F336030

General Info

Members Datasets Scaffolds Average Seq Length
223 178 222 275

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0250164|Ga0501042_0250164_296_1177
Length 293
Sequence MPCRRDDDGTLDRMVRRRFGNAGFDVPVLGQGSWHIEQDPRPDAIRALRRGLDLGLTHIDTAEMYGAGAAETLIAEAIAGRRDEVVLVSKVLPEHASRKGTVAACEASLARLRTDRLDCYLLHWPGEHPLEDTVDAFEELRRQGKIRAWGVSNFDVADLDAVWRLAGARLACNQVLYHLQERAVEHAVMPWCEQHGVAVVAYSPFGSGAFPGPRSKGGRVLQAIAEAHGGTPRQVALAFLLERASVFAIPKAGRREHVEENAAAASLQLAPADLARIERAFPRGRRPRELPTL

Samples

Sample ID Description Type Environment
1 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
150 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
151 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
152 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
175 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 0.9
Rhizosphere 92.83
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10028445 3300005327 Bacteria 4488
2 Ga0070676_10052874 3300005328 Bacteria 2390
3 Ga0070670_100214191 3300005331 Bacteria 1675
4 Ga0070689_100280219 3300005340 Bacteria 1383
5 Ga0070674_100310136 3300005356 Bacteria 1261
6 Ga0070709_10008861 3300005434 Bacteria 5538
7 Ga0070714_100019740 3300005435 Bacteria 5496
8 Ga0070710_10003882 3300005437 Bacteria 7075
9 Ga0070711_100017651 3300005439 Bacteria 4546
10 Ga0070708_100028219 3300005445 Bacteria 4828
11 Ga0070678_100031571 3300005456 Bacteria 3657
12 Ga0068867_100037357 3300005459 Bacteria 3530
13 Ga0070685_10397052 3300005466 Bacteria 954
14 Ga0070706_100290744 3300005467 Bacteria 1525
15 Ga0070707_100141767 3300005468 Bacteria 2339
16 Ga0070698_100003449 3300005471 Bacteria 17394
17 Ga0070698_100049910 3300005471 Bacteria 4269
18 Ga0070697_100080738 3300005536 Bacteria 2679
19 Ga0070672_100474863 3300005543 Bacteria 1079
20 Ga0068852_100040847 3300005616 Bacteria 3917
21 Ga0068859_100014375 3300005617 Bacteria 7942
22 Ga0068858_100014665 3300005842 Bacteria 7378
23 Ga0068860_100111228 3300005843 Bacteria 2619
24 Ga0068862_100416940 3300005844 Bacteria 1259
25 Ga0070716_100004016 3300006173 Bacteria 6985
26 Ga0097621_100062470 3300006237 Bacteria 3058
27 Ga0075428_100026918 3300006844 Bacteria 6369
28 Ga0075428_100031610 3300006844 Bacteria 5849
29 Ga0075428_100503711 3300006844 Bacteria 1295
30 Ga0075430_100001469 3300006846 Bacteria 19182
31 Ga0075431_100006472 3300006847 Bacteria 11632
32 Ga0075431_100013146 3300006847 Bacteria 8364
33 Ga0075431_100031610 3300006847 Bacteria 5451
34 Ga0075431_100188239 3300006847 Bacteria 2115
35 Ga0075434_100008740 3300006871 Bacteria 9424
36 Ga0075434_100647454 3300006871 Bacteria 1075
37 Ga0075429_100000527 3300006880 Bacteria 29058
38 Ga0075429_100008634 3300006880 Bacteria 8863
39 Ga0097620_100014375 3300006931 Bacteria 7942
40 Ga0099794_10015175 3300007265 Bacteria 3394
41 Ga0099794_10021568 3300007265 Bacteria 2927
42 Ga0099794_10038004 3300007265 Bacteria 2280
43 Ga0099794_10063133 3300007265 Bacteria 1802
44 Ga0099794_10100051 3300007265 Bacteria 1446
45 Ga0099795_10012394 3300007788 Bacteria 2584
46 Ga0105247_10179442 3300009101 Bacteria 1412
47 Ga0114129_10028173 3300009147 Bacteria 7959
48 Ga0114129_10044603 3300009147 Bacteria 6237
49 Ga0114129_10077814 3300009147 Bacteria 4613
50 Ga0105243_10796805 3300009148 Bacteria 931
51 Ga0105248_10005913 3300009177 Bacteria 13450
