F336505

General Info

Members Datasets Scaffolds Average Seq Length
224 155 205 261

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100005477|Ga0068858_10000547711
Length 294
Sequence MRAPLRQRSQRGLPLRAVAPNAVTALALCFGLTGIRYAISASSGLPGTGGDWEIAAAMIMIAGVLDGLDGTVARLVRGESRFGAELDSLSDAISFGVSPALILYLWSLKGIPRLGWLVALVFAVFCALRLARFNANIDVSEQPHKSAGFLTGIPAPAGAGLAMLPLYLSFVSQSFAGGAEFAQVLRSPLLVAPWVGFIASLMVSSVATFSWSSLKLRHHIRFEALVVVVLLGGALIVALWFTLSVICIAYLALIPFSIRSYRRVRRLRGTVGAGAEPQPPASQQDGPAPESGAR

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
10 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
11 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
12 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
13 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
14 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
15 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
16 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
17 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
18 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
19 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
20 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
136 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
141 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
142 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
143 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
146 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
147 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
148 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
151 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
152 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
153 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.52
Metatranscriptomes 0
Isolates 8.48

Biome Distribution

Category Percentage (%)
Aerial Root 1.34
Bulb 0
Endosphere 21.43
Nodule 0
Rhizoplane 1.79
Rhizosphere 60.27
Stem 0
Stem Tuber 0
Unclassified 15.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2317725 2162886006 Bacteria 936
2 JGI24749J21850_1000038 3300002076 Bacteria 24759
3 JGI24751J29686_10000212 3300002459 Bacteria 24736
4 JGI25150J39212_1000315 3300002774 Bacteria 23966
5 JGI25151J46595_10069955 3300003187 Bacteria 1068
6 JGI25165J46597_1000032 3300003214 Bacteria 294371
7 JGI25153J46596_10000266 3300003215 Bacteria 41550
8 rootL2_10167296 3300003322 Bacteria 1577
9 Ga0055542_1000046 3300003762 Bacteria 201922
10 Ga0055529_1000007 3300003763 Bacteria 403604
11 Ga0055526_1011063 3300003771 Bacteria 4118
12 Ga0055540_1003009 3300003792 Bacteria 8429
13 Ga0065165_1031326 3300005262 Bacteria 1682
14 Ga0065707_10085546 3300005295 Bacteria 6075
15 Ga0070670_100000031 3300005331 Bacteria 159070
16 Ga0070670_100010088 3300005331 Bacteria 8060
17 Ga0070666_10036606 3300005335 Bacteria 3259
18 Ga0070666_10077361 3300005335 Bacteria 2271
19 Ga0070668_100000004 3300005347 Bacteria 189408
20 Ga0070669_100000026 3300005353 Bacteria 170346
21 Ga0070669_100562695 3300005353 Bacteria 952
22 Ga0070671_100000014 3300005355 Bacteria 167986
23 Ga0070667_100000037 3300005367 Bacteria 172343
24 Ga0070667_100001473 3300005367 Bacteria 21102
25 Ga0070667_100001606 3300005367 Bacteria 20222
26 Ga0070667_100320687 3300005367 Bacteria 1398
27 Ga0070679_100124058 3300005530 Bacteria 2566
28 Ga0068853_100481781 3300005539 Bacteria 1170
29 Ga0070665_100000086 3300005548 Bacteria 178229
30 Ga0068857_100409772 3300005577 Bacteria 1262
31 Ga0068854_100066825 3300005578 Bacteria 2617
32 Ga0068859_100017515 3300005617 Bacteria 7202
33 Ga0068859_100027281 3300005617 Bacteria 5729
