F336334

General Info

Members Datasets Scaffolds Average Seq Length
224 171 448 132

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_101819577|Ga0068869_1018195771
Length 149
Sequence LCRLRPYLVDAGTLRGVATLEDAARIALDLPQVTEGEHHGRRTWAVAGKGFAWERPFSKADLKRYGDVTPPDGPILAVRVEDLGEKEAVLAAPPKGFFTIPHFNGYAAVLIQLRVAGKKALREAIVDGWLACAPPALAEEYLAGARRRR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 8.48
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 7.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_101819577 3300005334 Bacteria 545
2 Ga0070658_10754419 3300005327 Unclassified 845
3 Ga0070683_100395856 3300005329 Bacteria 1317
4 Ga0070661_100702350 3300005344 Bacteria 824
5 Ga0070661_101023495 3300005344 Bacteria 686
6 Ga0070668_101070752 3300005347 Bacteria 727
7 Ga0070709_10353153 3300005434 Unclassified 1087
8 Ga0070710_10093703 3300005437 Bacteria 1776
9 Ga0070710_10660622 3300005437 Unclassified 734
10 Ga0070711_100019505 3300005439 Bacteria 4350
11 Ga0070705_101127931 3300005440 Bacteria 643
12 Ga0070684_101067294 3300005535 Bacteria 759
13 Ga0070684_101222889 3300005535 Bacteria 707
14 Ga0070686_100431661 3300005544 Bacteria 1009
15 Ga0068855_100126560 3300005563 Bacteria 2921
16 Ga0068855_100743938 3300005563 Bacteria 1046
17 Ga0070664_100038319 3300005564 Bacteria 4034
18 Ga0070664_100229714 3300005564 Bacteria 1663
19 Ga0070664_100484150 3300005564 Bacteria 1139
20 Ga0068857_100062880 3300005577 Bacteria 3300
21 Ga0068857_101537665 3300005577 Bacteria 649
22 Ga0068854_100213121 3300005578 Bacteria 1524
23 Ga0068856_100056976 3300005614 Bacteria 3858
24 Ga0068856_100202723 3300005614 Bacteria 1998
25 Ga0068856_100499919 3300005614 Bacteria 1237
26 Ga0068852_101420240 3300005616 Unclassified 716
27 Ga0068864_100021681 3300005618 Bacteria 5380
28 Ga0068864_100112654 3300005618 Bacteria 2425
29 Ga0068858_100000004 3300005842 Bacteria 336234
30 Ga0068858_100302993 3300005842 Bacteria 1525
31 Ga0075363_100003595 3300006048 Bacteria 6635
32 Ga0075364_10302974 3300006051 Unclassified 1088
33 Ga0070712_100105541 3300006175 Bacteria 2093
34 Ga0075367_10975219 3300006178 Bacteria 541
35 Ga0068871_101178984 3300006358 Bacteria 718
36 Ga0075428_100644741 3300006844 Unclassified 1130
37 Ga0075430_100095676 3300006846 Bacteria 2482
38 Ga0075430_100344755 3300006846 Bacteria 1230
39 Ga0075434_100542409 3300006871 Bacteria 1183
40 Ga0075429_100335848 3300006880 Bacteria 1322
41 Ga0075435_102014405 3300007076 Bacteria 507
42 Ga0105240_10015090 3300009093 Bacteria 10516
43 Ga0105240_10891222 3300009093 Unclassified 958
44 Ga0111539_11630710 3300009094 Bacteria 748
45 Ga0105247_10347751 3300009101 Bacteria 1042
46 Ga0114129_10420337 3300009147 Bacteria 1758
47 Ga0114129_12895260 3300009147 Bacteria 568
48 Ga0105243_10234403 3300009148 Unclassified 1630
49 Ga0105248_10003004 3300009177 Bacteria 18711
50 Ga0105248_10093882 3300009177 Bacteria 3379
51 Ga0105237_10010017 3300009545 Bacteria 10114