52 Ga0105249_10510274 3300009553 Bacteria 1249
53 Ga0105239_10053740 3300010375 Bacteria 4418
54 Ga0105239_10214631 3300010375 Bacteria 2157
55 Ga0163162_10589590 3300013306 Bacteria 1238
56 Ga0157376_10005278 3300014969 Bacteria 9026
57 Ga0163161_10334134 3300017792 Bacteria 1201
58 Ga0207692_10003752 3300025898 Bacteria 5966
59 Ga0207685_10069593 3300025905 Bacteria 1422
60 Ga0207699_10029488 3300025906 Bacteria 3060
61 Ga0207645_10060095 3300025907 Bacteria 2427
62 Ga0207705_10054929 3300025909 Bacteria 2871
63 Ga0207684_10320664 3300025910 Bacteria 1336
64 Ga0207693_10000085 3300025915 Bacteria 83879
65 Ga0207663_10000552 3300025916 Bacteria 16504
66 Ga0207690_10006469 3300025932 Bacteria 6943
67 Ga0207665_10000066 3300025939 Bacteria 68434
68 Ga0207711_10028536 3300025941 Bacteria 4697
69 Ga0207689_10198136 3300025942 Bacteria 1657
70 Ga0207658_10088898 3300025986 Bacteria 2390
71 Ga0207708_10071119 3300026075 Bacteria 2664
72 Ga0207648_10030104 3300026089 Bacteria 4812
73 Ga0207675_100038341 3300026118 Bacteria 4471
74 Ga0207683_10020517 3300026121 Bacteria 5653
75 Ga0209179_1025717 3300027512 Bacteria 1176
76 Ga0209588_1003507 3300027671 Bacteria 4358
77 Ga0209588_1011706 3300027671 Bacteria 2653
78 Ga0268264_10724454 3300028381 Bacteria 989
79 Ga0265318_10042564 3300028577 Bacteria 1723
80 Ga0265320_10119393 3300031240 Bacteria 1203
81 Ga0265340_10074598 3300031247 Bacteria 1604
82 Ga0265340_10083739 3300031247 Bacteria 1498
83 Ga0265339_10062315 3300031249 Bacteria 2005
84 Ga0265331_10049811 3300031250 Bacteria 2011
85 Ga0265331_10152043 3300031250 Bacteria 1051
86 Ga0307408_100073810 3300031548 Bacteria 2529
87 Ga0307408_100394560 3300031548 Bacteria 1187
88 Ga0307408_100479282 3300031548 Bacteria 1085
89 Ga0307508_10017185 3300031616 Bacteria 6579
90 Ga0265314_10109786 3300031711 Bacteria 1755
91 Ga0316576_10003208 3300031727 Bacteria 9532
92 Ga0316578_10018265 3300031728 Bacteria 3838
93 Ga0307406_10072825 3300031901 Bacteria 2257
94 Ga0307407_10380131 3300031903 Bacteria 1008
95 Ga0307409_100460454 3300031995 Bacteria 1229
96 Ga0307409_100497173 3300031995 Bacteria 1187
97 Ga0307411_10029875 3300032005 Bacteria 3335
98 Ga0373934_0002889 3300035086 Bacteria 6280
99 Ga0373923_0001924 3300035111 Bacteria 6213
100 Ga0373953_0000362 3300035117 Bacteria 12287
101 Ga0373954_0002087 3300035118 Bacteria 8291
102 Ga0373956_0012830 3300035119 Bacteria 3479
103 Ga0373957_0037917 3300035120 Bacteria 1802
104 Ga0373960_0059587 3300035121 Bacteria 1155
105 Ga0373955_0011967 3300035172 Bacteria 4157
106 Ga0373924_0007237 3300035410 Bacteria 4001
107 Ga0373931_0148937 3300035691 Bacteria 1362
108 Ga0373933_0002791 3300035724 Bacteria 9752
109 Ga0373937_0096035 3300036401 Bacteria 2748
110 Ga0373937_0351046 3300036401 Bacteria 1397
111 Ga0395900_0092237 3300037418 Bacteria 3112
112 Ga0436363_0429614 3300039450 Bacteria 2308
113 Ga0436363_0721190 3300039450 Bacteria 1055
114 Ga0436363_1431275 3300039450 Bacteria 1221
115 Ga0466966_0057718 3300044684 Bacteria 2454
116 Ga0451576_0478233 3300045051 Bacteria 1308
117 Ga0495592_0007164 3300046454 Bacteria 8353
118 Ga0495629_0005565 3300046459 Bacteria 9406
119 Ga0495651_0001334 3300046462 Bacteria 19125
120 Ga0495653_0053709 3300046463 Bacteria 3081
121 Ga0495664_0159111 3300046477 Bacteria 1370
122 Ga0495608_0040102 3300046511 Bacteria 3137