34 Ga0068859_100081279 3300005617 Bacteria 3283
35 Ga0068859_100486763 3300005617 Bacteria 1329
36 Ga0068864_100000075 3300005618 Bacteria 108554
37 Ga0068864_100002235 3300005618 Bacteria 15994
38 Ga0068864_100081091 3300005618 Bacteria 2844
39 Ga0068861_100000008 3300005719 Bacteria 85041
40 Ga0068861_100138502 3300005719 Bacteria 1983
41 Ga0068863_100020188 3300005841 Bacteria 6374
42 Ga0068863_100053767 3300005841 Bacteria 3817
43 Ga0068858_100002731 3300005842 Bacteria 17756
44 Ga0068858_100005477 3300005842 Bacteria 12426
45 Ga0068858_100006423 3300005842 Bacteria 11450
46 Ga0068860_100000002 3300005843 Bacteria 627849
47 Ga0068860_100002081 3300005843 Bacteria 21102
48 Ga0068862_100000006 3300005844 Bacteria 346828
49 Ga0068862_100000171 3300005844 Bacteria 72200
50 Ga0075364_10028216 3300006051 Bacteria 3592
51 Ga0075370_10038147 3300006353 Bacteria 2704
52 Ga0097620_100017515 3300006931 Bacteria 7202
53 Ga0097620_100027281 3300006931 Bacteria 5729
54 Ga0097620_100081280 3300006931 Bacteria 3283
55 Ga0097620_100486770 3300006931 Bacteria 1329
56 Ga0105240_10007760 3300009093 Bacteria 15521
57 Ga0105240_10194483 3300009093 Bacteria 2383
58 Ga0105245_10000505 3300009098 Bacteria 35782
59 Ga0105248_10001039 3300009177 Bacteria 30716
60 Ga0105248_10059555 3300009177 Bacteria 4290
61 Ga0105248_10357130 3300009177 Bacteria 1645
62 Ga0105237_10003482 3300009545 Bacteria 18670
63 Ga0105237_10010990 3300009545 Bacteria 9607
64 Ga0105239_10000320 3300010375 Bacteria 70971
65 Ga0105246_10456223 3300011119 Bacteria 1075
66 Ga0157326_1000891 3300012513 Bacteria 3427
67 Ga0157378_10159951 3300013297 Bacteria 2106
68 Ga0163162_10262540 3300013306 Bacteria 1859
69 Ga0157372_10070312 3300013307 Bacteria 3938
70 Ga0163163_10061345 3300014325 Bacteria 3725
71 Ga0157380_10000412 3300014326 Bacteria 26019
72 Ga0183363_1001 3300015690 Bacteria 611534
73 Ga0207425_1000026 3300025245 Bacteria 301303
74 Ga0209148_1000026 3300025254 Bacteria 629213
75 Ga0209129_1000834 3300025258 Bacteria 19378
76 Ga0209233_1000066 3300025261 Bacteria 381218
77 Ga0209565_1000240 3300025263 Bacteria 59106
78 Ga0209455_1000005 3300025272 Bacteria 1416756
79 Ga0209676_1009190 3300025292 Bacteria 4298
80 Ga0209676_1032341 3300025292 Bacteria 1575
81 Ga0209025_1001326 3300025294 Bacteria 33497
82 Ga0209564_1001139 3300025295 Bacteria 31226
83 Ga0209758_1000004 3300025297 Bacteria 1375322
84 Ga0209050_1000001 3300025298 Bacteria 3563507
85 Ga0209050_1000550 3300025298 Bacteria 61775
86 Ga0209051_1000336 3300025303 Bacteria 70491
87 Ga0209257_1001103 3300025304 Bacteria 35112
88 Ga0209257_1001896 3300025304 Bacteria 22606
89 Ga0209257_1011162 3300025304 Bacteria 4376
90 Ga0207680_10051269 3300025903 Bacteria 2467
91 Ga0207695_10054462 3300025913 Bacteria 4177
92 Ga0207695_10232959 3300025913 Bacteria 1745
93 Ga0207671_10032553 3300025914 Bacteria 3880
94 Ga0207681_10000001 3300025923 Bacteria 1105841
95 Ga0207681_10096636 3300025923 Bacteria 2121
96 Ga0207681_10326576 3300025923 Bacteria 1222
97 Ga0207650_10000055 3300025925 Bacteria 158325
98 Ga0207650_10043568 3300025925 Bacteria 3295
99 Ga0207687_10000677 3300025927 Bacteria 22939
100 Ga0207644_10000030 3300025931 Bacteria 136272
101 Ga0207711_10046648 3300025941 Bacteria 3702
102 Ga0207689_10561583 3300025942 Bacteria 959
103 Ga0207668_10000192 3300025972 Bacteria 41888
104 Ga0207658_10000002 3300025986 Bacteria 1364188
105 Ga0207658_10001587 3300025986 Bacteria 17524
106 Ga0207658_10005421 3300025986 Bacteria 8746
107 Ga0207703_10000501 3300026035 Bacteria 40495
108 Ga0207703_10000654 3300026035 Bacteria 34723
