F336031

General Info

Members Datasets Scaffolds Average Seq Length
223 173 446 217

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0188839|Ga0501046_0188839_310_1077
Length 255
Sequence MPQIFPKALNPVARVTILCLPIIAASTGVGLAAFYRSSYATGIHETPPQPVAFSHAHHVGQLGIDCRYCHTSVETSGFANVPPTKTCMNCHQQIWQGADLLEPVRNSYKTNTPIEWNRVYNLPQYAYFNHSIHVSKGVGCVSCHGRMDEQNLTTQHATLLMEWCINCHREPEKHLRPRSEITSMLYNPATLAADGKPVKWTRADFPNHGKLPDGKDNELIGKERPTNQKELGLLLKEQYNVRDAVTLTNCSVCHR

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
129 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.38
Nodule 0
Rhizoplane 3.14
Rhizosphere 87.44
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0188839 3300049580 Bacteria 1538
2 JGI25156J39149_1003262 3300002705 Bacteria 5385
3 rootL2_10107482 3300003322 Bacteria 2333
4 Ga0065715_10337710 3300005293 Bacteria 972
5 Ga0065715_10381981 3300005293 Bacteria 906
6 Ga0070658_10078142 3300005327 Bacteria 2716
7 Ga0070676_10146862 3300005328 Bacteria 1506
8 Ga0070690_100051395 3300005330 Bacteria 2631
9 Ga0070670_100557782 3300005331 Unclassified 1022
10 Ga0068869_100071418 3300005334 Unclassified 2570
11 Ga0068868_100016346 3300005338 Bacteria 5511
12 Ga0068868_100143811 3300005338 Bacteria 1960
13 Ga0070689_100054092 3300005340 Bacteria 3107
14 Ga0070689_100400402 3300005340 Bacteria 1160
15 Ga0070687_100004459 3300005343 Bacteria 5586
16 Ga0070668_100104927 3300005347 Bacteria 2243
17 Ga0070675_100025526 3300005354 Bacteria 4737
18 Ga0070674_100006057 3300005356 Bacteria 7035
19 Ga0070659_100309883 3300005366 Bacteria 1318
20 Ga0070667_100057136 3300005367 Bacteria 3297
21 Ga0070713_100459573 3300005436 Bacteria 1197
22 Ga0070711_100090849 3300005439 Bacteria 2200
23 Ga0070705_100607974 3300005440 Bacteria 847
24 Ga0070700_100013429 3300005441 Bacteria 4600
25 Ga0070678_100367670 3300005456 Bacteria 1241
26 Ga0070681_10946150 3300005458 Bacteria 780
27 Ga0068867_100020838 3300005459 Bacteria 4675
28 Ga0070685_10008275 3300005466 Bacteria 5339
29 Ga0070679_100101052 3300005530 Bacteria 2870
30 Ga0070672_100027981 3300005543 Bacteria 4211
31 Ga0070686_100016195 3300005544 Bacteria 4334
32 Ga0070664_100002543 3300005564 Bacteria 14708
33 Ga0070664_100127005 3300005564 Bacteria 2238
34 Ga0070664_100334569 3300005564 Unclassified 1374
35 Ga0068857_100040548 3300005577 Bacteria 4129
36 Ga0068854_100089824 3300005578 Bacteria 2284
37 Ga0068856_100448958 3300005614 Bacteria 1310
38 Ga0070702_100246454 3300005615 Bacteria 1209
39 Ga0068852_100027762 3300005616 Bacteria 4618
40 Ga0068852_100773572 3300005616 Bacteria 973
41 Ga0068859_100056858 3300005617 Bacteria 3939
42 Ga0068864_100152612 3300005618 Bacteria 2094
43 Ga0068864_100229549 3300005618 Bacteria 1716
44 Ga0068866_10002945 3300005718 Bacteria 7025
45 Ga0068861_100384121 3300005719 Bacteria 1241
46 Ga0068870_10053407 3300005840 Bacteria 2146
47 Ga0068863_100026911 3300005841 Bacteria 5484
48 Ga0068858_100083281 3300005842 Bacteria 2974
49 Ga0068860_100048486 3300005843 Bacteria 4048