123 Ga0495632_0000011 3300046519 Bacteria 266804
124 Ga0495648_0001270 3300046524 Bacteria 25160
125 Ga0495652_0002471 3300046529 Bacteria 19000
126 Ga0495640_0036620 3300046533 Bacteria 3465
127 Ga0495586_0379882 3300046535 Unclassified 812
128 Ga0495587_0000862 3300046536 Bacteria 20057
129 Ga0495645_0035659 3300046543 Bacteria 3626
130 Ga0495667_0000424 3300046559 Bacteria 27001
131 Ga0495634_0046308 3300046642 Bacteria 2936
132 Ga0495635_0006044 3300046663 Bacteria 8443
133 Ga0495657_0041333 3300046675 Bacteria 3156
134 Ga0495599_0037577 3300046678 Bacteria 3042
135 Ga0495623_0014992 3300046679 Bacteria 5009
136 Ga0495646_0012461 3300046680 Bacteria 5407
137 Ga0495658_0093533 3300046683 Bacteria 1784
138 Ga0495613_0158969 3300046689 Bacteria 1608
139 Ga0495624_0309267 3300046690 Bacteria 952
140 Ga0495600_0000337 3300046809 Bacteria 25017
141 Ga0495604_0061381 3300047317 Bacteria 2875
142 Ga0495674_0043337 3300047319 Bacteria 4005
143 Ga0495680_0066898 3300047322 Bacteria 2748
144 Ga0495675_0000559 3300047444 Bacteria 24018
145 Ga0495684_0002496 3300047471 Bacteria 14666
146 Ga0495593_0081125 3300047673 Bacteria 1678
147 Ga0495602_0056989 3300048088 Bacteria 3431
148 Ga0496109_0108567 3300048912 Bacteria 2579
149 Ga0496111_0095450 3300048914 Bacteria 2182
150 Ga0496121_0044062 3300048924 Bacteria 3855
151 Ga0496124_0000004 3300048927 Bacteria 976131
152 Ga0496126_0033931 3300048929 Bacteria 4799
153 Ga0501034_0280786 3300049571 Bacteria 1605
154 Ga0501034_0359825 3300049571 Bacteria 1382
155 Ga0501036_0013150 3300049572 Bacteria 6874
156 Ga0501037_0022443 3300049573 Bacteria 4668
157 Ga0501038_0059753 3300049574 Bacteria 3264
158 Ga0501038_0077463 3300049574 Bacteria 2807
159 Ga0501039_0028467 3300049575 Bacteria 4302
160 Ga0501039_0341433 3300049575 Bacteria 1177
161 Ga0501040_0223040 3300049576 Bacteria 1341
162 Ga0501042_0250164 3300049578 Bacteria 1279
163 Ga0501046_0007610 3300049580 Bacteria 9504
164 Ga0501046_0144379 3300049580 Bacteria 1798
165 Ga0501047_0049074 3300049581 Bacteria 4075
166 Ga0501067_0018388 3300049583 Bacteria 3872
167 Ga0501068_0030461 3300049584 Bacteria 3201
168 Ga0501069_0073224 3300049585 Bacteria 1921
169 Ga0501070_0226454 3300049586 Bacteria 1532
170 Ga0501071_0087091 3300049587 Bacteria 2291
171 Ga0501071_0098775 3300049587 Bacteria 2151
172 Ga0501072_0001450 3300049588 Bacteria 17777
173 Ga0501073_0093756 3300049589 Bacteria 2086
174 Ga0501074_0043571 3300049590 Bacteria 3248
175 Ga0501075_0001200 3300049591 Bacteria 16766
176 Ga0501075_0004468 3300049591 Bacteria 9470
177 Ga0501075_0028087 3300049591 Bacteria 4151
178 Ga0501076_0003285 3300049592 Bacteria 11327
179 Ga0501076_0008494 3300049592 Bacteria 7526
180 Ga0501076_0274836 3300049592 Bacteria 1380
181 Ga0501227_000068 3300049665 Bacteria 15669
182 Ga0501233_001528 3300049668 Bacteria 3955
183 Ga0501235_041021 3300049669 Bacteria 1058
184 Ga0501234_016336 3300049707 Bacteria 1171
185 Ga0501079_0001892 3300049741 Bacteria 15001
186 Ga0501079_0002727 3300049741 Bacteria 12872
187 Ga0501080_0083691 3300049742 Bacteria 2964
188 Ga0501081_0005116 3300049743 Bacteria 8440
189 Ga0501083_0028518 3300049744 Bacteria 3846
190 Ga0501283_030235 3300049779 Bacteria 906
191 Ga0501035_0009092 3300049822 Bacteria 9238
192 Ga0501044_0002983 3300049823 Bacteria 19183
193 Ga0501045_0056359 3300049824 Bacteria 2874
