F336465

General Info

Members Datasets Scaffolds Average Seq Length
224 132 448 265

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100129566|Ga0070699_1001295663
Length 301
Sequence MIESMLTKVTPLILTYDEAANIGRTLEQLRWARDIVVVDSFSDDETLEIVRTFPQARIFQREFDCHEKQWNFGLSETGISSEWILGLDADYVLTEEFSAELQALHPAPDIKGYRAKFIYCINGKRISSGVYPPVTVLYRKDNVSYAQDGHTQRLVIDGRIEDLHAPILHDDRKSLSRWLEAQSRYTKLEADKLLSSRAESLSWTDRVRRWRVVAPAAMLFYCLIIRGGVLDGWAGFYYAFQRSLAELMLSLYMLDRDLRISDSGLRNSAFEEPAPRDAEHSDLTRPAQFPIRNPKSEIRNS

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
114 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
117 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
118 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
119 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
120 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
121 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
122 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
123 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
124 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
125 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
126 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
127 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
128 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.89
Rhizosphere 99.11
Stem 0
Stem Tuber 0
Unclassified 29.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100129566 3300005518 Unclassified 2223
2 MBSR1b_contig_10776166 2162886012 Unclassified 1113
3 MBSR1b_contig_2621893 2162886012 Bacteria 1344
4 JGI24751J29686_10000033 3300002459 Bacteria 87652
5 JGI25406J46586_10004034 3300003203 Bacteria 6866
6 Ga0065712_10079867 3300005290 Unclassified 3168
7 Ga0065715_10095600 3300005293 Unclassified 4044
8 Ga0065715_10103198 3300005293 Bacteria 3051
9 Ga0065707_10265676 3300005295 Bacteria 1074
10 Ga0070683_100201650 3300005329 Unclassified 1889
11 Ga0070670_100010482 3300005331 Bacteria 7912
12 Ga0070670_100135383 3300005331 Unclassified 2129
13 Ga0068869_100015495 3300005334 Bacteria 5116
14 Ga0068869_100122022 3300005334 Bacteria 1994
15 Ga0068869_100159100 3300005334 Unclassified 1757
16 Ga0068869_100161146 3300005334 Bacteria 1746
17 Ga0070680_100037184 3300005336 Bacteria 3934
18 Ga0070682_100128722 3300005337 Unclassified 1710
19 Ga0070660_100180488 3300005339 Unclassified 1708
20 Ga0070687_100377332 3300005343 Unclassified 923
21 Ga0070661_100072249 3300005344 Unclassified 2539
22 Ga0070692_10264808 3300005345 Bacteria 1035
23 Ga0070669_100130604 3300005353 Unclassified 1926
24 Ga0070673_100102098 3300005364 Bacteria 2364
25 Ga0070659_100065128 3300005366 Unclassified 2886
26 Ga0070709_10156781 3300005434 Bacteria 1579
27 Ga0070705_100082518 3300005440 Bacteria 1978
28 Ga0070700_100000444 3300005441 Bacteria 20953
29 Ga0070700_100079878 3300005441 Bacteria 2109
30 Ga0070700_100084178 3300005441 Bacteria 2061
31 Ga0070708_100000295 3300005445 Bacteria 37646
32 Ga0070681_10013828 3300005458 Bacteria 8034
33 Ga0070706_100000002 3300005467 Bacteria 326510
34 Ga0070706_100019840 3300005467 Bacteria 6197
35 Ga0070706_100042293 3300005467 Unclassified 4209