109 Ga0207703_10657134 3300026035 Bacteria 995
110 Ga0207641_10000606 3300026088 Bacteria 39350
111 Ga0207641_10010945 3300026088 Bacteria 7433
112 Ga0207641_10103805 3300026088 Bacteria 2508
113 Ga0207676_10000004 3300026095 Bacteria 725417
114 Ga0207676_10057537 3300026095 Bacteria 3062
115 Ga0207674_10034968 3300026116 Bacteria 5247
116 Ga0207674_10300696 3300026116 Bacteria 1553
117 Ga0207675_100001177 3300026118 Bacteria 26009
118 Ga0207675_100028893 3300026118 Bacteria 5165
119 Ga0207675_100208365 3300026118 Bacteria 1879
120 Ga0268266_10000002 3300028379 Bacteria 3059047
121 Ga0268265_10000002 3300028380 Bacteria 1035381
122 Ga0268265_10000323 3300028380 Bacteria 52384
123 Ga0268264_10000001 3300028381 Bacteria 1221000
124 Ga0268264_10000229 3300028381 Bacteria 108305
125 Ga0307517_10016351 3300028786 Bacteria 9759
126 Ga0307513_10012580 3300031456 Bacteria 10434
127 Ga0307513_10178143 3300031456 Bacteria 1993
128 Ga0307408_100396591 3300031548 Bacteria 1184
129 Ga0307408_100679811 3300031548 Bacteria 923
130 Ga0307508_10018935 3300031616 Bacteria 6256
131 Ga0307405_10157101 3300031731 Bacteria 1606
132 Ga0307412_10001832 3300031911 Bacteria 11782
133 Ga0307412_10014024 3300031911 Bacteria 4719
134 Ga0307412_10018551 3300031911 Bacteria 4190
135 Ga0307412_10028984 3300031911 Bacteria 3470
136 Ga0307416_100216072 3300032002 Bacteria 1834
137 Ga0307510_10043874 3300033180 Bacteria 4854
138 Ga0436365_1804930 3300039437 Bacteria 1605
139 Ga0466973_0199075 3300044659 Bacteria 1492
140 Ga0495638_0051589 3300046460 Bacteria 2565
141 Ga0495637_0038453 3300046520 Bacteria 2072
142 Ga0495648_0109837 3300046524 Bacteria 1503
143 Ga0495597_0061401 3300046542 Bacteria 1637
144 Ga0495668_0024869 3300046616 Bacteria 3405
145 Ga0495668_0072542 3300046616 Bacteria 1891
146 Ga0495668_0165744 3300046616 Bacteria 1210
147 Ga0495625_0000570 3300046660 Bacteria 54000
148 Ga0495670_0010172 3300046691 Bacteria 4629
149 Ga0495670_0025500 3300046691 Bacteria 2925
150 Ga0495677_0021493 3300047445 Bacteria 2338
151 Ga0495673_0032735 3300047469 Bacteria 2420
152 Ga0495681_0140030 3300047470 Bacteria 1023
153 Ga0495686_0000293 3300047472 Bacteria 87130
154 Ga0495686_0033236 3300047472 Bacteria 3332
155 Ga0495686_0072438 3300047472 Bacteria 2118
156 Ga0496102_0074380 3300048905 Bacteria 3123
157 Ga0496115_0017533 3300048918 Bacteria 5478
158 Ga0496116_0171480 3300048919 Bacteria 1175
159 Ga0496117_0131933 3300048920 Bacteria 1512
160 Ga0496120_0128943 3300048923 Bacteria 1298
161 Ga0496121_0052292 3300048924 Bacteria 3432
162 Ga0496121_0052595 3300048924 Bacteria 3418
163 Ga0496121_0092122 3300048924 Bacteria 2363
164 Ga0496121_0189137 3300048924 Bacteria 1478
165 Ga0496121_0329306 3300048924 Bacteria 1025
166 Ga0496123_0056820 3300048926 Bacteria 2553
167 Ga0496123_0148395 3300048926 Bacteria 1269
168 Ga0496123_0174819 3300048926 Bacteria 1128
169 Ga0496124_0001648 3300048927 Bacteria 31950
170 Ga0496124_0005515 3300048927 Bacteria 14203
171 Ga0496124_0147180 3300048927 Bacteria 1852
172 Ga0496124_0390098 3300048927 Bacteria 970
173 Ga0496125_0036993 3300048928 Bacteria 4250
174 Ga0496125_0126426 3300048928 Bacteria 1811
175 Ga0496126_0086017 3300048929 Bacteria 2771
176 Ga0501033_0141741 3300049570 Bacteria 1737
177 Ga0501043_0075202 3300049579 Bacteria 2653
178 Ga0501043_0122870 3300049579 Bacteria 2036
179 Ga0501047_0084550 3300049581 Bacteria 3050
180 Ga0501047_0181233 3300049581 Bacteria 1973
181 Ga0501047_0578493 3300049581 Bacteria 946
182 Ga0501071_0124597 3300049587 Bacteria 1912
183 Ga0501249_005319 3300049679 Bacteria 2631