194 Ga0501045_0103011 3300049824 Bacteria 2113
195 nmdc:mga05p37_113685_c1 3300050507 Bacteria 3328
196 nmdc:mga05p37_230846_c1 3300050507 Bacteria 2230
197 nmdc:mga05p37_30528_c1 3300050507 Bacteria 6575
198 nmdc:mga09592_2128_c1 3300050508 Bacteria 15997
199 nmdc:mga0qj67_126124_c1 3300050509 Bacteria 2072
200 nmdc:mga0qj67_30424_c1 3300050509 Bacteria 4203
201 nmdc:mga0qj67_689555_c1 3300050509 Bacteria 813
202 nmdc:mga06r32_114408_c1 3300050510 Bacteria 2656
203 nmdc:mga06r32_19683_c1 3300050510 Bacteria 6200
204 nmdc:mga06r32_3161_c1 3300050510 Bacteria 14755
205 nmdc:mga08y16_252822_c1 3300050511 Bacteria 1821
206 nmdc:mga08y16_307514_c1 3300050511 Bacteria 1633
207 nmdc:mga0n895_272723_c1 3300050512 Bacteria 1716
208 Ga0495601_0027940 3300053077 Bacteria 3491
209 Ga0495595_0000340 3300053084 Bacteria 17922
210 Ga0495619_0000979 3300053085 Bacteria 18695
211 Ga0500651_0014655 3300053093 Bacteria 4799
212 Ga0500566_0039346 3300053094 Bacteria 2734
213 Ga0500618_013742 3300053125 Bacteria 2084
214 Ga0500568_0007541 3300053139 Bacteria 5326
215 Ga0500590_035926 3300053148 Bacteria 2563
216 Ga0500636_0002426 3300053177 Bacteria 10318
217 Ga0501084_0002742 3300054114 Bacteria 14214
218 Ga0501084_0051269 3300054114 Bacteria 3454
219 Ga0501082_0003905 3300060353 Bacteria 13022
220 Ga0501082_0010414 3300060353 Bacteria 8004
221 Ga0501082_0468436 3300060353 Bacteria 1101
222 Ga0530510_0006420 3300061734 Bacteria 8192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0379882 Ga0495586_0379882_21_719 230
2 3300049571 Ga0501034_0280786 Ga0501034_0280786_519_1343 248
3 3300049584 Ga0501068_0030461 Ga0501068_0030461_457_1284 248
4 3300049589 Ga0501073_0093756 Ga0501073_0093756_953_1780 248
5 3300050509 nmdc:mga0qj67_689555_c1 nmdc:mga0qj67_689555_c1_51_803 249
6 3300005471 Ga0070698_100003449 Ga0070698_1000034496 250
7 3300049585 Ga0501069_0073224 Ga0501069_0073224_1011_1838 250
8 3300049586 Ga0501070_0226454 Ga0501070_0226454_751_1512 250
9 3300006844 Ga0075428_100031610 Ga0075428_1000316105 252
10 3300036401 Ga0373937_0351046 Ga0373937_0351046_456_1220 252
11 3300007265 Ga0099794_10038004 Ga0099794_100380041 253
12 3300050507 nmdc:mga05p37_113685_c1 nmdc:mga05p37_113685_c1_994_1761 253
13 3300005340 Ga0070689_100280219 Ga0070689_1002802192 256
14 3300050511 nmdc:mga08y16_252822_c1 nmdc:mga08y16_252822_c1_209_985 256
15 3300005328 Ga0070676_10052874 Ga0070676_100528742 257
16 3300025907 Ga0207645_10060095 Ga0207645_100600952 257
17 3300049575 Ga0501039_0341433 Ga0501039_0341433_384_1163 257
18 3300027671 Ga0209588_1003507 Ga0209588_10035072 263
19 3300031247 Ga0265340_10074598 Ga0265340_100745982 263
20 3300031250 Ga0265331_10152043 Ga0265331_101520431 263
21 3300035086 Ga0373934_0002889 Ga0373934_0002889_3689_4486 263
22 3300035111 Ga0373923_0001924 Ga0373923_0001924_4048_4845 263
23 3300035117 Ga0373953_0000362 Ga0373953_0000362_2100_2897 263
24 3300035118 Ga0373954_0002087 Ga0373954_0002087_2466_3263 263
25 3300035119 Ga0373956_0012830 Ga0373956_0012830_577_1374 263
26 3300035120 Ga0373957_0037917 Ga0373957_0037917_621_1418 263
27 3300035172 Ga0373955_0011967 Ga0373955_0011967_1760_2557 263
28 3300035410 Ga0373924_0007237 Ga0373924_0007237_1954_2751 263
29 3300035724 Ga0373933_0002791 Ga0373933_0002791_7234_8031 263
30 3300036401 Ga0373937_0096035 Ga0373937_0096035_680_1477 263