52 Ga0105238_10412029 3300009551 Unclassified 1345
53 Ga0105238_10900140 3300009551 Bacteria 903
54 Ga0105249_11914924 3300009553 Unclassified 666
55 Ga0105239_10050237 3300010375 Bacteria 4574
56 Ga0105239_11515610 3300010375 Unclassified 775
57 Ga0105246_10794666 3300011119 Bacteria 839
58 Ga0163162_10970380 3300013306 Bacteria 960
59 Ga0157375_11139688 3300013308 Bacteria 914
60 Ga0163163_10016942 3300014325 Bacteria 6783
61 Ga0163163_10074649 3300014325 Bacteria 3383
62 Ga0157377_10169317 3300014745 Bacteria 1365
63 Ga0157379_10000009 3300014968 Bacteria 131645
64 Ga0157379_10175589 3300014968 Bacteria 1934
65 Ga0206353_11708692 3300020082 Bacteria 1283
66 Ga0207692_10107209 3300025898 Bacteria 1544
67 Ga0207692_10594086 3300025898 Unclassified 711
68 Ga0207642_10437642 3300025899 Unclassified 790
69 Ga0207685_10054207 3300025905 Bacteria 1561
70 Ga0207695_10087479 3300025913 Bacteria 3138
71 Ga0207695_10735151 3300025913 Unclassified 867
72 Ga0207671_10013034 3300025914 Bacteria 6649
73 Ga0207693_10012001 3300025915 Bacteria 7003
74 Ga0207693_10117361 3300025915 Bacteria 2089
75 Ga0207663_11546537 3300025916 Bacteria 534
76 Ga0207657_10336969 3300025919 Bacteria 1191
77 Ga0207649_10450807 3300025920 Bacteria 971
78 Ga0207694_10412727 3300025924 Bacteria 1124
79 Ga0207659_10259305 3300025926 Bacteria 1413
80 Ga0207687_11146955 3300025927 Bacteria 668
81 Ga0207700_10552816 3300025928 Bacteria 1022
82 Ga0207670_10377397 3300025936 Bacteria 1128
83 Ga0207711_10000296 3300025941 Bacteria 53275
84 Ga0207711_10120101 3300025941 Bacteria 2345
85 Ga0207661_10165760 3300025944 Bacteria 1920
86 Ga0207679_10270573 3300025945 Bacteria 1453
87 Ga0207679_10406352 3300025945 Bacteria 1199
88 Ga0207679_10499958 3300025945 Bacteria 1085
89 Ga0207667_11355410 3300025949 Bacteria 686
90 Ga0207640_10083203 3300025981 Bacteria 2194
91 Ga0207703_10000011 3300026035 Bacteria 336248
92 Ga0207703_10391834 3300026035 Bacteria 1287
93 Ga0207702_10725636 3300026078 Bacteria 980
94 Ga0207641_10364542 3300026088 Bacteria 1380
95 Ga0207676_10098981 3300026095 Bacteria 2412
96 Ga0207674_10054669 3300026116 Bacteria 4064
97 Ga0207674_10063251 3300026116 Bacteria 3735
98 Ga0207698_10974824 3300026142 Bacteria 858
99 Ga0207698_11173936 3300026142 Bacteria 781
100 Ga0268264_10113407 3300028381 Bacteria 2378
101 Ga0268264_10328390 3300028381 Bacteria 1449
102 Ga0265336_10015063 3300028666 Bacteria 2552
103 Ga0307515_10054006 3300028794 Bacteria 5909
104 Ga0265338_10057287 3300028800 Bacteria 3448
105 Ga0307516_10007957 3300031730 Bacteria 12066
106 Ga0307416_100546643 3300032002 Unclassified 1231
107 Ga0316215_1024735 3300033544 Bacteria 616
108 Ga0373926_0001209 3300035083 Bacteria 7748
109 Ga0373934_0134506 3300035086 Bacteria 1009
110 Ga0373944_0003419 3300035089 Bacteria 4094
111 Ga0373923_0000192 3300035111 Bacteria 12429
112 Ga0373936_0000258 3300035113 Bacteria 17322
113 Ga0373936_0267184 3300035113 Bacteria 767