184 Ga0501259_025161 3300049688 Bacteria 1089
185 Ga0501035_0267390 3300049822 Bacteria 1448
186 nmdc:mga00v17_137829_c1 3300050491 Bacteria 1563
187 nmdc:mga07m45_172144_c1 3300050496 Bacteria 1258
188 Ga0500643_001438 3300053087 Bacteria 13734
189 Ga0500643_030952 3300053087 Bacteria 1636
190 Ga0500651_0048429 3300053093 Bacteria 2670
191 Ga0500641_0016252 3300053096 Bacteria 2770
192 Ga0500555_059015 3300053103 Bacteria 1035
193 Ga0500618_009117 3300053125 Bacteria 2727
194 Ga0500642_0056749 3300053130 Bacteria 1745
195 Ga0500655_000366 3300053133 Bacteria 9772
196 Ga0500658_0015691 3300053134 Bacteria 2815
197 Ga0500559_0091634 3300053136 Bacteria 1392
198 Ga0500568_0021543 3300053139 Bacteria 2771
199 Ga0500573_0019282 3300053140 Bacteria 3901
200 Ga0500590_000636 3300053148 Bacteria 12505
201 Ga0500627_0133309 3300053158 Bacteria 1122
202 Ga0500639_079675 3300053163 Bacteria 1652
203 Ga0500645_003182 3300053730 Bacteria 6823
204 Ga0500645_040209 3300053730 Bacteria 1384
205 Ga0500596_003271 3300053735 Bacteria 3107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10010990 Ga0105237_100109905 208
2 3300048927 Ga0496124_0147180 Ga0496124_0147180_425_1249 209
3 3300048928 Ga0496125_0126426 Ga0496125_0126426_14_838 212
4 3300031911 Ga0307412_10001832 Ga0307412_1000183210 217
5 3300048927 Ga0496124_0001648 Ga0496124_0001648_30095_30919 217
6 3300005577 Ga0068857_100409772 Ga0068857_1004097722 218
7 3300026116 Ga0207674_10300696 Ga0207674_103006962 218
8 3300048926 Ga0496123_0056820 Ga0496123_0056820_1027_1851 218
9 3300048926 Ga0496123_0174819 Ga0496123_0174819_230_1054 218
10 3300048927 Ga0496124_0005515 Ga0496124_0005515_12653_13477 218
11 3300048927 Ga0496124_0390098 Ga0496124_0390098_108_932 218
12 3300026035 Ga0207703_10657134 Ga0207703_106571341 219
13 3300047472 Ga0495686_0033236 Ga0495686_0033236_1957_2811 219
14 3300053087 Ga0500643_001438 Ga0500643_001438_11698_12378 222
15 3300053158 Ga0500627_0133309 Ga0500627_0133309_146_937 223
16 3300009177 Ga0105248_10059555 Ga0105248_100595555 231
17 3300046616 Ga0495668_0165744 Ga0495668_0165744_413_1138 231
18 3300003762 Ga0055542_1000046 Ga0055542_1000046111 232
19 3300003763 Ga0055529_1000007 Ga0055529_1000007118 232
20 3300025254 Ga0209148_1000026 Ga0209148_1000026267 232
21 3300025272 Ga0209455_1000005 Ga0209455_10000051014 232
22 3300025923 Ga0207681_10096636 Ga0207681_100966361 232
23 3300048923 Ga0496120_0128943 Ga0496120_0128943_472_1209 232
24 3300053134 Ga0500658_0015691 Ga0500658_0015691_1179_1991 232
25 3300005617 Ga0068859_100027281 Ga0068859_1000272817 233
26 3300005719 Ga0068861_100000008 Ga0068861_1000000082 233
27 3300006931 Ga0097620_100027281 Ga0097620_1000272813 233
28 3300026118 Ga0207675_100208365 Ga0207675_1002083652 233
29 3300046691 Ga0495670_0010172 Ga0495670_0010172_3084_3875 234
30 3300003322 rootL2_10167296 rootL2_101672962 235
31 3300048919 Ga0496116_0171480 Ga0496116_0171480_13_771 235
32 3300046460 Ga0495638_0051589 Ga0495638_0051589_571_1383 236
33 3300006051 Ga0075364_10028216 Ga0075364_100282165 238
34 3300046691 Ga0495670_0025500 Ga0495670_0025500_1351_2154 238
35 3300047470 Ga0495681_0140030 Ga0495681_0140030_75_869 238
36 3300050491 nmdc:mga00v17_137829_c1 nmdc:mga00v17_137829_c1_565_1365 238
37 3300053140 Ga0500573_0019282 Ga0500573_0019282_2171_2980 238
38 3300005262 Ga0065165_1031326 Ga0065165_10313261 239
39 3300005548 Ga0070665_100000086 Ga0070665_100000086107 239
40 3300015690 Ga0183363_1001 Ga0183363_1001450 239
41 3300028379 Ga0268266_10000002 Ga0268266_100000022453 239
42 3300003771 Ga0055526_1011063 Ga0055526_10110632 240