31 3300046454 Ga0495592_0007164 Ga0495592_0007164_5653_6450 263
32 3300046459 Ga0495629_0005565 Ga0495629_0005565_7313_8110 263
33 3300046462 Ga0495651_0001334 Ga0495651_0001334_16374_17171 263
34 3300046463 Ga0495653_0053709 Ga0495653_0053709_1899_2696 263
35 3300046511 Ga0495608_0040102 Ga0495608_0040102_386_1183 263
36 3300046524 Ga0495648_0001270 Ga0495648_0001270_19738_20535 263
37 3300046529 Ga0495652_0002471 Ga0495652_0002471_2825_3622 263
38 3300046533 Ga0495640_0036620 Ga0495640_0036620_1248_2045 263
39 3300046536 Ga0495587_0000862 Ga0495587_0000862_1272_2069 263
40 3300046543 Ga0495645_0035659 Ga0495645_0035659_1232_2029 263
41 3300046559 Ga0495667_0000424 Ga0495667_0000424_24933_25730 263
42 3300046642 Ga0495634_0046308 Ga0495634_0046308_970_1767 263
43 3300046663 Ga0495635_0006044 Ga0495635_0006044_5469_6266 263
44 3300046675 Ga0495657_0041333 Ga0495657_0041333_1974_2771 263
45 3300046678 Ga0495599_0037577 Ga0495599_0037577_690_1487 263
46 3300046679 Ga0495623_0014992 Ga0495623_0014992_258_1055 263
47 3300046680 Ga0495646_0012461 Ga0495646_0012461_1728_2525 263
48 3300046689 Ga0495613_0158969 Ga0495613_0158969_90_887 263
49 3300046809 Ga0495600_0000337 Ga0495600_0000337_20778_21575 263
50 3300047317 Ga0495604_0061381 Ga0495604_0061381_1399_2196 263
51 3300047322 Ga0495680_0066898 Ga0495680_0066898_1272_2069 263
52 3300047444 Ga0495675_0000559 Ga0495675_0000559_15639_16436 263
53 3300047471 Ga0495684_0002496 Ga0495684_0002496_1363_2160 263
54 3300047673 Ga0495593_0081125 Ga0495593_0081125_855_1652 263
55 3300048088 Ga0495602_0056989 Ga0495602_0056989_680_1477 263
56 3300050512 nmdc:mga0n895_272723_c1 nmdc:mga0n895_272723_c1_317_1108 263
57 3300053077 Ga0495601_0027940 Ga0495601_0027940_2355_3152 263
58 3300053084 Ga0495595_0000340 Ga0495595_0000340_15277_16074 263
59 3300053085 Ga0495619_0000979 Ga0495619_0000979_16500_17297 263
60 3300005445 Ga0070708_100028219 Ga0070708_1000282192 265
61 3300005467 Ga0070706_100290744 Ga0070706_1002907441 265
62 3300005536 Ga0070697_100080738 Ga0070697_1000807383 265
63 3300005616 Ga0068852_100040847 Ga0068852_1000408473 265
64 3300007265 Ga0099794_10021568 Ga0099794_100215682 265
65 3300007265 Ga0099794_10100051 Ga0099794_101000512 265
66 3300025910 Ga0207684_10320664 Ga0207684_103206642 265
67 3300027671 Ga0209588_1011706 Ga0209588_10117063 265
68 3300005356 Ga0070674_100310136 Ga0070674_1003101362 266
69 3300025986 Ga0207658_10088898 Ga0207658_100888983 266
70 3300007265 Ga0099794_10063133 Ga0099794_100631332 267
71 3300005331 Ga0070670_100214191 Ga0070670_1002141912 270
72 3300031727 Ga0316576_10003208 Ga0316576_100032084 270
73 3300031728 Ga0316578_10018265 Ga0316578_100182653 270
74 3300049665 Ga0501227_000068 Ga0501227_000068_13756_14586 273
75 3300049668 Ga0501233_001528 Ga0501233_001528_2235_3065 273
76 3300049669 Ga0501235_041021 Ga0501235_041021_69_899 273
77 3300049707 Ga0501234_016336 Ga0501234_016336_154_984 273
78 3300025942 Ga0207689_10198136 Ga0207689_101981362 274
79 3300026075 Ga0207708_10071119 Ga0207708_100711192 274
80 3300031616 Ga0307508_10017185 Ga0307508_100171855 274
81 3300035121 Ga0373960_0059587 Ga0373960_0059587_61_900 274
82 3300039450 Ga0436363_0429614 Ga0436363_0429614_843_1673 274
83 3300060353 Ga0501082_0468436 Ga0501082_0468436_151_984 274
84 3300005468 Ga0070707_100141767 Ga0070707_1001417671 275
