2 139 GO:0047617
AF-A0A5N7N3X2-F1-model_v4 Acyl-CoA thioesterase 0.9917 2 143 GO:0047617
AF-A0A3N4UVA7-F1-model_v4 Acyl-CoA thioester hydrolase 0.9915 3 143 GO:0047617

Map