43 3300025263 Ga0209565_1000240 Ga0209565_100024050 240
44 3300025295 Ga0209564_1001139 Ga0209564_100113918 240
45 3300028786 Ga0307517_10016351 Ga0307517_1001635110 240
46 3300031456 Ga0307513_10012580 Ga0307513_100125802 240
47 3300046524 Ga0495648_0109837 Ga0495648_0109837_96_902 240
48 3300048926 Ga0496123_0148395 Ga0496123_0148395_165_1004 240
49 3300053735 Ga0500596_003271 Ga0500596_003271_1034_1840 240
50 3300005539 Ga0068853_100481781 Ga0068853_1004817812 241
51 3300053730 Ga0500645_003182 Ga0500645_003182_4593_5390 241
52 3300031911 Ga0307412_10028984 Ga0307412_100289843 242
53 3300049579 Ga0501043_0122870 Ga0501043_0122870_943_1671 242
54 3300003187 JGI25151J46595_10069955 JGI25151J46595_100699551 243
55 3300003792 Ga0055540_1003009 Ga0055540_10030098 243
56 3300025245 Ga0207425_1000026 Ga0207425_1000026300 243
57 3300025294 Ga0209025_1001326 Ga0209025_100132615 243
58 3300025297 Ga0209758_1000004 Ga0209758_10000041242 243
59 3300025298 Ga0209050_1000001 Ga0209050_10000013245 243
60 3300025298 Ga0209050_1000550 Ga0209050_100055010 243
61 3300025303 Ga0209051_1000336 Ga0209051_100033637 243
62 3300025304 Ga0209257_1001103 Ga0209257_10011032 243
63 3300025304 Ga0209257_1001896 Ga0209257_100189622 243
64 3300048905 Ga0496102_0074380 Ga0496102_0074380_780_1619 243
65 iso_pu_bacteria 2885429604 2885429978 244
66 3300009093 Ga0105240_10007760 Ga0105240_100077604 245
67 3300010375 Ga0105239_10000320 Ga0105239_100003207 245
68 3300025913 Ga0207695_10054462 Ga0207695_100544623 245
69 3300048924 Ga0496121_0052595 Ga0496121_0052595_1738_2592 245
70 3300048929 Ga0496126_0086017 Ga0496126_0086017_771_1625 245
71 iso_pu_bacteria 2830075706 2830077641 247
72 3300031548 Ga0307408_100396591 Ga0307408_1003965912 248
73 3300047445 Ga0495677_0021493 Ga0495677_0021493_359_1141 248
74 3300049581 Ga0501047_0084550 Ga0501047_0084550_713_1510 248
75 3300049822 Ga0501035_0267390 Ga0501035_0267390_427_1224 248
76 3300053103 Ga0500555_059015 Ga0500555_059015_158_967 248
77 3300005530 Ga0070679_100124058 Ga0070679_1001240582 250
78 3300025258 Ga0209129_1000834 Ga0209129_100083413 250
79 3300025292 Ga0209676_1009190 Ga0209676_10091903 250
80 3300025292 Ga0209676_1032341 Ga0209676_10323412 250
81 3300025304 Ga0209257_1011162 Ga0209257_10111625 250
82 3300048924 Ga0496121_0329306 Ga0496121_0329306_25_807 250
83 3300002774 JGI25150J39212_1000315 JGI25150J39212_100031510 251
84 3300003215 JGI25153J46596_10000266 JGI25153J46596_1000026626 251
85 3300011119 Ga0105246_10456223 Ga0105246_104562231 251
86 3300013306 Ga0163162_10262540 Ga0163162_102625402 251
87 3300025942 Ga0207689_10561583 Ga0207689_105615831 251
88 3300047469 Ga0495673_0032735 Ga0495673_0032735_396_1208 251
89 3300047472 Ga0495686_0000293 Ga0495686_0000293_84876_85688 251
90 3300048918 Ga0496115_0017533 Ga0496115_0017533_3888_4682 251
91 3300048924 Ga0496121_0189137 Ga0496121_0189137_420_1238 251
92 3300049570 Ga0501033_0141741 Ga0501033_0141741_605_1414 251
93 3300049579 Ga0501043_0075202 Ga0501043_0075202_594_1403 251
94 3300003214 JGI25165J46597_1000032 JGI25165J46597_1000032163 252
95 3300005367 Ga0070667_100320687 Ga0070667_1003206872 252
96 3300005618 Ga0068864_100002235 Ga0068864_10000223515 252
97 3300005842 Ga0068858_100002731 Ga0068858_10000273114 252
98 3300025261 Ga0209233_1000066 Ga0209233_1000066165 252
99 3300026035 Ga0207703_10000501 Ga0207703_100005012 252
100 3300049581 Ga0501047_0181233 Ga0501047_0181233_741_1508 252
101 iso_pu_bacteria 2879163058 2879164501 253
102 3300031456 Ga0307513_10178143 Ga0307513_101781432 254
103 3300031616 Ga0307508_10018935 Ga0307508_100189354 254