36 Ga0070706_100081693 3300005467 Bacteria 2993
37 Ga0070707_100012888 3300005468 Bacteria 7809
38 Ga0070698_100002283 3300005471 Bacteria 21223
39 Ga0070698_100005699 3300005471 Bacteria 13631
40 Ga0070698_100328412 3300005471 Bacteria 1460
41 Ga0070699_100001161 3300005518 Bacteria 24445
42 Ga0070679_100038558 3300005530 Unclassified 4750
43 Ga0070679_100101012 3300005530 Bacteria 2871
44 Ga0070697_100000420 3300005536 Bacteria 32693
45 Ga0070697_100022966 3300005536 Bacteria 4960
46 Ga0070672_100083346 3300005543 Bacteria 2566
47 Ga0070686_100001872 3300005544 Bacteria 11722
48 Ga0070696_100046980 3300005546 Bacteria 2995
49 Ga0070665_100211694 3300005548 Bacteria 1939
50 Ga0070704_100050005 3300005549 Bacteria 2935
51 Ga0070664_100018898 3300005564 Bacteria 5666
52 Ga0068857_100016264 3300005577 Bacteria 6518
53 Ga0068854_100352619 3300005578 Bacteria 1205
54 Ga0070702_100046251 3300005615 Bacteria 2466
55 Ga0068852_100652484 3300005616 Bacteria 1060
56 Ga0068859_100004585 3300005617 Bacteria 14096
57 Ga0068859_100006103 3300005617 Bacteria 12237
58 Ga0068859_100022288 3300005617 Bacteria 6351
59 Ga0068859_100026465 3300005617 Bacteria 5817
60 Ga0068859_100068611 3300005617 Bacteria 3580
61 Ga0068859_100279255 3300005617 Unclassified 1763
62 Ga0068859_100284090 3300005617 Bacteria 1748
63 Ga0068859_100803958 3300005617 Unclassified 1028
64 Ga0068864_100037157 3300005618 Unclassified 4154
65 Ga0068861_100027873 3300005719 Viruses 4119
66 Ga0068863_100105404 3300005841 Bacteria 2682
67 Ga0068863_100275293 3300005841 Bacteria 1630
68 Ga0068863_100550042 3300005841 Bacteria 1140
69 Ga0068858_100089045 3300005842 Bacteria 2872
70 Ga0068858_100332868 3300005842 Bacteria 1452
71 Ga0068858_100551398 3300005842 Bacteria 1116
72 Ga0068860_100022748 3300005843 Bacteria 6060
73 Ga0068860_100048182 3300005843 Viruses 4061
74 Ga0068862_100542262 3300005844 Bacteria 1110
75 Ga0081539_10001267 3300005985 Bacteria 44584
76 Ga0068871_100001835 3300006358 Bacteria 14349
77 Ga0068871_100616230 3300006358 Bacteria 988
78 Ga0075428_100268515 3300006844 Unclassified 1836
79 Ga0075433_10069745 3300006852 Unclassified 3088
80 Ga0075429_100101002 3300006880 Bacteria 2518
81 Ga0075436_100000008 3300006914 Bacteria 279288
82 Ga0075436_100212972 3300006914 Unclassified 1370
83 Ga0097620_100004586 3300006931 Bacteria 14096
84 Ga0097620_100006103 3300006931 Bacteria 12237
85 Ga0097620_100022287 3300006931 Bacteria 6351
86 Ga0097620_100026464 3300006931 Bacteria 5817
87 Ga0097620_100068609 3300006931 Bacteria 3580
88 Ga0097620_100279273 3300006931 Unclassified 1763
89 Ga0097620_100284078 3300006931 Bacteria 1748
90 Ga0097620_100803983 3300006931 Unclassified 1028
91 Ga0075435_100001677 3300007076 Bacteria 14381
92 Ga0111539_10333802 3300009094 Bacteria 1765
93 Ga0105247_10001797 3300009101 Bacteria 15062
94 Ga0114129_10021675 3300009147 Bacteria 9119
95 Ga0114129_10166168 3300009147 Bacteria 3011
96 Ga0114129_10413162 3300009147 Bacteria 1776
97 Ga0114129_10917576 3300009147 Bacteria 1109
98 Ga0114129_11215997 3300009147 Unclassified 938
99 Ga0105243_10000086 3300009148 Bacteria 105723
100 Ga0105243_10174020 3300009148 Bacteria 1867
