F335927

General Info

Members Datasets Scaffolds Average Seq Length
223 158 446 239

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0197373|Ga0495608_0197373_78_893
Length 271
Sequence MDPATNDVNSTAVGFMPNESYRLRSSFARMNAGDVTLTTSDGPMRTFEAIPDGTSKGAIVVVQEAFGVNPHIEDVTRRCAAAGYHAVAPDLFHRSGSGCVVEYGNFEKVLEYFGDVSGDAAVLADIEAALDHLRGSGFADAQIGIVGFCFGGRVTFLTALRHALGAAVGFYGGGIVTGRFPQFPALIDGADQLQTPWLGLFGDQDGSIPVDDVETLRATLAKLPIDTEIVRYAEAGHGFHCDARPDYRADDAADAWNRALDWFAAHLSHKE

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
141 2527291627 Frankia casuarinae Thr Isolate Nodule
142 2527291629 Frankia sp. BMG5.23 Isolate Nodule
143 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
144 2576861822 Frankia sp. CeD Isolate Nodule
145 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
146 2619618881 Frankia sp. ACN1ag Isolate Unclassified
147 2619619003 Frankia sp. CpI1-P Isolate Nodule
148 2626541554 Frankia sp. AvcI.1 Isolate Nodule
149 2671180195 Frankia sp. CcI49 Isolate Nodule
150 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
151 2684623036 Frankia sp. CgIM4 Isolate Nodule
152 2710264753 Frankia sp. KB5 Isolate Nodule
153 2773857922 Frankia sp. CcI49 Isolate Nodule
154 2773857924 Frankia sp. CgIS1 Isolate Nodule
155 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
156 637000116 Frankia casuarinae CcI3 Isolate Nodule
157 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
158 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.93
Metatranscriptomes 0
Isolates 8.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 5.83
Rhizoplane 10.31
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0197373 3300046511 Bacteria 1269
2 Ga0070676_10074292 3300005328 Unclassified 2047
3 Ga0070680_100087845 3300005336 Bacteria 2571
4 Ga0070668_100147342 3300005347 Bacteria 1901
5 Ga0070669_100127058 3300005353 Bacteria 1952
6 Ga0070675_100085906 3300005354 Bacteria 2629
7 Ga0070675_100137220 3300005354 Unclassified 2088
8 Ga0070700_100196426 3300005441 Bacteria 1414
9 Ga0070694_100017721 3300005444 Bacteria 4501
10 Ga0070708_100032155 3300005445 Bacteria 4548
11 Ga0070681_10000185 3300005458 Bacteria 48054
12 Ga0068867_100435246 3300005459 Bacteria 1114
13 Ga0070706_100007398 3300005467 Bacteria 10299
14 Ga0070706_100263316 3300005467 Bacteria 1609
15 Ga0070706_100662168 3300005467 Bacteria 969
16 Ga0070706_100875926 3300005467 Bacteria 830
17 Ga0070707_100103741 3300005468 Bacteria 2756
18 Ga0070707_100358934 3300005468 Bacteria 1415
19 Ga0070698_100044125 3300005471 Bacteria 4567
20 Ga0070698_100199345 3300005471 Bacteria 1938
21 Ga0070699_100119230 3300005518 Bacteria 2319
22 Ga0070679_100000187 3300005530 Bacteria 49927
23 Ga0070679_100137309 3300005530 Bacteria 2426
24 Ga0070697_100217873 3300005536 Bacteria 1626
25 Ga0070686_100180935 3300005544 Bacteria 1498
26 Ga0070693_100132100 3300005547 Bacteria 1562
27 Ga0070665_100040312 3300005548 Bacteria 4695
28 Ga0070665_100342588 3300005548 Bacteria 1500
29 Ga0070704_100467035 3300005549 Bacteria 1090
30 Ga0068859_100286165 3300005617 Bacteria 1741
31 Ga0068858_100592189 3300005842 Unclassified 1075