114 Ga0373945_0002709 3300035116 Bacteria 5558
115 Ga0373956_0498925 3300035119 Bacteria 581
116 Ga0373943_0006641 3300035170 Bacteria 5189
117 Ga0373946_0005564 3300035171 Bacteria 4544
118 Ga0373924_0058007 3300035410 Bacteria 1615
119 Ga0373935_0003837 3300035692 Bacteria 8766
120 Ga0373935_0285800 3300035692 Bacteria 1162
121 Ga0373947_0164171 3300035725 Bacteria 1438
122 Ga0373947_0258849 3300035725 Bacteria 1152
123 Ga0373937_0090955 3300036401 Bacteria 2827
124 Ga0372808_006288 3300036459 Bacteria 1596
125 Ga0373925_0113159 3300037068 Bacteria 2098
126 Ga0373925_0452962 3300037068 Bacteria 1051
127 Ga0373925_0539605 3300037068 Bacteria 959
128 Ga0395900_1212042 3300037418 Bacteria 670
129 Ga0395905_0081093 3300037471 Bacteria 3041
130 Ga0395901_0344048 3300038443 Bacteria 1540
131 Ga0451853_0282596 3300041512 Bacteria 1567
132 Ga0466957_0582461 3300044842 Bacteria 782
133 Ga0466960_0247509 3300044901 Bacteria 989
134 Ga0466960_0292749 3300044901 Bacteria 915
135 Ga0466958_0078884 3300045836 Bacteria 2024
136 Ga0466967_0971632 3300045976 Bacteria 845
137 Ga0466967_1259585 3300045976 Bacteria 737
138 Ga0495603_0031147 3300046455 Bacteria 3211
139 Ga0495629_0000717 3300046459 Bacteria 26869
140 Ga0495641_0010010 3300046461 Bacteria 5560
141 Ga0495651_0498670 3300046462 Bacteria 780
142 Ga0495653_0322296 3300046463 Bacteria 1001
143 Ga0495580_0048436 3300046472 Bacteria 3009
144 Ga0495582_0059999 3300046473 Bacteria 2098
145 Ga0495639_0000897 3300046475 Bacteria 13449
146 Ga0495662_0003358 3300046476 Bacteria 8117
147 Ga0495662_0106065 3300046476 Bacteria 1376
148 Ga0495662_0247485 3300046476 Bacteria 878
149 Ga0495594_0071236 3300046499 Bacteria 1933
150 Ga0495630_0003694 3300046517 Bacteria 10671
151 Ga0495630_0495928 3300046517 Bacteria 936
152 Ga0495666_0079673 3300046526 Bacteria 1550
153 Ga0495665_0011219 3300046531 Bacteria 4852
154 Ga0495640_0005850 3300046533 Bacteria 9761
155 Ga0495586_0003584 3300046535 Bacteria 8317
156 Ga0495667_0264399 3300046559 Bacteria 1094
157 Ga0495634_0002864 3300046642 Bacteria 14143
158 Ga0495634_0444721 3300046642 Bacteria 765
159 Ga0495634_0592191 3300046642 Bacteria 644
160 Ga0495635_0014686 3300046663 Bacteria 5478
161 Ga0495588_0023383 3300046674 Bacteria 3059
162 Ga0495647_0000309 3300046681 Bacteria 13701
163 Ga0495658_0016602 3300046683 Bacteria 3789
164 Ga0495613_0006107 3300046689 Bacteria 9011
165 Ga0495613_0447876 3300046689 Bacteria 875
166 Ga0495624_0013534 3300046690 Bacteria 5561
167 Ga0495581_0025523 3300047315 Bacteria 3426
168 Ga0495581_0074881 3300047315 Bacteria 1959
169 Ga0495674_0008881 3300047319 Bacteria 9557
170 Ga0495676_0507408 3300047321 Bacteria 791
171 Ga0495680_0012036 3300047322 Bacteria 7633
172 Ga0495593_0002406 3300047673 Bacteria 11258
173 Ga0495593_0398419 3300047673 Bacteria 688
174 Ga0495614_0002768 3300048089 Bacteria 7793
175 Ga0496101_0835531 3300048904 Bacteria 726
176 Ga0496102_1171601 3300048905 Bacteria 688