50 Ga0068862_100049897 3300005844 Bacteria 3575
51 Ga0068862_100104335 3300005844 Bacteria 2483
52 Ga0068862_100320207 3300005844 Unclassified 1431
53 Ga0081455_10247249 3300005937 Unclassified 1307
54 Ga0075365_10014660 3300006038 Bacteria 4721
55 Ga0075368_10014635 3300006042 Bacteria 2901
56 Ga0075364_10025844 3300006051 Bacteria 3741
57 Ga0075362_10002261 3300006177 Bacteria 6414
58 Ga0075367_10005280 3300006178 Bacteria 6390
59 Ga0075366_10001682 3300006195 Bacteria 11105
60 Ga0097621_100262347 3300006237 Bacteria 1516
61 Ga0075428_100025186 3300006844 Bacteria 6583
62 Ga0075428_100339596 3300006844 Bacteria 1613
63 Ga0075431_100004864 3300006847 Bacteria 13228
64 Ga0075433_10142693 3300006852 Bacteria 2129
65 Ga0075434_100088120 3300006871 Bacteria 3105
66 Ga0075429_100027302 3300006880 Bacteria 4954
67 Ga0068865_100004781 3300006881 Bacteria 8187
68 Ga0097620_100056864 3300006931 Bacteria 3939
69 Ga0075435_100032829 3300007076 Bacteria 4101
70 Ga0075435_100927000 3300007076 Bacteria 760
71 Ga0111539_10000070 3300009094 Bacteria 103017
72 Ga0105245_10179841 3300009098 Bacteria 2020
73 Ga0114129_10152041 3300009147 Bacteria 3167
74 Ga0114129_10189373 3300009147 Bacteria 2795
75 Ga0114129_11475159 3300009147 Bacteria 837
76 Ga0105242_10105790 3300009176 Bacteria 2390
77 Ga0105248_10059656 3300009177 Bacteria 4286
78 Ga0105237_10007972 3300009545 Bacteria 11535
79 Ga0105237_10523279 3300009545 Bacteria 1193
80 Ga0105246_10477163 3300011119 Bacteria 1054
81 Ga0157370_10058553 3300013104 Bacteria 3662
82 Ga0157370_11072816 3300013104 Unclassified 728
83 Ga0163162_10222875 3300013306 Bacteria 2015
84 Ga0163162_10640473 3300013306 Unclassified 1187
85 Ga0157372_10440683 3300013307 Bacteria 1518
86 Ga0157375_10154252 3300013308 Bacteria 2434
87 Ga0157375_10337437 3300013308 Unclassified 1672
88 Ga0163163_10393065 3300014325 Unclassified 1445
89 Ga0157380_10646251 3300014326 Bacteria 1054
90 Ga0157377_10070261 3300014745 Bacteria 2022
91 Ga0157377_10249461 3300014745 Bacteria 1150
92 Ga0163161_10041829 3300017792 Bacteria 3294
93 Ga0207642_10020243 3300025899 Bacteria 2593
94 Ga0207671_10044537 3300025914 Bacteria 3282
95 Ga0207662_10002294 3300025918 Bacteria 9578
96 Ga0207681_10134282 3300025923 Bacteria 1834
97 Ga0207659_10023060 3300025926 Bacteria 4150
98 Ga0207687_10201730 3300025927 Bacteria 1555
99 Ga0207706_10194540 3300025933 Bacteria 1779
100 Ga0207670_10257478 3300025936 Bacteria 1351
101 Ga0207670_10406421 3300025936 Bacteria 1090
102 Ga0207704_10461040 3300025938 Bacteria 1016
103 Ga0207691_10020977 3300025940 Bacteria 6175
104 Ga0207711_10098105 3300025941 Bacteria 2588
105 Ga0207689_10017717 3300025942 Bacteria 6020
106 Ga0207689_10026151 3300025942 Bacteria 4887
107 Ga0207679_10246181 3300025945 Bacteria 1517
108 Ga0207679_10362322 3300025945 Bacteria 1266
109 Ga0207679_10426978 3300025945 Bacteria 1171
110 Ga0207668_10453088 3300025972 Bacteria 1095
111 Ga0207640_10031607 3300025981 Bacteria 3273