32 Ga0068860_100002031 3300005843 Bacteria 21331
33 Ga0075365_10024226 3300006038 Bacteria 3825
34 Ga0097621_100459656 3300006237 Bacteria 1148
35 Ga0075428_100022707 3300006844 Bacteria 6943
36 Ga0075428_100490403 3300006844 Bacteria 1315
37 Ga0075430_100070177 3300006846 Bacteria 2939
38 Ga0075431_100013539 3300006847 Bacteria 8242
39 Ga0075433_10002567 3300006852 Bacteria 13825
40 Ga0075434_100024882 3300006871 Bacteria 5853
41 Ga0075434_100426678 3300006871 Bacteria 1347
42 Ga0075429_100161997 3300006880 Bacteria 1959
43 Ga0097620_100286161 3300006931 Bacteria 1741
44 Ga0075435_100001522 3300007076 Bacteria 14923
45 Ga0075435_100043490 3300007076 Bacteria 3595
46 Ga0111539_10110249 3300009094 Bacteria 3229
47 Ga0111539_10444351 3300009094 Bacteria 1510
48 Ga0114129_10040753 3300009147 Bacteria 6547
49 Ga0114129_10059854 3300009147 Bacteria 5325
50 Ga0114129_10091024 3300009147 Bacteria 4228
51 Ga0114129_11156457 3300009147 Bacteria 966
52 Ga0105243_10804162 3300009148 Unclassified 927
53 Ga0157370_10369114 3300013104 Bacteria 1322
54 Ga0163162_10112413 3300013306 Bacteria 2822
55 Ga0157375_10412259 3300013308 Unclassified 1517
56 Ga0163163_10076171 3300014325 Bacteria 3349
57 Ga0157376_10582182 3300014969 Bacteria 1112
58 Ga0207692_10153164 3300025898 Bacteria 1322
59 Ga0207684_10008795 3300025910 Bacteria 8964
60 Ga0207684_10060742 3300025910 Bacteria 3210
61 Ga0207684_10380831 3300025910 Archaea 1213
62 Ga0207684_10401594 3300025910 Bacteria 1178
63 Ga0207707_10000339 3300025912 Bacteria 49412
64 Ga0207693_10084471 3300025915 Bacteria 2487
65 Ga0207660_10011038 3300025917 Bacteria 5875
66 Ga0207652_10000316 3300025921 Bacteria 49842
67 Ga0207646_10234859 3300025922 Bacteria 1657
68 Ga0207659_10161865 3300025926 Unclassified 1758
69 Ga0207700_10243856 3300025928 Bacteria 1532
70 Ga0207644_10148905 3300025931 Bacteria 1810
71 Ga0207706_10191232 3300025933 Bacteria 1796
72 Ga0207709_10338095 3300025935 Bacteria 1132
73 Ga0207669_10027351 3300025937 Bacteria 3121
74 Ga0207665_10157602 3300025939 Bacteria 1631
75 Ga0207691_10311282 3300025940 Unclassified 1351
76 Ga0207651_10744780 3300025960 Bacteria 866
77 Ga0207641_10171517 3300026088 Bacteria 1981
78 Ga0268264_10007267 3300028381 Bacteria 9270
79 Ga0265334_10003274 3300028573 Bacteria 7392
80 Ga0265338_10001439 3300028800 Bacteria 38657
81 Ga0265338_10051476 3300028800 Bacteria 3707
82 Ga0265325_10011326 3300031241 Bacteria 5125
83 Ga0265325_10044200 3300031241 Bacteria 2321
84 Ga0265339_10002296 3300031249 Bacteria 13799
85 Ga0265331_10007481 3300031250 Bacteria 6313
86 Ga0265327_10000231 3300031251 Bacteria 113114
87 Ga0265327_10009248 3300031251 Bacteria 7145
88 Ga0265313_10006897 3300031595 Bacteria 7898
89 Ga0373923_0199472 3300035111 Unclassified 925
90 Ga0316574_0018253 3300035398 Bacteria 4120
91 Ga0373931_0282788 3300035691 Unclassified 1019
92 Ga0373935_0325922 3300035692 Bacteria 1091
93 Ga0373947_0013528 3300035725 Bacteria 4675
94 Ga0373947_0510389 3300035725 Unclassified 817
95 Ga0373937_0279864 3300036401 Bacteria 1575
96 Ga0316582_0151716 3300036647 Bacteria 1567
97 Ga0395901_0561343 3300038443 Bacteria 1156