85 3300005471 Ga0070698_100049910 Ga0070698_1000499104 275
86 3300006844 Ga0075428_100503711 Ga0075428_1005037112 275
87 3300006847 Ga0075431_100188239 Ga0075431_1001882394 275
88 3300046519 Ga0495632_0000011 Ga0495632_0000011_66060_66893 275
89 iso_pu_bacteria 2857542790 2857547408 275
90 3300005434 Ga0070709_10008861 Ga0070709_100088613 277
91 3300005435 Ga0070714_100019740 Ga0070714_1000197403 277
92 3300005437 Ga0070710_10003882 Ga0070710_100038825 277
93 3300005439 Ga0070711_100017651 Ga0070711_1000176512 277
94 3300006173 Ga0070716_100004016 Ga0070716_1000040164 277
95 3300007265 Ga0099794_10015175 Ga0099794_100151753 277
96 3300007788 Ga0099795_10012394 Ga0099795_100123941 277
97 3300009147 Ga0114129_10028173 Ga0114129_100281737 277
98 3300010375 Ga0105239_10214631 Ga0105239_102146312 277
99 3300025898 Ga0207692_10003752 Ga0207692_100037523 277
100 3300025905 Ga0207685_10069593 Ga0207685_100695932 277
101 3300025906 Ga0207699_10029488 Ga0207699_100294883 277
102 3300025915 Ga0207693_10000085 Ga0207693_100000856 277
103 3300025916 Ga0207663_10000552 Ga0207663_100005527 277
104 3300025932 Ga0207690_10006469 Ga0207690_100064692 277
105 3300025939 Ga0207665_10000066 Ga0207665_1000006631 277
106 3300027512 Ga0209179_1025717 Ga0209179_10257171 277
107 3300028577 Ga0265318_10042564 Ga0265318_100425642 277
108 3300031240 Ga0265320_10119393 Ga0265320_101193932 277
109 3300031247 Ga0265340_10083739 Ga0265340_100837392 277
110 3300035691 Ga0373931_0148937 Ga0373931_0148937_444_1307 277
111 3300037418 Ga0395900_0092237 Ga0395900_0092237_1427_2266 277
112 3300039450 Ga0436363_0721190 Ga0436363_0721190_112_951 277
113 3300039450 Ga0436363_1431275 Ga0436363_1431275_363_1202 277
114 3300044684 Ga0466966_0057718 Ga0466966_0057718_984_1853 277
115 3300048912 Ga0496109_0108567 Ga0496109_0108567_1083_1946 277
116 3300048914 Ga0496111_0095450 Ga0496111_0095450_160_1014 277
117 3300048929 Ga0496126_0033931 Ga0496126_0033931_2088_2960 277
118 3300053093 Ga0500651_0014655 Ga0500651_0014655_3537_4376 277
119 3300053094 Ga0500566_0039346 Ga0500566_0039346_1088_1927 277
120 3300053125 Ga0500618_013742 Ga0500618_013742_974_1813 277
121 3300053139 Ga0500568_0007541 Ga0500568_0007541_3806_4669 277
122 3300053148 Ga0500590_035926 Ga0500590_035926_988_1827 277
123 3300053177 Ga0500636_0002426 Ga0500636_0002426_703_1542 277
124 3300006844 Ga0075428_100026918 Ga0075428_1000269182 278
125 3300006846 Ga0075430_100001469 Ga0075430_10000146916 278
126 3300006847 Ga0075431_100006472 Ga0075431_1000064727 278
127 3300006847 Ga0075431_100013146 Ga0075431_1000131462 278
128 3300006847 Ga0075431_100031610 Ga0075431_1000316106 278
129 3300006880 Ga0075429_100000527 Ga0075429_1000005279 278
130 3300006880 Ga0075429_100008634 Ga0075429_1000086346 278
131 3300009147 Ga0114129_10044603 Ga0114129_100446035 278
132 3300009147 Ga0114129_10077814 Ga0114129_100778142 278
133 3300031548 Ga0307408_100073810 Ga0307408_1000738102 278
134 3300031548 Ga0307408_100394560 Ga0307408_1003945602 278
135 3300031548 Ga0307408_100479282 Ga0307408_1004792822 278
136 3300031901 Ga0307406_10072825 Ga0307406_100728252 278
137 3300031903 Ga0307407_10380131 Ga0307407_103801311 278
138 3300031995 Ga0307409_100460454 Ga0307409_1004604541 278
139 3300031995 Ga0307409_100497173 Ga0307409_1004971731 278