101 Ga0105243_10220876 3300009148 Bacteria 1675
102 Ga0105242_10000057 3300009176 Bacteria 75984
103 Ga0105242_10102950 3300009176 Unclassified 2421
104 Ga0105248_10003801 3300009177 Bacteria 16737
105 Ga0105248_10171542 3300009177 Unclassified 2445
106 Ga0105248_10175271 3300009177 Bacteria 2417
107 Ga0105248_10948650 3300009177 Unclassified 972
108 Ga0105237_10058199 3300009545 Bacteria 3868
109 Ga0105237_10160137 3300009545 Bacteria 2249
110 Ga0105238_10019355 3300009551 Bacteria 6933
111 Ga0163162_10004714 3300013306 Bacteria 13148
112 Ga0163162_10008458 3300013306 Bacteria 10040
113 Ga0163162_10092789 3300013306 Bacteria 3103
114 Ga0157375_10072686 3300013308 Bacteria 3457
115 Ga0163163_10000263 3300014325 Bacteria 53159
116 Ga0163163_10061084 3300014325 Bacteria 3733
117 Ga0163163_10199179 3300014325 Bacteria 2051
118 Ga0163163_10384513 3300014325 Bacteria 1461
119 Ga0163163_10391233 3300014325 Unclassified 1448
120 Ga0157380_10350992 3300014326 Bacteria 1380
121 Ga0157377_10063279 3300014745 Bacteria 2119
122 Ga0157379_10081435 3300014968 Bacteria 2900
123 Ga0157379_10148733 3300014968 Bacteria 2113
124 Ga0207710_10000988 3300025900 Bacteria 14888
125 Ga0207699_10378742 3300025906 Unclassified 1004
126 Ga0207684_10000065 3300025910 Bacteria 194463
127 Ga0207684_10006579 3300025910 Bacteria 10573
128 Ga0207684_10066920 3300025910 Bacteria 3052
129 Ga0207684_10138239 3300025910 Bacteria 2093
130 Ga0207684_10306036 3300025910 Unclassified 1370
131 Ga0207707_10019871 3300025912 Bacteria 5862
132 Ga0207707_10027749 3300025912 Bacteria 4950
133 Ga0207671_10288976 3300025914 Unclassified 1294
134 Ga0207662_10027952 3300025918 Unclassified 3258
135 Ga0207662_10390798 3300025918 Unclassified 941
136 Ga0207657_10190350 3300025919 Unclassified 1655
137 Ga0207652_10112489 3300025921 Unclassified 2416
138 Ga0207652_10116399 3300025921 Bacteria 2375
139 Ga0207646_10033025 3300025922 Bacteria 4682
140 Ga0207646_10310018 3300025922 Bacteria 1426
141 Ga0207681_10135547 3300025923 Unclassified 1826
142 Ga0207694_10004072 3300025924 Bacteria 11490
143 Ga0207650_10000046 3300025925 Bacteria 178190
144 Ga0207690_10036328 3300025932 Unclassified 3189
145 Ga0207686_10000037 3300025934 Bacteria 127619
146 Ga0207686_10260863 3300025934 Bacteria 1270
147 Ga0207709_10000113 3300025935 Bacteria 126620
148 Ga0207709_10017826 3300025935 Unclassified 3969
149 Ga0207709_10229276 3300025935 Unclassified 1344
150 Ga0207665_10044418 3300025939 Bacteria 2974
151 Ga0207665_10118380 3300025939 Bacteria 1869
152 Ga0207691_10156467 3300025940 Bacteria 2001
153 Ga0207711_10373897 3300025941 Unclassified 1322
154 Ga0207711_10491092 3300025941 Unclassified 1144
155 Ga0207689_10000672 3300025942 Bacteria 32629
156 Ga0207689_10067601 3300025942 Unclassified 2937
157 Ga0207689_10079634 3300025942 Bacteria 2692
158 Ga0207689_10160006 3300025942 Unclassified 1855
159 Ga0207679_10558618 3300025945 Unclassified 1028
160 Ga0207651_10136722 3300025960 Bacteria 1886
161 Ga0207651_10408786 3300025960 Bacteria 1156
162 Ga0207651_10689530 3300025960 Unclassified 899
163 Ga0207712_10035231 3300025961 Bacteria 3398
164 Ga0207640_10145330 3300025981 Unclassified 1735