98 Ga0436360_1127653 3300039438 Bacteria 916
99 Ga0436362_0854733 3300039453 Bacteria 6571
100 Ga0495592_0334394 3300046454 Bacteria 975
101 Ga0495629_0101476 3300046459 Bacteria 2008
102 Ga0495629_0122731 3300046459 Bacteria 1810
103 Ga0495653_0227585 3300046463 Bacteria 1250
104 Ga0495582_0239821 3300046473 Bacteria 1039
105 Ga0495608_0341108 3300046511 Bacteria 923
106 Ga0495618_0114334 3300046514 Bacteria 1728
107 Ga0495618_0192237 3300046514 Bacteria 1294
108 Ga0495618_0294860 3300046514 Bacteria 1009
109 Ga0495630_0038594 3300046517 Bacteria 3572
110 Ga0495630_0365857 3300046517 Bacteria 1104
111 Ga0495666_0160007 3300046526 Bacteria 1044
112 Ga0495666_0175640 3300046526 Bacteria 990
113 Ga0495652_0057553 3300046529 Bacteria 3296
114 Ga0495640_0133539 3300046533 Bacteria 1605
115 Ga0495640_0141553 3300046533 Bacteria 1550
116 Ga0495586_0165952 3300046535 Bacteria 1247
117 Ga0495622_0031848 3300046557 Bacteria 2463
118 Ga0495634_0020575 3300046642 Bacteria 4678
119 Ga0495657_0228981 3300046675 Bacteria 1125
120 Ga0495657_0365494 3300046675 Bacteria 852
121 Ga0495658_0033148 3300046683 Bacteria 2827
122 Ga0495658_0092229 3300046683 Bacteria 1795
123 Ga0495658_0223793 3300046683 Bacteria 1179
124 Ga0495613_0034749 3300046689 Bacteria 3743
125 Ga0495613_0060092 3300046689 Bacteria 2785
126 Ga0495624_0209105 3300046690 Bacteria 1184
127 Ga0495676_0117844 3300047321 Bacteria 1937
128 Ga0495676_0195354 3300047321 Bacteria 1409
129 Ga0495684_0105970 3300047471 Bacteria 2124
130 Ga0495614_0047677 3300048089 Bacteria 1838
131 Ga0496100_0166653 3300048903 Bacteria 1583
132 Ga0496101_0027338 3300048904 Bacteria 3974
133 Ga0496102_0529993 3300048905 Bacteria 1100
134 Ga0496104_0103408 3300048907 Bacteria 2728
135 Ga0496104_0259222 3300048907 Unclassified 1652
136 Ga0496105_0154339 3300048908 Bacteria 1886
137 Ga0496106_0055312 3300048909 Bacteria 2999
138 Ga0496107_0035801 3300048910 Bacteria 3560
139 Ga0496108_0658358 3300048911 Bacteria 910
140 Ga0496108_0751662 3300048911 Bacteria 843
141 Ga0496109_0258026 3300048912 Bacteria 1642
142 Ga0496110_0319263 3300048913 Bacteria 1415
143 Ga0496111_0040775 3300048914 Bacteria 3331
144 Ga0496111_0605087 3300048914 Bacteria 802
145 Ga0496112_0005298 3300048915 Bacteria 11126
146 Ga0496112_0021990 3300048915 Bacteria 6071
147 Ga0496112_0120438 3300048915 Bacteria 2594
148 Ga0496112_0142429 3300048915 Bacteria 2367
149 Ga0496113_0038971 3300048916 Bacteria 3496
150 Ga0496115_0082989 3300048918 Unclassified 2612
151 Ga0496115_0168394 3300048918 Unclassified 1812
152 Ga0496115_0361062 3300048918 Bacteria 1183
153 Ga0501034_0003702 3300049571 Bacteria 17265
154 Ga0501034_0009281 3300049571 Bacteria 10311
155 Ga0501037_0031962 3300049573 Bacteria 3886
156 Ga0501040_0117256 3300049576 Bacteria 1866
157 Ga0501068_0000384 3300049584 Bacteria 22308
158 Ga0501069_0000008 3300049585 Bacteria 182652
159 Ga0501069_0031517 3300049585 Bacteria 2916
160 Ga0501070_0000042 3300049586 Bacteria 109349
161 Ga0501070_0027563 3300049586 Bacteria 4765
162 Ga0501071_0008375 3300049587 Bacteria 6833
163 Ga0501073_0000372 3300049589 Bacteria 30265