140 3300032005 Ga0307411_10029875 Ga0307411_100298754 278
141 3300049574 Ga0501038_0077463 Ga0501038_0077463_1196_2038 278
142 3300049575 Ga0501039_0028467 Ga0501039_0028467_54_896 278
143 3300049576 Ga0501040_0223040 Ga0501040_0223040_418_1260 278
144 3300049578 Ga0501042_0250164 Ga0501042_0250164_296_1177 278
145 3300049580 Ga0501046_0144379 Ga0501046_0144379_528_1370 278
146 3300049583 Ga0501067_0018388 Ga0501067_0018388_2546_3388 278
147 3300049587 Ga0501071_0087091 Ga0501071_0087091_694_1536 278
148 3300049587 Ga0501071_0098775 Ga0501071_0098775_59_901 278
149 3300049588 Ga0501072_0001450 Ga0501072_0001450_6320_7162 278
150 3300049590 Ga0501074_0043571 Ga0501074_0043571_1584_2426 278
151 3300049591 Ga0501075_0001200 Ga0501075_0001200_5597_6439 278
152 3300049591 Ga0501075_0004468 Ga0501075_0004468_483_1325 278
153 3300049591 Ga0501075_0028087 Ga0501075_0028087_2479_3321 278
154 3300049592 Ga0501076_0003285 Ga0501076_0003285_2215_3057 278
155 3300049592 Ga0501076_0008494 Ga0501076_0008494_4386_5228 278
156 3300049592 Ga0501076_0274836 Ga0501076_0274836_47_928 278
157 3300049741 Ga0501079_0001892 Ga0501079_0001892_5102_5944 278
158 3300049741 Ga0501079_0002727 Ga0501079_0002727_4420_5262 278
159 3300049742 Ga0501080_0083691 Ga0501080_0083691_219_1061 278
160 3300049743 Ga0501081_0005116 Ga0501081_0005116_3166_4008 278
161 3300049744 Ga0501083_0028518 Ga0501083_0028518_1011_1853 278
162 3300049779 Ga0501283_030235 Ga0501283_030235_18_860 278
163 3300049824 Ga0501045_0056359 Ga0501045_0056359_1098_1940 278
164 3300049824 Ga0501045_0103011 Ga0501045_0103011_844_1686 278
165 3300050507 nmdc:mga05p37_230846_c1 nmdc:mga05p37_230846_c1_725_1567 278
166 3300050507 nmdc:mga05p37_30528_c1 nmdc:mga05p37_30528_c1_5571_6413 278
167 3300050508 nmdc:mga09592_2128_c1 nmdc:mga09592_2128_c1_2199_3041 278
168 3300050509 nmdc:mga0qj67_126124_c1 nmdc:mga0qj67_126124_c1_1157_1999 278
169 3300050509 nmdc:mga0qj67_30424_c1 nmdc:mga0qj67_30424_c1_653_1495 278
170 3300050510 nmdc:mga06r32_19683_c1 nmdc:mga06r32_19683_c1_2487_3329 278
171 3300050510 nmdc:mga06r32_3161_c1 nmdc:mga06r32_3161_c1_6802_7644 278
172 3300050511 nmdc:mga08y16_307514_c1 nmdc:mga08y16_307514_c1_37_879 278
173 3300054114 Ga0501084_0002742 Ga0501084_0002742_9238_10080 278
174 3300054114 Ga0501084_0051269 Ga0501084_0051269_1129_2010 278
175 3300060353 Ga0501082_0003905 Ga0501082_0003905_3827_4669 278
176 3300060353 Ga0501082_0010414 Ga0501082_0010414_5281_6123 278
177 3300061734 Ga0530510_0006420 Ga0530510_0006420_5534_6376 278
178 3300005327 Ga0070658_10028445 Ga0070658_100284453 279
179 3300005456 Ga0070678_100031571 Ga0070678_1000315714 279
180 3300005459 Ga0068867_100037357 Ga0068867_1000373574 279
181 3300005466 Ga0070685_10397052 Ga0070685_103970521 279
182 3300005543 Ga0070672_100474863 Ga0070672_1004748631 279
183 3300005617 Ga0068859_100014375 Ga0068859_1000143755 279
184 3300005842 Ga0068858_100014665 Ga0068858_1000146655 279
185 3300005843 Ga0068860_100111228 Ga0068860_1001112282 279
186 3300005844 Ga0068862_100416940 Ga0068862_1004169402 279
187 3300006237 Ga0097621_100062470 Ga0097621_1000624703 279
188 3300006871 Ga0075434_100008740 Ga0075434_1000087403 279
189 3300006871 Ga0075434_100647454 Ga0075434_1006474541 279
190 3300006931 Ga0097620_100014375 Ga0097620_1000143755 279
191 3300009101 Ga0105247_10179442 Ga0105247_101794422 279