112 Ga0207658_10039960 3300025986 Bacteria 3388
113 Ga0207677_10178023 3300026023 Unclassified 1670
114 Ga0207677_10272934 3300026023 Bacteria 1384
115 Ga0207703_10082796 3300026035 Bacteria 2679
116 Ga0207678_10006704 3300026067 Bacteria 10213
117 Ga0207678_10258736 3300026067 Bacteria 1491
118 Ga0207708_10067308 3300026075 Bacteria 2740
119 Ga0207702_10328222 3300026078 Bacteria 1459
120 Ga0207641_10242994 3300026088 Bacteria 1678
121 Ga0207648_10017750 3300026089 Bacteria 6461
122 Ga0207674_10072293 3300026116 Bacteria 3465
123 Ga0207675_100063685 3300026118 Bacteria 3445
124 Ga0207683_10015288 3300026121 Bacteria 6533
125 Ga0207698_10031474 3300026142 Bacteria 3829
126 Ga0209813_10003685 3300027866 Bacteria 3605
127 Ga0207428_10000093 3300027907 Bacteria 123740
128 Ga0268265_10216571 3300028380 Bacteria 1672
129 Ga0268264_10307995 3300028381 Bacteria 1493
130 Ga0307408_100066880 3300031548 Unclassified 2641
131 Ga0307508_10015158 3300031616 Bacteria 7024
132 Ga0307405_10338939 3300031731 Unclassified 1155
133 Ga0307410_10097617 3300031852 Bacteria 2099
134 Ga0307407_10129653 3300031903 Bacteria 1611
135 Ga0307416_100420788 3300032002 Bacteria 1380
136 Ga0307411_10306497 3300032005 Bacteria 1276
137 Ga0307507_10038105 3300033179 Bacteria 4880
138 Ga0373952_0081947 3300035092 Bacteria 825
139 Ga0373956_0090929 3300035119 Bacteria 1408
140 Ga0373961_0000006 3300035241 Bacteria 146085
141 Ga0373933_0323544 3300035724 Bacteria 1000
142 Ga0373937_0357964 3300036401 Bacteria 1383
143 Ga0395899_0017365 3300037312 Bacteria 5482
144 Ga0395898_0000303 3300037466 Bacteria 117164
145 Ga0395905_0000065 3300037471 Bacteria 184928
146 Ga0395905_0000683 3300037471 Bacteria 44990
147 Ga0395905_0010242 3300037471 Bacteria 9135
148 Ga0436364_0373987 3300037853 Bacteria 1453
149 Ga0395901_0033658 3300038443 Bacteria 5292
150 Ga0395901_0165396 3300038443 Bacteria 2323
151 Ga0395901_0207623 3300038443 Bacteria 2051
152 Ga0395901_0797204 3300038443 Bacteria 934
153 Ga0436365_1030008 3300039437 Bacteria 699
154 Ga0451804_0083950 3300041463 Bacteria 643
155 Ga0451837_0567270 3300041494 Bacteria 1510
156 Ga0451853_0269099 3300041512 Bacteria 905
157 Ga0450920_039406 3300042122 Bacteria 941
158 Ga0450894_000781 3300042131 Bacteria 5182
159 Ga0451577_0274286 3300042876 Bacteria 1527
160 Ga0451577_0315726 3300042876 Bacteria 1417
161 Ga0466969_0021564 3300044656 Bacteria 3329
162 Ga0466969_0024343 3300044656 Bacteria 3113
163 Ga0453683_0154761 3300044673 Bacteria 1449
164 Ga0453683_0393313 3300044673 Unclassified 893
165 Ga0466965_0099459 3300044683 Bacteria 1486
166 Ga0466965_0113991 3300044683 Bacteria 1391
167 Ga0466966_0008674 3300044684 Bacteria 6728
168 Ga0466966_0033134 3300044684 Bacteria 3345
169 Ga0466961_0014442 3300044693 Bacteria 5070
170 Ga0466961_0061980 3300044693 Bacteria 2376
171 Ga0466963_0097177 3300044694 Bacteria 2012
172 Ga0466963_0439015 3300044694 Bacteria 921
173 Ga0466964_0098583 3300044706 Bacteria 1284