164 Ga0501073_0056786 3300049589 Bacteria 2738
165 Ga0501074_0000010 3300049590 Bacteria 99952
166 Ga0501074_0390885 3300049590 Bacteria 986
167 Ga0501076_0081007 3300049592 Bacteria 2606
168 Ga0501080_0000543 3300049742 Bacteria 29719
169 Ga0501080_0000775 3300049742 Bacteria 25976
170 Ga0501080_0194018 3300049742 Bacteria 1866
171 Ga0501080_0202861 3300049742 Bacteria 1820
172 Ga0501080_0244846 3300049742 Bacteria 1636
173 Ga0501081_0156892 3300049743 Bacteria 1638
174 Ga0501081_0727299 3300049743 Unclassified 746
175 Ga0501083_0072015 3300049744 Bacteria 2297
176 Ga0501083_0108444 3300049744 Unclassified 1826
177 nmdc:mga03n38_15593_c1 3300050490 Bacteria 2936
178 nmdc:mga0yw44_36074_c1 3300050492 Bacteria 2911
179 nmdc:mga05p37_272039_c1 3300050507 Bacteria 2024
180 nmdc:mga05p37_85460_c1 3300050507 Bacteria 3887
181 nmdc:mga09592_157361_c1 3300050508 Bacteria 1961
182 nmdc:mga0qj67_74897_c1 3300050509 Bacteria 2705
183 nmdc:mga0qj67_855348_c1 3300050509 Bacteria 718
184 nmdc:mga06r32_269522_c1 3300050510 Bacteria 1690
185 nmdc:mga06r32_32556_c1 3300050510 Bacteria 4906
186 nmdc:mga06r32_44684_c1 3300050510 Bacteria 4219
187 nmdc:mga06r32_635389_c1 3300050510 Bacteria 1036
188 nmdc:mga06r32_781966_c1 3300050510 Bacteria 916
189 nmdc:mga08y16_789143_c1 3300050511 Bacteria 943
190 nmdc:mga08y16_93901_c1 3300050511 Bacteria 3125
191 nmdc:mga0n895_593193_c1 3300050512 Bacteria 1111
192 nmdc:mga0n895_779683_c1 3300050512 Bacteria 947
193 nmdc:mga0rr50_139202_c1 3300050513 Unclassified 1951
194 nmdc:mga0rr50_715961_c1 3300050513 Bacteria 854
195 nmdc:mga08x19_31640_c1 3300050514 Bacteria 3330
196 nmdc:mga0a205_50477_c1 3300050515 Bacteria 4017
197 Ga0495601_0144078 3300053077 Bacteria 1555
198 Ga0495601_0477188 3300053077 Unclassified 806
199 Ga0495619_0121491 3300053085 Bacteria 1791
200 Ga0495619_0193402 3300053085 Bacteria 1408
201 Ga0500616_0038106 3300053153 Bacteria 2598
202 Ga0501084_0000026 3300054114 Bacteria 132271
203 Ga0501084_0577837 3300054114 Bacteria 950
204 Ga0501082_0261252 3300060353 Bacteria 1506
205 Ga0530510_0005312 3300061734 Bacteria 8905
206 2528206643 2527291627 Bacteria 5309833
207 2528212025 2527291629 Bacteria 5267418
208 2546946952 2546825537 Bacteria 5389291
209 2579747539 2576861822 Bacteria 5004595
210 2579854547 2579778521 Bacteria 7624758
211 2619853814 2619618881 Bacteria 7521104
212 2620349504 2619619003 Bacteria 7619552
213 2626634840 2626541554 Bacteria 7741902
214 2671835800 2671180195 Bacteria 9757215
215 2686539653 2684623035 Bacteria 8032739
216 2686543534 2684623036 Bacteria 5199090
217 2710602613 2710264753 Bacteria 5455564
218 2774853956 2773857922 Bacteria 9757215
219 2774867074 2773857924 Bacteria 5256821
220 2895884880 2895880812 Bacteria 11255272
221 637877865 637000116 Bacteria 5433628
222 8054920568 8054913762 Bacteria 7713009
223 8054922609 8054920844 Bacteria 7068637
224 Ga0495608_0197373
225 Ga0070676_10074292
226 Ga0070680_100087845
227 Ga0070668_100147342
228 Ga0070669_100127058
229 Ga0070675_100085906
230 Ga0070675_100137220
231 Ga0070700_100196426
232 Ga0070694_100017721