165 Ga0207703_10101884 3300026035 Bacteria 2435
166 Ga0207703_10164257 3300026035 Unclassified 1947
167 Ga0207703_10282339 3300026035 Unclassified 1508
168 Ga0207703_10347174 3300026035 Unclassified 1365
169 Ga0207703_10402038 3300026035 Unclassified 1271
170 Ga0207639_10200624 3300026041 Unclassified 1710
171 Ga0207639_10428967 3300026041 Bacteria 1197
172 Ga0207708_10000133 3300026075 Bacteria 58317
173 Ga0207708_10085505 3300026075 Bacteria 2426
174 Ga0207641_10907728 3300026088 Unclassified 875
175 Ga0207676_10018520 3300026095 Bacteria 5063
176 Ga0207676_10121436 3300026095 Bacteria 2204
177 Ga0207676_10309301 3300026095 Bacteria 1446
178 Ga0207674_10023387 3300026116 Bacteria 6620
179 Ga0207675_100028642 3300026118 Bacteria 5188
180 Ga0207698_10213557 3300026142 Unclassified 1738
181 Ga0268264_10049130 3300028381 Bacteria 3509
182 Ga0268264_10096641 3300028381 Unclassified 2559
183 Ga0307408_100022415 3300031548 Bacteria 4290
184 Ga0307405_10164523 3300031731 Bacteria 1575
185 Ga0307412_10235183 3300031911 Unclassified 1413
186 Ga0307409_100335026 3300031995 Unclassified 1421
187 Ga0307411_10019224 3300032005 Bacteria 3942
188 Ga0307415_100010582 3300032126 Bacteria 5230
189 Ga0373951_0005471 3300035091 Bacteria 2950
190 Ga0395900_0188879 3300037418 Bacteria 2091
191 Ga0395898_0261046 3300037466 Bacteria 1652
192 Ga0395901_0188374 3300038443 Bacteria 2164
193 Ga0395901_0216216 3300038443 Unclassified 2005
194 Ga0495663_0000217 3300046525 Bacteria 23003
195 Ga0496112_0109202 3300048915 Bacteria 2737
196 Ga0496112_0568690 3300048915 Bacteria 1067
197 Ga0501296_002758 3300049519 Bacteria 1856
198 Ga0501296_003671 3300049519 Bacteria 1645
199 Ga0501298_000570 3300049521 Bacteria 5037
200 Ga0501298_001024 3300049521 Bacteria 3998
201 Ga0501048_0185816 3300049582 Bacteria 1473
202 Ga0501198_004282 3300049649 Unclassified 1980
203 Ga0501202_000920 3300049652 Bacteria 4519
204 Ga0501207_004585 3300049654 Bacteria 1886
205 Ga0501209_064709 3300049656 Bacteria 1028
206 Ga0501217_000252 3300049661 Bacteria 8322
207 Ga0501217_004408 3300049661 Bacteria 2892
208 Ga0501223_031320 3300049663 Unclassified 1034
209 Ga0501230_002059 3300049667 Unclassified 2518
210 Ga0501233_001137 3300049668 Bacteria 4518
211 Ga0501259_007126 3300049688 Unclassified 1787
212 Ga0501221_024499 3300049704 Unclassified 1212
213 Ga0501225_0000869 3300049705 Bacteria 9400
214 Ga0501225_0025786 3300049705 Unclassified 1617
215 Ga0501234_013774 3300049707 Bacteria 1269
216 Ga0501283_000948 3300049779 Bacteria 3848
217 Ga0501283_005954 3300049779 Bacteria 1692
218 nmdc:mga05p37_265804_c1 3300050507 Bacteria 2051
219 nmdc:mga05p37_471785_c1 3300050507 Unclassified 1448
220 nmdc:mga0rr50_876_c1 3300050513 Bacteria 16284
221 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
222 nmdc:mga08x19_304994_c1 3300050514 Unclassified 1106
223 nmdc:mga0a205_342002_c1 3300050515 Bacteria 1364
224 nmdc:mga0a205_540757_c1 3300050515 Unclassified 1021
225 Ga0070699_100129566
226 MBSR1b_contig_10776166
227 MBSR1b_contig_2621893
228 JGI24751J29686_10000033
229 JGI25406J46586_10004034
230 Ga0065712_10079867
231 Ga0065715_10095600
232 Ga0065715_10103198