174 Ga0453684_0143747 3300044712 Bacteria 2844
175 Ga0466971_0003079 3300044719 Bacteria 7085
176 Ga0466968_0005800 3300044735 Bacteria 4631
177 Ga0466970_0070868 3300044765 Bacteria 1874
178 Ga0466959_0001379 3300045049 Bacteria 14830
179 Ga0466959_0018596 3300045049 Bacteria 5103
180 Ga0466959_0093668 3300045049 Bacteria 2155
181 Ga0466959_0518993 3300045049 Unclassified 805
182 Ga0451576_0080280 3300045051 Bacteria 3394
183 Ga0466958_0006670 3300045836 Bacteria 6298
184 Ga0466958_0108653 3300045836 Bacteria 1730
185 Ga0466958_0178971 3300045836 Bacteria 1345
186 Ga0496104_0172446 3300048907 Bacteria 2074
187 Ga0496108_0245030 3300048911 Bacteria 1559
188 Ga0496109_0140394 3300048912 Unclassified 2259
189 Ga0496111_0716262 3300048914 Bacteria 727
190 Ga0496112_0396886 3300048915 Bacteria 1319
191 Ga0496112_0676101 3300048915 Bacteria 961
192 Ga0501046_0168606 3300049580 Bacteria 1644
193 Ga0501047_0004219 3300049581 Bacteria 13531
194 Ga0501047_0227041 3300049581 Bacteria 1722
195 Ga0501047_0479362 3300049581 Bacteria 1072
196 Ga0501070_0267746 3300049586 Bacteria 1396
197 Ga0501071_0425502 3300049587 Bacteria 1015
198 Ga0501071_0586553 3300049587 Unclassified 857
199 Ga0501074_0324589 3300049590 Bacteria 1093
200 Ga0501080_0008603 3300049742 Bacteria 9261
201 Ga0501083_0049326 3300049744 Bacteria 2838
202 Ga0501035_0071155 3300049822 Bacteria 3080
203 Ga0501035_0218306 3300049822 Bacteria 1629
204 Ga0501044_0001334 3300049823 Bacteria 29029
205 Ga0501044_0418795 3300049823 Bacteria 1250
206 nmdc:mga00v17_28094_c1 3300050491 Bacteria 3292
207 nmdc:mga0k408_6965_c1 3300050493 Bacteria 6032
208 nmdc:mga06z11_20711_c1 3300050494 Bacteria 3044
209 nmdc:mga04h51_2850_c1 3300050495 Bacteria 4145
210 nmdc:mga07m45_439369_c1 3300050496 Bacteria 757
211 nmdc:mga05p37_25381_c1 3300050507 Bacteria 7206
212 nmdc:mga06r32_1930_c1 3300050510 Bacteria 18482
213 nmdc:mga0n895_171553_c1 3300050512 Bacteria 2201
214 nmdc:mga0n895_319202_c1 3300050512 Bacteria 1574
215 nmdc:mga0rr50_30197_c1 3300050513 Bacteria 3834
216 nmdc:mga08x19_152355_c1 3300050514 Bacteria 1566
217 nmdc:mga0a205_11815_c1 3300050515 Bacteria 8058
218 Ga0495619_0225005 3300053085 Unclassified 1300
219 Ga0501084_0004911 3300054114 Bacteria 10930
220 Ga0501082_0506584 3300060353 Bacteria 1055
221 Ga0466962_0010747 3300061719 Bacteria 4400
222 Ga0466962_0108685 3300061719 Bacteria 1334
223 2673162967 2671180531 Bacteria 9045424
224 Ga0501046_0188839
225 JGI25156J39149_1003262
226 rootL2_10107482
227 Ga0065715_10337710
228 Ga0065715_10381981
229 Ga0070658_10078142
230 Ga0070676_10146862
231 Ga0070690_100051395
232 Ga0070670_100557782
233 Ga0068869_100071418
234 Ga0068868_100016346
235 Ga0068868_100143811
236 Ga0070689_100054092
237 Ga0070689_100400402
238 Ga0070687_100004459
239 Ga0070668_100104927
240 Ga0070675_100025526
241 Ga0070674_100006057
242 Ga0070659_100309883
243 Ga0070667_100057136
244 Ga0070713_100459573
245 Ga0070711_100090849
246 Ga0070705_100607974