233 Ga0070708_100032155
234 Ga0070681_10000185
235 Ga0068867_100435246
236 Ga0070706_100007398
237 Ga0070706_100263316
238 Ga0070706_100662168
239 Ga0070706_100875926
240 Ga0070707_100103741
241 Ga0070707_100358934
242 Ga0070698_100044125
243 Ga0070698_100199345
244 Ga0070699_100119230
245 Ga0070679_100000187
246 Ga0070679_100137309
247 Ga0070697_100217873
248 Ga0070686_100180935
249 Ga0070693_100132100
250 Ga0070665_100040312
251 Ga0070665_100342588
252 Ga0070704_100467035
253 Ga0068859_100286165
254 Ga0068858_100592189
255 Ga0068860_100002031
256 Ga0075365_10024226
257 Ga0097621_100459656
258 Ga0075428_100022707
259 Ga0075428_100490403
260 Ga0075430_100070177
261 Ga0075431_100013539
262 Ga0075433_10002567
263 Ga0075434_100024882
264 Ga0075434_100426678
265 Ga0075429_100161997
266 Ga0097620_100286161
267 Ga0075435_100001522
268 Ga0075435_100043490
269 Ga0111539_10110249
270 Ga0111539_10444351
271 Ga0114129_10040753
272 Ga0114129_10059854
273 Ga0114129_10091024
274 Ga0114129_11156457
275 Ga0105243_10804162
276 Ga0157370_10369114
277 Ga0163162_10112413
278 Ga0157375_10412259
279 Ga0163163_10076171
280 Ga0157376_10582182
281 Ga0207692_10153164
282 Ga0207684_10008795
283 Ga0207684_10060742
284 Ga0207684_10380831
285 Ga0207684_10401594
286 Ga0207707_10000339
287 Ga0207693_10084471
288 Ga0207660_10011038
289 Ga0207652_10000316
290 Ga0207646_10234859
291 Ga0207659_10161865
292 Ga0207700_10243856
293 Ga0207644_10148905
294 Ga0207706_10191232
295 Ga0207709_10338095
296 Ga0207669_10027351
297 Ga0207665_10157602
298 Ga0207691_10311282
299 Ga0207651_10744780
300 Ga0207641_10171517
301 Ga0268264_10007267
302 Ga0265334_10003274
303 Ga0265338_10001439
304 Ga0265338_10051476
305 Ga0265325_10011326
306 Ga0265325_10044200
307 Ga0265339_10002296
308 Ga0265331_10007481
309 Ga0265327_10000231
310 Ga0265327_10009248
311 Ga0265313_10006897
312 Ga0373923_0199472
313 Ga0316574_0018253
314 Ga0373931_0282788
315 Ga0373935_0325922
316 Ga0373947_0013528
317 Ga0373947_0510389
318 Ga0373937_0279864
319 Ga0316582_0151716
320 Ga0395901_0561343
321 Ga0436360_1127653
322 Ga0436362_0854733
323 Ga0495592_0334394
324 Ga0495629_0101476
325 Ga0495629_0122731
326 Ga0495653_0227585
327 Ga0495582_0239821
328 Ga0495608_0341108
329 Ga0495618_0114334
330 Ga0495618_0192237
331 Ga0495618_0294860
332 Ga0495630_0038594
333 Ga0495630_0365857
334 Ga0495666_0160007
335 Ga0495666_0175640
336 Ga0495652_0057553
337 Ga0495640_0133539
338 Ga0495640_0141553
339 Ga0495586_0165952
340 Ga0495622_0031848
341 Ga0495634_0020575
342 Ga0495657_0228981
343 Ga0495657_0365494
344 Ga0495658_0033148
345 Ga0495658_0092229
346 Ga0495658_0223793
347 Ga0495613_0034749
348 Ga0495613_0060092
349 Ga0495624_0209105
350 Ga0495676_0117844
351 Ga0495676_0195354
352 Ga0495684_0105970
353 Ga0495614_0047677
354 Ga0496100_0166653
355 Ga0496101_0027338
356 Ga0496102_0529993
357 Ga0496104_0103408
358 Ga0496104_0259222
359 Ga0496105_0154339
360 Ga0496106_0055312
361 Ga0496107_0035801
362 Ga0496108_0658358
363 Ga0496108_0751662
364 Ga0496109_0258026
365 Ga0496110_0319263
366 Ga0496111_0040775
367 Ga0496111_0605087
368 Ga0496112_0005298
369 Ga0496112_0021990