104 3300033180 Ga0307510_10043874 Ga0307510_100438743 254
105 3300048924 Ga0496121_0052292 Ga0496121_0052292_1808_2605 254
106 3300053087 Ga0500643_030952 Ga0500643_030952_265_1074 254
107 3300005578 Ga0068854_100066825 Ga0068854_1000668253 255
108 3300009093 Ga0105240_10194483 Ga0105240_101944833 255
109 3300009545 Ga0105237_10003482 Ga0105237_1000348220 255
110 3300025913 Ga0207695_10232959 Ga0207695_102329593 255
111 3300025914 Ga0207671_10032553 Ga0207671_100325533 255
112 3300039437 Ga0436365_1804930 Ga0436365_1804930_220_1053 255
113 3300048920 Ga0496117_0131933 Ga0496117_0131933_470_1297 255
114 3300048924 Ga0496121_0092122 Ga0496121_0092122_938_1771 255
115 iso_pu_bacteria 2599185359 2600224759 255
116 iso_pu_bacteria 2818991466 2819712952 255
117 iso_pu_bacteria 2928526807 2928527490 255
118 iso_pu_bacteria 2928968154 2928969021 255
119 3300013307 Ga0157372_10070312 Ga0157372_100703123 256
120 3300049581 Ga0501047_0578493 Ga0501047_0578493_47_838 256
121 3300049587 Ga0501071_0124597 Ga0501071_0124597_878_1687 256
122 iso_pu_bacteria 2582581305 2585263265 256
123 iso_pu_bacteria 2643221605 2644037342 256
124 iso_pu_bacteria 2928027323 2928027829 256
125 iso_pu_bacteria 2946787523 2946791094 256
126 iso_pu_bacteria 2984555340 2984558793 256
127 iso_pu_bacteria 2984564862 2984566701 256
128 iso_pu_bacteria 2993356040 2993357889 256
129 iso_pu_bacteria 2643221541 2643730224 257
130 iso_pu_bacteria 2643221606 2644043393 257
131 iso_pu_bacteria 2643221671 2644393553 257
132 iso_pu_bacteria 2599185354 2600203865 258
133 iso_pu_bacteria 2751185897 2753764014 258
134 3300005335 Ga0070666_10077361 Ga0070666_100773612 259
135 3300005367 Ga0070667_100001473 Ga0070667_10000147317 259
136 3300005617 Ga0068859_100486763 Ga0068859_1004867632 259
137 3300005841 Ga0068863_100020188 Ga0068863_1000201882 259
138 3300005843 Ga0068860_100002081 Ga0068860_10000208116 259
139 3300006931 Ga0097620_100486770 Ga0097620_1004867702 259
140 3300025986 Ga0207658_10005421 Ga0207658_100054215 259
141 3300026088 Ga0207641_10010945 Ga0207641_100109455 259
142 3300028381 Ga0268264_10000229 Ga0268264_1000022930 259
143 3300049679 Ga0501249_005319 Ga0501249_005319_553_1347 259
144 3300049688 Ga0501259_025161 Ga0501259_025161_243_1037 259
145 3300005331 Ga0070670_100010088 Ga0070670_1000100883 260
146 3300005335 Ga0070666_10036606 Ga0070666_100366064 260
147 3300005347 Ga0070668_100000004 Ga0070668_10000000493 260
148 3300005353 Ga0070669_100562695 Ga0070669_1005626951 260
149 3300005355 Ga0070671_100000014 Ga0070671_100000014110 260
150 3300005367 Ga0070667_100000037 Ga0070667_10000003789 260
151 3300005617 Ga0068859_100081279 Ga0068859_1000812793 260
152 3300005618 Ga0068864_100081091 Ga0068864_1000810913 260
153 3300005841 Ga0068863_100053767 Ga0068863_1000537673 260
154 3300005842 Ga0068858_100005477 Ga0068858_10000547711 260
155 3300005842 Ga0068858_100006423 Ga0068858_10000642311 260
156 3300005843 Ga0068860_100000002 Ga0068860_100000002517 260
157 3300005844 Ga0068862_100000171 Ga0068862_10000017152 260
158 3300006353 Ga0075370_10038147 Ga0075370_100381473 260
159 3300006931 Ga0097620_100081280 Ga0097620_1000812803 260
160 3300009098 Ga0105245_10000505 Ga0105245_1000050514 260
161 3300009177 Ga0105248_10357130 Ga0105248_103571302 260
162 3300012513 Ga0157326_1000891 Ga0157326_10008912 260
163 3300013297 Ga0157378_10159951 Ga0157378_101599512 260
164 3300025903 Ga0207680_10051269 Ga0207680_100512693 260
165 3300025923 Ga0207681_10326576 Ga0207681_103265762 260
166 3300025925 Ga0207650_10043568 Ga0207650_100435684 260
167 3300025927 Ga0207687_10000677 Ga0207687_1000067714 260