233 Ga0065707_10265676
234 Ga0070683_100201650
235 Ga0070670_100010482
236 Ga0070670_100135383
237 Ga0068869_100015495
238 Ga0068869_100122022
239 Ga0068869_100159100
240 Ga0068869_100161146
241 Ga0070680_100037184
242 Ga0070682_100128722
243 Ga0070660_100180488
244 Ga0070687_100377332
245 Ga0070661_100072249
246 Ga0070692_10264808
247 Ga0070669_100130604
248 Ga0070673_100102098
249 Ga0070659_100065128
250 Ga0070709_10156781
251 Ga0070705_100082518
252 Ga0070700_100000444
253 Ga0070700_100079878
254 Ga0070700_100084178
255 Ga0070708_100000295
256 Ga0070681_10013828
257 Ga0070706_100000002
258 Ga0070706_100019840
259 Ga0070706_100042293
260 Ga0070706_100081693
261 Ga0070707_100012888
262 Ga0070698_100002283
263 Ga0070698_100005699
264 Ga0070698_100328412
265 Ga0070699_100001161
266 Ga0070679_100038558
267 Ga0070679_100101012
268 Ga0070697_100000420
269 Ga0070697_100022966
270 Ga0070672_100083346
271 Ga0070686_100001872
272 Ga0070696_100046980
273 Ga0070665_100211694
274 Ga0070704_100050005
275 Ga0070664_100018898
276 Ga0068857_100016264
277 Ga0068854_100352619
278 Ga0070702_100046251
279 Ga0068852_100652484
280 Ga0068859_100004585
281 Ga0068859_100006103
282 Ga0068859_100022288
283 Ga0068859_100026465
284 Ga0068859_100068611
285 Ga0068859_100279255
286 Ga0068859_100284090
287 Ga0068859_100803958
288 Ga0068864_100037157
289 Ga0068861_100027873
290 Ga0068863_100105404
291 Ga0068863_100275293
292 Ga0068863_100550042
293 Ga0068858_100089045
294 Ga0068858_100332868
295 Ga0068858_100551398
296 Ga0068860_100022748
297 Ga0068860_100048182
298 Ga0068862_100542262
299 Ga0081539_10001267
300 Ga0068871_100001835
301 Ga0068871_100616230
302 Ga0075428_100268515
303 Ga0075433_10069745
304 Ga0075429_100101002
305 Ga0075436_100000008
306 Ga0075436_100212972
307 Ga0097620_100004586
308 Ga0097620_100006103
309 Ga0097620_100022287
310 Ga0097620_100026464
311 Ga0097620_100068609
312 Ga0097620_100279273
313 Ga0097620_100284078
314 Ga0097620_100803983
315 Ga0075435_100001677
316 Ga0111539_10333802
317 Ga0105247_10001797
318 Ga0114129_10021675
319 Ga0114129_10166168
320 Ga0114129_10413162
321 Ga0114129_10917576
322 Ga0114129_11215997
323 Ga0105243_10000086
324 Ga0105243_10174020
325 Ga0105243_10220876
326 Ga0105242_10000057
327 Ga0105242_10102950
328 Ga0105248_10003801
329 Ga0105248_10171542
330 Ga0105248_10175271
331 Ga0105248_10948650
332 Ga0105237_10058199
333 Ga0105237_10160137
334 Ga0105238_10019355
335 Ga0163162_10004714
336 Ga0163162_10008458
337 Ga0163162_10092789
338 Ga0157375_10072686
339 Ga0163163_10000263
340 Ga0163163_10061084
341 Ga0163163_10199179
342 Ga0163163_10384513
343 Ga0163163_10391233
344 Ga0157380_10350992
345 Ga0157377_10063279
346 Ga0157379_10081435
347 Ga0157379_10148733
348 Ga0207710_10000988
349 Ga0207699_10378742
350 Ga0207684_10000065
351 Ga0207684_10006579
352 Ga0207684_10066920
353 Ga0207684_10138239
354 Ga0207684_10306036
355 Ga0207707_10019871
356 Ga0207707_10027749
357 Ga0207671_10288976
358 Ga0207662_10027952
359 Ga0207662_10390798
360 Ga0207657_10190350
361 Ga0207652_10112489
362 Ga0207652_10116399
363 Ga0207646_10033025
364 Ga0207646_10310018
365 Ga0207681_10135547