177 Ga0496105_0052593 3300048908 Bacteria 3364
178 Ga0496105_0187179 3300048908 Bacteria 1694
179 Ga0496106_0022968 3300048909 Bacteria 4632
180 Ga0496106_0701454 3300048909 Bacteria 807
181 Ga0496108_0022794 3300048911 Bacteria 5151
182 Ga0496109_0004855 3300048912 Bacteria 11222
183 Ga0496110_0005002 3300048913 Bacteria 10358
184 Ga0496110_0627501 3300048913 Bacteria 974
185 Ga0496111_0137183 3300048914 Bacteria 1812
186 Ga0496112_0035036 3300048915 Bacteria 4885
187 Ga0496112_0055221 3300048915 Bacteria 3905
188 Ga0496112_0589719 3300048915 Unclassified 1044
189 Ga0496113_0003508 3300048916 Bacteria 9408
190 Ga0496113_0010934 3300048916 Bacteria 6025
191 Ga0496113_0460538 3300048916 Bacteria 1022
192 Ga0496114_0007655 3300048917 Bacteria 8540
193 Ga0496114_0829529 3300048917 Bacteria 804
194 Ga0501033_0014998 3300049570 Bacteria 5881
195 Ga0501036_0085493 3300049572 Bacteria 2666
196 Ga0501038_0031685 3300049574 Bacteria 4670
197 Ga0501039_0328708 3300049575 Bacteria 1201
198 Ga0501040_0079685 3300049576 Bacteria 2267
199 Ga0501041_0002085 3300049577 Bacteria 11251
200 Ga0501042_0004777 3300049578 Bacteria 8654
201 Ga0501043_0435095 3300049579 Bacteria 988
202 Ga0501046_0024882 3300049580 Bacteria 4905
203 Ga0501048_0024661 3300049582 Bacteria 4389
204 Ga0501068_0007079 3300049584 Bacteria 6211
205 Ga0501071_0028308 3300049587 Bacteria 3948
206 Ga0501075_0030036 3300049591 Bacteria 4022
207 Ga0501076_0135072 3300049592 Bacteria 2002
208 Ga0501079_0004267 3300049741 Bacteria 10607
209 Ga0501081_0031968 3300049743 Bacteria 3568
210 Ga0501083_0989781 3300049744 Bacteria 547
211 Ga0501035_0149732 3300049822 Bacteria 2026
212 Ga0501045_0045517 3300049824 Bacteria 3194
213 nmdc:mga00v17_187698_c1 3300050491 Unclassified 1334
214 nmdc:mga05p37_548272_c1 3300050507 Bacteria 1317
215 nmdc:mga09592_293242_c1 3300050508 Bacteria 1410
216 nmdc:mga0qj67_31013_c1 3300050509 Bacteria 4163
217 nmdc:mga0n895_1643244_c1 3300050512 Bacteria 606
218 nmdc:mga08x19_313668_c1 3300050514 Bacteria 1091
219 nmdc:mga0a205_943966_c1 3300050515 Bacteria 709
220 Ga0495619_0015438 3300053085 Bacteria 4832
221 Ga0495619_0087883 3300053085 Bacteria 2102
222 Ga0501084_0297294 3300054114 Bacteria 1363
223 Ga0501082_0015246 3300060353 Bacteria 6620
224 Ga0530510_0047448 3300061734 Bacteria 3103
225 Ga0068869_101819577
226 Ga0070658_10754419
227 Ga0070683_100395856
228 Ga0070661_100702350
229 Ga0070661_101023495
230 Ga0070668_101070752
231 Ga0070709_10353153
232 Ga0070710_10093703
233 Ga0070710_10660622
234 Ga0070711_100019505
235 Ga0070705_101127931
236 Ga0070684_101067294
237 Ga0070684_101222889
238 Ga0070686_100431661
239 Ga0068855_100126560
240 Ga0068855_100743938
241 Ga0070664_100038319
242 Ga0070664_100229714
243 Ga0070664_100484150
244 Ga0068857_100062880
245 Ga0068857_101537665
246 Ga0068854_100213121
247 Ga0068856_100056976
248 Ga0068856_100202723
249 Ga0068856_100499919
250 Ga0068852_101420240