168 3300025931 Ga0207644_10000030 Ga0207644_1000003062 260
169 3300025972 Ga0207668_10000192 Ga0207668_1000019220 260
170 3300025986 Ga0207658_10000002 Ga0207658_10000002800 260
171 3300026035 Ga0207703_10000654 Ga0207703_1000065425 260
172 3300026088 Ga0207641_10000606 Ga0207641_1000060628 260
173 3300026088 Ga0207641_10103805 Ga0207641_101038052 260
174 3300026095 Ga0207676_10057537 Ga0207676_100575373 260
175 3300026118 Ga0207675_100028893 Ga0207675_1000288933 260
176 3300028380 Ga0268265_10000323 Ga0268265_1000032331 260
177 3300028381 Ga0268264_10000001 Ga0268264_100000011125 260
178 3300031548 Ga0307408_100679811 Ga0307408_1006798111 260
179 3300031731 Ga0307405_10157101 Ga0307405_101571013 260
180 3300031911 Ga0307412_10014024 Ga0307412_100140243 260
181 3300031911 Ga0307412_10018551 Ga0307412_100185513 260
182 3300032002 Ga0307416_100216072 Ga0307416_1002160722 260
183 3300046520 Ga0495637_0038453 Ga0495637_0038453_480_1271 260
184 3300046542 Ga0495597_0061401 Ga0495597_0061401_257_1048 260
185 3300046616 Ga0495668_0024869 Ga0495668_0024869_1272_2063 260
186 3300046616 Ga0495668_0072542 Ga0495668_0072542_931_1722 260
187 3300046660 Ga0495625_0000570 Ga0495625_0000570_51786_52640 260
188 3300047472 Ga0495686_0072438 Ga0495686_0072438_595_1449 260
189 3300048928 Ga0496125_0036993 Ga0496125_0036993_1684_2475 260
190 3300050496 nmdc:mga07m45_172144_c1 nmdc:mga07m45_172144_c1_361_1152 260
191 3300053093 Ga0500651_0048429 Ga0500651_0048429_509_1300 260
192 3300053096 Ga0500641_0016252 Ga0500641_0016252_1438_2229 260
193 3300053125 Ga0500618_009117 Ga0500618_009117_1209_2000 260
194 3300053130 Ga0500642_0056749 Ga0500642_0056749_653_1444 260
195 3300053133 Ga0500655_000366 Ga0500655_000366_1637_2428 260
196 3300053136 Ga0500559_0091634 Ga0500559_0091634_88_951 260
197 3300053139 Ga0500568_0021543 Ga0500568_0021543_1013_1840 260
198 3300053148 Ga0500590_000636 Ga0500590_000636_10434_11225 260
199 3300053163 Ga0500639_079675 Ga0500639_079675_161_952 260
200 3300026116 Ga0207674_10034968 Ga0207674_100349683 261
201 3300044659 Ga0466973_0199075 Ga0466973_0199075_256_1053 261
202 3300053730 Ga0500645_040209 Ga0500645_040209_91_885 261
203 2162886006 SwRhRL3b_contig_2317725 SwRhRL3b_0823.00002040 263
204 3300002076 JGI24749J21850_1000038 JGI24749J21850_10000388 263
205 3300002459 JGI24751J29686_10000212 JGI24751J29686_1000021221 263
206 3300005295 Ga0065707_10085546 Ga0065707_100855463 263
207 3300005331 Ga0070670_100000031 Ga0070670_100000031102 263
208 3300005353 Ga0070669_100000026 Ga0070669_10000002646 263
209 3300005367 Ga0070667_100001606 Ga0070667_10000160610 263
210 3300005617 Ga0068859_100017515 Ga0068859_1000175154 263
211 3300005618 Ga0068864_100000075 Ga0068864_10000007545 263
212 3300005719 Ga0068861_100138502 Ga0068861_1001385022 263
213 3300005844 Ga0068862_100000006 Ga0068862_100000006290 263
214 3300006931 Ga0097620_100017515 Ga0097620_1000175157 263
215 3300009177 Ga0105248_10001039 Ga0105248_1000103926 263
216 3300014325 Ga0163163_10061345 Ga0163163_100613454 263
217 3300014326 Ga0157380_10000412 Ga0157380_1000041210 263
218 3300025923 Ga0207681_10000001 Ga0207681_10000001965 263
219 3300025925 Ga0207650_10000055 Ga0207650_10000055102 263
220 3300025941 Ga0207711_10046648 Ga0207711_100466483 263
221 3300025986 Ga0207658_10001587 Ga0207658_1000158711 263
222 3300026095 Ga0207676_10000004 Ga0207676_1000000465 263
223 3300026118 Ga0207675_100001177 Ga0207675_10000117716 263
224 3300028380 Ga0268265_10000002 Ga0268265_100000021015 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08009