366 Ga0207694_10004072
367 Ga0207650_10000046
368 Ga0207690_10036328
369 Ga0207686_10000037
370 Ga0207686_10260863
371 Ga0207709_10000113
372 Ga0207709_10017826
373 Ga0207709_10229276
374 Ga0207665_10044418
375 Ga0207665_10118380
376 Ga0207691_10156467
377 Ga0207711_10373897
378 Ga0207711_10491092
379 Ga0207689_10000672
380 Ga0207689_10067601
381 Ga0207689_10079634
382 Ga0207689_10160006
383 Ga0207679_10558618
384 Ga0207651_10136722
385 Ga0207651_10408786
386 Ga0207651_10689530
387 Ga0207712_10035231
388 Ga0207640_10145330
389 Ga0207703_10101884
390 Ga0207703_10164257
391 Ga0207703_10282339
392 Ga0207703_10347174
393 Ga0207703_10402038
394 Ga0207639_10200624
395 Ga0207639_10428967
396 Ga0207708_10000133
397 Ga0207708_10085505
398 Ga0207641_10907728
399 Ga0207676_10018520
400 Ga0207676_10121436
401 Ga0207676_10309301
402 Ga0207674_10023387
403 Ga0207675_100028642
404 Ga0207698_10213557
405 Ga0268264_10049130
406 Ga0268264_10096641
407 Ga0307408_100022415
408 Ga0307405_10164523
409 Ga0307412_10235183
410 Ga0307409_100335026
411 Ga0307411_10019224
412 Ga0307415_100010582
413 Ga0373951_0005471
414 Ga0395900_0188879
415 Ga0395898_0261046
416 Ga0395901_0188374
417 Ga0395901_0216216
418 Ga0495663_0000217
419 Ga0496112_0109202
420 Ga0496112_0568690
421 Ga0501296_002758
422 Ga0501296_003671
423 Ga0501298_000570
424 Ga0501298_001024
425 Ga0501048_0185816
426 Ga0501198_004282
427 Ga0501202_000920
428 Ga0501207_004585
429 Ga0501209_064709
430 Ga0501217_000252
431 Ga0501217_004408
432 Ga0501223_031320
433 Ga0501230_002059
434 Ga0501233_001137
435 Ga0501259_007126
436 Ga0501221_024499
437 Ga0501225_0000869
438 Ga0501225_0025786
439 Ga0501234_013774
440 Ga0501283_000948
441 Ga0501283_005954
442 nmdc:mga05p37_265804_c1
443 nmdc:mga05p37_471785_c1
444 nmdc:mga0rr50_876_c1
445 nmdc:mga08x19_16_c1
446 nmdc:mga08x19_304994_c1
447 nmdc:mga0a205_342002_c1
448 nmdc:mga0a205_540757_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

12

146

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7638 5 167
7pd5-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with 4-aminobenzoic acid 0.7635 5 116
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7601 5 168
7pho-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde 0.747 5 116
7pho-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde 0.746 5 116
ID Description Score Start End Superfamily
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8692 2 86 3.90.550.10
2z86A02 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7959 1 115 3.90.550.10
af_Q2FV58_23_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7836 5 96 3.90.550.10
af_A0A1D6ECY7_2_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7789 18 57 3.40.50.2000
af_P9WKW9_5_162_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7651 8 135 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A512NP91-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9813 1 255
AF-A0A5C8P7D8-F1-model_v4 Glycosyltransferase family 2 protein 0.9795 1 256 GO:0016740
AF-A0ZIU5-F1-model_v4 deleted 0.9791 1 253
AF-A0A844B674-F1-model_v4 Glycosyltransferase 0.9776 2 263 GO:0016740
AF-A0A7T9IJZ4-F1-model_v4 deleted 0.9766 1 170

Map