251 Ga0068864_100021681
252 Ga0068864_100112654
253 Ga0068858_100000004
254 Ga0068858_100302993
255 Ga0075363_100003595
256 Ga0075364_10302974
257 Ga0070712_100105541
258 Ga0075367_10975219
259 Ga0068871_101178984
260 Ga0075428_100644741
261 Ga0075430_100095676
262 Ga0075430_100344755
263 Ga0075434_100542409
264 Ga0075429_100335848
265 Ga0075435_102014405
266 Ga0105240_10015090
267 Ga0105240_10891222
268 Ga0111539_11630710
269 Ga0105247_10347751
270 Ga0114129_10420337
271 Ga0114129_12895260
272 Ga0105243_10234403
273 Ga0105248_10003004
274 Ga0105248_10093882
275 Ga0105237_10010017
276 Ga0105238_10412029
277 Ga0105238_10900140
278 Ga0105249_11914924
279 Ga0105239_10050237
280 Ga0105239_11515610
281 Ga0105246_10794666
282 Ga0163162_10970380
283 Ga0157375_11139688
284 Ga0163163_10016942
285 Ga0163163_10074649
286 Ga0157377_10169317
287 Ga0157379_10000009
288 Ga0157379_10175589
289 Ga0206353_11708692
290 Ga0207692_10107209
291 Ga0207692_10594086
292 Ga0207642_10437642
293 Ga0207685_10054207
294 Ga0207695_10087479
295 Ga0207695_10735151
296 Ga0207671_10013034
297 Ga0207693_10012001
298 Ga0207693_10117361
299 Ga0207663_11546537
300 Ga0207657_10336969
301 Ga0207649_10450807
302 Ga0207694_10412727
303 Ga0207659_10259305
304 Ga0207687_11146955
305 Ga0207700_10552816
306 Ga0207670_10377397
307 Ga0207711_10000296
308 Ga0207711_10120101
309 Ga0207661_10165760
310 Ga0207679_10270573
311 Ga0207679_10406352
312 Ga0207679_10499958
313 Ga0207667_11355410
314 Ga0207640_10083203
315 Ga0207703_10000011
316 Ga0207703_10391834
317 Ga0207702_10725636
318 Ga0207641_10364542
319 Ga0207676_10098981
320 Ga0207674_10054669
321 Ga0207674_10063251
322 Ga0207698_10974824
323 Ga0207698_11173936
324 Ga0268264_10113407
325 Ga0268264_10328390
326 Ga0265336_10015063
327 Ga0307515_10054006
328 Ga0265338_10057287
329 Ga0307516_10007957
330 Ga0307416_100546643
331 Ga0316215_1024735
332 Ga0373926_0001209
333 Ga0373934_0134506
334 Ga0373944_0003419
335 Ga0373923_0000192
336 Ga0373936_0000258
337 Ga0373936_0267184
338 Ga0373945_0002709
339 Ga0373956_0498925
340 Ga0373943_0006641
341 Ga0373946_0005564
342 Ga0373924_0058007
343 Ga0373935_0003837
344 Ga0373935_0285800
345 Ga0373947_0164171
346 Ga0373947_0258849
347 Ga0373937_0090955
348 Ga0372808_006288
349 Ga0373925_0113159
350 Ga0373925_0452962
351 Ga0373925_0539605
352 Ga0395900_1212042
353 Ga0395905_0081093
354 Ga0395901_0344048
355 Ga0451853_0282596
356 Ga0466957_0582461
357 Ga0466960_0247509
358 Ga0466960_0292749
359 Ga0466958_0078884
360 Ga0466967_0971632
361 Ga0466967_1259585
362 Ga0495603_0031147
363 Ga0495629_0000717
364 Ga0495641_0010010
365 Ga0495651_0498670
366 Ga0495653_0322296
367 Ga0495580_0048436
368 Ga0495582_0059999
369 Ga0495639_0000897
370 Ga0495662_0003358
371 Ga0495662_0106065
372 Ga0495662_0247485
373 Ga0495594_0071236
374 Ga0495630_0003694
375 Ga0495630_0495928
376 Ga0495666_0079673
377 Ga0495665_0011219
378 Ga0495640_0005850
379 Ga0495586_0003584
380 Ga0495667_0264399