192 3300009148 Ga0105243_10796805 Ga0105243_107968051 279
193 3300009177 Ga0105248_10005913 Ga0105248_100059139 279
194 3300009553 Ga0105249_10510274 Ga0105249_105102742 279
195 3300010375 Ga0105239_10053740 Ga0105239_100537402 279
196 3300013306 Ga0163162_10589590 Ga0163162_105895902 279
197 3300014969 Ga0157376_10005278 Ga0157376_100052785 279
198 3300017792 Ga0163161_10334134 Ga0163161_103341341 279
199 3300025909 Ga0207705_10054929 Ga0207705_100549292 279
200 3300025941 Ga0207711_10028536 Ga0207711_100285363 279
201 3300026089 Ga0207648_10030104 Ga0207648_100301043 279
202 3300026118 Ga0207675_100038341 Ga0207675_1000383412 279
203 3300026121 Ga0207683_10020517 Ga0207683_100205172 279
204 3300028381 Ga0268264_10724454 Ga0268264_107244542 279
205 3300031249 Ga0265339_10062315 Ga0265339_100623152 279
206 3300031250 Ga0265331_10049811 Ga0265331_100498111 279
207 3300031711 Ga0265314_10109786 Ga0265314_101097861 279
208 3300045051 Ga0451576_0478233 Ga0451576_0478233_36_881 279
209 3300046477 Ga0495664_0159111 Ga0495664_0159111_388_1239 279
210 3300046683 Ga0495658_0093533 Ga0495658_0093533_182_1030 279
211 3300046690 Ga0495624_0309267 Ga0495624_0309267_13_864 279
212 3300047319 Ga0495674_0043337 Ga0495674_0043337_851_1702 279
213 3300048924 Ga0496121_0044062 Ga0496121_0044062_844_1689 279
214 3300048927 Ga0496124_0000004 Ga0496124_0000004_898370_899215 279
215 3300049571 Ga0501034_0359825 Ga0501034_0359825_507_1355 279
216 3300049572 Ga0501036_0013150 Ga0501036_0013150_5857_6705 279
217 3300049573 Ga0501037_0022443 Ga0501037_0022443_1331_2179 279
218 3300049574 Ga0501038_0059753 Ga0501038_0059753_1115_1963 279
219 3300049580 Ga0501046_0007610 Ga0501046_0007610_5273_6121 279
220 3300049581 Ga0501047_0049074 Ga0501047_0049074_156_1004 279
221 3300049822 Ga0501035_0009092 Ga0501035_0009092_5634_6482 279
222 3300049823 Ga0501044_0002983 Ga0501044_0002983_15987_16835 279
223 3300050510 nmdc:mga06r32_114408_c1 nmdc:mga06r32_114408_c1_790_1632 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

28

281

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.9473 1 267
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.9353 2 279
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9346 1 279
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.934 2 279
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.9288 2 279
ID Description Score Start End Superfamily
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9438 1 265 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9346 1 279 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9249 1 279 3.20.20.100
af_Q0D8N4_49_369_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9166 3 270 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9132 1 268 3.20.20.100
ID Description Score Start End GO Terms
AF-W1XLZ6-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9963 33 136 GO:0016491
AF-W1ESS6-F1-model_v4 Putative oxidoreductase YeaE, aldo/keto reductase family 0.9914 60 137 GO:0016491
AF-A0A258CZV1-F1-model_v4 Oxidoreductase 0.9898 110 279 GO:0016491
AF-A0A0S6UQN5-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9854 1 279 GO:0016491
AF-A0A3N5YJ64-F1-model_v4 Aldo/keto reductase 0.9844 13 134 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.45 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map