CDP-OH_P_tran_2

CDP-alcohol phosphatidyltransferase 2

219

255

0.94

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

17

203

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e2a-assembly1.cif.gz_C asp81leu enzyme iia from the lactose specific pts from lactococcus lactis 0.8181 16 96
2e2a-assembly1.cif.gz_B asp81leu enzyme iia from the lactose specific pts from lactococcus lactis 0.8068 17 96
1e2a-assembly1.cif.gz_A enzyme iia from the lactose specific pts from lactococcus lactis 0.8017 16 96
3k1s-assembly1.cif.gz_A crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis 0.799 7 96
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.7781 12 246
ID Description Score Start End Superfamily
af_P9WPG1_2_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8831 4 189 1.20.120.1760
af_P69791_14_116_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8529 16 96 1.20.58.80
af_P9WPG1_2_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8436 4 189 1.20.120.1760
2e2aC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8181 16 96 1.20.58.80
af_Q58609_4_200_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8126 20 246 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A832EXD2-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.964 11 102 GO:0008654
GO:0016020
GO:0016780
AF-A0A7Y3CIB4-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9602 16 137 GO:0003882
GO:0008654
GO:0012505
GO:0016020
AF-A0A7C7K264-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase 0.9535 11 133 GO:0008654
GO:0016020
GO:0016780
AF-A0A6D0ZPL3-F1-model_v4 deleted 0.9457 9 123
AF-A0A2D7FMV4-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9443 11 249 GO:0008654
GO:0016020
GO:0016780

Feature Viewer

pLDDT pTM Quality
68.65 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map