381 Ga0495634_0002864
382 Ga0495634_0444721
383 Ga0495634_0592191
384 Ga0495635_0014686
385 Ga0495588_0023383
386 Ga0495647_0000309
387 Ga0495658_0016602
388 Ga0495613_0006107
389 Ga0495613_0447876
390 Ga0495624_0013534
391 Ga0495581_0025523
392 Ga0495581_0074881
393 Ga0495674_0008881
394 Ga0495676_0507408
395 Ga0495680_0012036
396 Ga0495593_0002406
397 Ga0495593_0398419
398 Ga0495614_0002768
399 Ga0496101_0835531
400 Ga0496102_1171601
401 Ga0496105_0052593
402 Ga0496105_0187179
403 Ga0496106_0022968
404 Ga0496106_0701454
405 Ga0496108_0022794
406 Ga0496109_0004855
407 Ga0496110_0005002
408 Ga0496110_0627501
409 Ga0496111_0137183
410 Ga0496112_0035036
411 Ga0496112_0055221
412 Ga0496112_0589719
413 Ga0496113_0003508
414 Ga0496113_0010934
415 Ga0496113_0460538
416 Ga0496114_0007655
417 Ga0496114_0829529
418 Ga0501033_0014998
419 Ga0501036_0085493
420 Ga0501038_0031685
421 Ga0501039_0328708
422 Ga0501040_0079685
423 Ga0501041_0002085
424 Ga0501042_0004777
425 Ga0501043_0435095
426 Ga0501046_0024882
427 Ga0501048_0024661
428 Ga0501068_0007079
429 Ga0501071_0028308
430 Ga0501075_0030036
431 Ga0501076_0135072
432 Ga0501079_0004267
433 Ga0501081_0031968
434 Ga0501083_0989781
435 Ga0501035_0149732
436 Ga0501045_0045517
437 nmdc:mga00v17_187698_c1
438 nmdc:mga05p37_548272_c1
439 nmdc:mga09592_293242_c1
440 nmdc:mga0qj67_31013_c1
441 nmdc:mga0n895_1643244_c1
442 nmdc:mga08x19_313668_c1
443 nmdc:mga0a205_943966_c1
444 Ga0495619_0015438
445 Ga0495619_0087883
446 Ga0501084_0297294
447 Ga0501082_0015246
448 Ga0530510_0047448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

28

143

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oyc-assembly4.cif.gz_A glycosylation associate protein (gap123) complex from streptococcus agalactiae 0.7264 19 42
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7225 19 120
6lnw-assembly1.cif.gz_A crystal structure of accessory secretory protein 1,2 and 3 in streptococcus pneumoniae 0.7025 19 42
4n06-assembly1.cif.gz_A crystal structure of cas1 from archaeoglobus fulgidus and its nucleolytic activity 0.6821 17 38
6p8t-assembly2.cif.gz_E acinetobacter baumannii trna synthetase in complex with compound 1 0.6793 8 42
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8635 9 127 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8433 9 127 3.30.70.1230
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7252 7 131 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7145 7 131 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7115 8 128 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A6C7EE07-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9953 6 130
AF-A0A3N4ZRC3-F1-model_v4 YjbR protein 0.992 7 128
AF-A0A538JLE0-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9915 6 130
AF-A0A841DMI3-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9864 6 130
AF-A0A3D5E1P3-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9838 6 130

Map