247 Ga0070700_100013429
248 Ga0070678_100367670
249 Ga0070681_10946150
250 Ga0068867_100020838
251 Ga0070685_10008275
252 Ga0070679_100101052
253 Ga0070672_100027981
254 Ga0070686_100016195
255 Ga0070664_100002543
256 Ga0070664_100127005
257 Ga0070664_100334569
258 Ga0068857_100040548
259 Ga0068854_100089824
260 Ga0068856_100448958
261 Ga0070702_100246454
262 Ga0068852_100027762
263 Ga0068852_100773572
264 Ga0068859_100056858
265 Ga0068864_100152612
266 Ga0068864_100229549
267 Ga0068866_10002945
268 Ga0068861_100384121
269 Ga0068870_10053407
270 Ga0068863_100026911
271 Ga0068858_100083281
272 Ga0068860_100048486
273 Ga0068862_100049897
274 Ga0068862_100104335
275 Ga0068862_100320207
276 Ga0081455_10247249
277 Ga0075365_10014660
278 Ga0075368_10014635
279 Ga0075364_10025844
280 Ga0075362_10002261
281 Ga0075367_10005280
282 Ga0075366_10001682
283 Ga0097621_100262347
284 Ga0075428_100025186
285 Ga0075428_100339596
286 Ga0075431_100004864
287 Ga0075433_10142693
288 Ga0075434_100088120
289 Ga0075429_100027302
290 Ga0068865_100004781
291 Ga0097620_100056864
292 Ga0075435_100032829
293 Ga0075435_100927000
294 Ga0111539_10000070
295 Ga0105245_10179841
296 Ga0114129_10152041
297 Ga0114129_10189373
298 Ga0114129_11475159
299 Ga0105242_10105790
300 Ga0105248_10059656
301 Ga0105237_10007972
302 Ga0105237_10523279
303 Ga0105246_10477163
304 Ga0157370_10058553
305 Ga0157370_11072816
306 Ga0163162_10222875
307 Ga0163162_10640473
308 Ga0157372_10440683
309 Ga0157375_10154252
310 Ga0157375_10337437
311 Ga0163163_10393065
312 Ga0157380_10646251
313 Ga0157377_10070261
314 Ga0157377_10249461
315 Ga0163161_10041829
316 Ga0207642_10020243
317 Ga0207671_10044537
318 Ga0207662_10002294
319 Ga0207681_10134282
320 Ga0207659_10023060
321 Ga0207687_10201730
322 Ga0207706_10194540
323 Ga0207670_10257478
324 Ga0207670_10406421
325 Ga0207704_10461040
326 Ga0207691_10020977
327 Ga0207711_10098105
328 Ga0207689_10017717
329 Ga0207689_10026151
330 Ga0207679_10246181
331 Ga0207679_10362322
332 Ga0207679_10426978
333 Ga0207668_10453088
334 Ga0207640_10031607
335 Ga0207658_10039960
336 Ga0207677_10178023
337 Ga0207677_10272934
338 Ga0207703_10082796
339 Ga0207678_10006704
340 Ga0207678_10258736
341 Ga0207708_10067308
342 Ga0207702_10328222
343 Ga0207641_10242994
344 Ga0207648_10017750
345 Ga0207674_10072293
346 Ga0207675_100063685
347 Ga0207683_10015288
348 Ga0207698_10031474
349 Ga0209813_10003685
350 Ga0207428_10000093
351 Ga0268265_10216571
352 Ga0268264_10307995
353 Ga0307408_100066880
354 Ga0307508_10015158
355 Ga0307405_10338939
356 Ga0307410_10097617
357 Ga0307407_10129653
358 Ga0307416_100420788
359 Ga0307411_10306497
360 Ga0307507_10038105
361 Ga0373952_0081947
362 Ga0373956_0090929
363 Ga0373961_0000006
364 Ga0373933_0323544
365 Ga0373937_0357964
366 Ga0395899_0017365
367 Ga0395898_0000303
368 Ga0395905_0000065
369 Ga0395905_0000683
370 Ga0395905_0010242
371 Ga0436364_0373987
372 Ga0395901_0033658
373 Ga0395901_0165396
374 Ga0395901_0207623
375 Ga0395901_0797204