370 Ga0496112_0120438
371 Ga0496112_0142429
372 Ga0496113_0038971
373 Ga0496115_0082989
374 Ga0496115_0168394
375 Ga0496115_0361062
376 Ga0501034_0003702
377 Ga0501034_0009281
378 Ga0501037_0031962
379 Ga0501040_0117256
380 Ga0501068_0000384
381 Ga0501069_0000008
382 Ga0501069_0031517
383 Ga0501070_0000042
384 Ga0501070_0027563
385 Ga0501071_0008375
386 Ga0501073_0000372
387 Ga0501073_0056786
388 Ga0501074_0000010
389 Ga0501074_0390885
390 Ga0501076_0081007
391 Ga0501080_0000543
392 Ga0501080_0000775
393 Ga0501080_0194018
394 Ga0501080_0202861
395 Ga0501080_0244846
396 Ga0501081_0156892
397 Ga0501081_0727299
398 Ga0501083_0072015
399 Ga0501083_0108444
400 nmdc:mga03n38_15593_c1
401 nmdc:mga0yw44_36074_c1
402 nmdc:mga05p37_272039_c1
403 nmdc:mga05p37_85460_c1
404 nmdc:mga09592_157361_c1
405 nmdc:mga0qj67_74897_c1
406 nmdc:mga0qj67_855348_c1
407 nmdc:mga06r32_269522_c1
408 nmdc:mga06r32_32556_c1
409 nmdc:mga06r32_44684_c1
410 nmdc:mga06r32_635389_c1
411 nmdc:mga06r32_781966_c1
412 nmdc:mga08y16_789143_c1
413 nmdc:mga08y16_93901_c1
414 nmdc:mga0n895_593193_c1
415 nmdc:mga0n895_779683_c1
416 nmdc:mga0rr50_139202_c1
417 nmdc:mga0rr50_715961_c1
418 nmdc:mga08x19_31640_c1
419 nmdc:mga0a205_50477_c1
420 Ga0495601_0144078
421 Ga0495601_0477188
422 Ga0495619_0121491
423 Ga0495619_0193402
424 Ga0500616_0038106
425 Ga0501084_0000026
426 Ga0501084_0577837
427 Ga0501082_0261252
428 Ga0530510_0005312
429 2528206643
430 2528212025
431 2546946952
432 2579747539
433 2579854547
434 2619853814
435 2620349504
436 2626634840
437 2671835800
438 2686539653
439 2686543534
440 2710602613
441 2774853956
442 2774867074
443 2895884880
444 637877865
445 8054920568
446 8054922609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

44

267

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8746 4 233
4u2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution 0.87 10 229
4u2f-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-1 variant (q35h, f38l, y64h, q110l, c123s, y137c, y145c, n154d, e199g, s208g and g211d) at 1.80 a resolution 0.8669 10 235
1zi8-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a 0.8664 10 235
4u2c-assembly1.cif.gz_A crystal structure of dienelactone hydrolase a-6 variant (s7t, a24v, q35h, f38l, q110l, c123s, y145c, e199g and s208g) at 1.95 a resolution 0.8661 10 235
ID Description Score Start End Superfamily
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8828 8 230 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8653 10 235 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8594 4 233 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.844 3 234 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8425 6 234 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3C1DQW6-F1-model_v4 Carboxymethylenebutenolidase 0.9702 6 234 GO:0016787
AF-A0A7C4TK37-F1-model_v4 Dienelactone hydrolase family protein 0.9593 21 235 GO:0016787
AF-A0A538IDH6-F1-model_v4 Dienelactone hydrolase family protein 0.9591 6 235 GO:0016787
AF-A0A132MNQ6-F1-model_v4 Carboxymethylenebutenolidase 0.954 6 235 GO:0016787
AF-A0A4R6HER0-F1-model_v4 deleted 0.954 21 235

Map