376 Ga0436365_1030008
377 Ga0451804_0083950
378 Ga0451837_0567270
379 Ga0451853_0269099
380 Ga0450920_039406
381 Ga0450894_000781
382 Ga0451577_0274286
383 Ga0451577_0315726
384 Ga0466969_0021564
385 Ga0466969_0024343
386 Ga0453683_0154761
387 Ga0453683_0393313
388 Ga0466965_0099459
389 Ga0466965_0113991
390 Ga0466966_0008674
391 Ga0466966_0033134
392 Ga0466961_0014442
393 Ga0466961_0061980
394 Ga0466963_0097177
395 Ga0466963_0439015
396 Ga0466964_0098583
397 Ga0453684_0143747
398 Ga0466971_0003079
399 Ga0466968_0005800
400 Ga0466970_0070868
401 Ga0466959_0001379
402 Ga0466959_0018596
403 Ga0466959_0093668
404 Ga0466959_0518993
405 Ga0451576_0080280
406 Ga0466958_0006670
407 Ga0466958_0108653
408 Ga0466958_0178971
409 Ga0496104_0172446
410 Ga0496108_0245030
411 Ga0496109_0140394
412 Ga0496111_0716262
413 Ga0496112_0396886
414 Ga0496112_0676101
415 Ga0501046_0168606
416 Ga0501047_0004219
417 Ga0501047_0227041
418 Ga0501047_0479362
419 Ga0501070_0267746
420 Ga0501071_0425502
421 Ga0501071_0586553
422 Ga0501074_0324589
423 Ga0501080_0008603
424 Ga0501083_0049326
425 Ga0501035_0071155
426 Ga0501035_0218306
427 Ga0501044_0001334
428 Ga0501044_0418795
429 nmdc:mga00v17_28094_c1
430 nmdc:mga0k408_6965_c1
431 nmdc:mga06z11_20711_c1
432 nmdc:mga04h51_2850_c1
433 nmdc:mga07m45_439369_c1
434 nmdc:mga05p37_25381_c1
435 nmdc:mga06r32_1930_c1
436 nmdc:mga0n895_171553_c1
437 nmdc:mga0n895_319202_c1
438 nmdc:mga0rr50_30197_c1
439 nmdc:mga08x19_152355_c1
440 nmdc:mga0a205_11815_c1
441 Ga0495619_0225005
442 Ga0501084_0004911
443 Ga0501082_0506584
444 Ga0466962_0010747
445 Ga0466962_0108685
446 2673162967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14522

Cytochrome_C7

Cytochrome c7 and related cytochrome c

126

188

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7985 3 215
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7878 3 215
6f0k-assembly1.cif.gz_A alternative complex iii 0.7737 5 215
6f0k-assembly1.cif.gz_A alternative complex iii 0.7701 5 215
6btm-assembly1.cif.gz_A structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.6194 16 215
ID Description Score Start End Superfamily
af_Q54WR1_132_533_3.40.50.12760 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.399 176 209 3.40.50.12760
af_A0A1D6PRE3_272_652_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.3716 159 211 3.30.70.270
af_A0A1D6KUQ6_639_844_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.354 153 211 3.30.70.270
af_A3FIN4_284_534_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.288 159 212 3.40.1110.10
1l8cA00 Mainly Alpha;Up-down Bundle;CREB-binding Protein; Chain A;TAZ domain 0.2804 159 211 1.20.1020.10
ID Description Score Start End GO Terms
AF-A0A2U3Q6U8-F1-model_v4 Chaperone protein HtpG 0.9772 43 215
AF-A0A3N5T2J7-F1-model_v4 Cytochrome C 0.9724 78 215
AF-A0A2V9T9S4-F1-model_v4 Cytochrome C 0.9695 120 215
AF-K9HLV1-F1-model_v4 Chaperone protein HtpG 0.9693 86 215
AF-A0A2V8D5P9-F1-model_v4 Cytochrome C 0.9678 51 215

Map