F335890

General Info

Members Datasets Scaffolds Average Seq Length
223 126 222 315

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0018735|Ga0451576_0018735_3689_4786
Length 365
Sequence VGNLLNLMDGFQPANSSKKLTYLPRAAQQFATSGNIFHFYQKEGPMLRSFLIYLSKADWAQKLVTGWGFAWKAASRFIAGSTIQEAIQVVRNLNAKGINATLDQLGEHTTTAEEANRAADGIVAVLDEIQKAGVRSNVSIKLTQIGMGMDDDVCRTNLIRILECARQYGNFVRIDIEDTPYTDKTIAFFYEMMEKGFTVNTFGMAVQSYLYRAEADVRKMVEIGTTFRLVKGAYKEPPELAYPKKADVDANYDTLTSILIDASLTHETVLSQDGRIPPIPAIASHDEKRIAFAKSYADKVGLPKNGVEFQMLYGIRRDLQEELCKEGYPMRVYVPFGTHWYPYFMRRLAERPANIWFFVSNFFKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
87 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
88 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
89 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
90 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
91 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
97 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
98 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
99 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
100 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.45
Rhizosphere 99.1
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3554542 2162886007 Bacteria 3907
2 Ga0065704_10000291 3300005289 Bacteria 52676
3 Ga0065712_10105230 3300005290 Bacteria 1944
4 Ga0065707_10000435 3300005295 Bacteria 91033
5 Ga0065707_10086270 3300005295 Bacteria 5560
6 Ga0065707_10087636 3300005295 Unclassified 4905
7 Ga0065707_10088736 3300005295 Unclassified 4567
8 Ga0065707_10089666 3300005295 Bacteria 4309
9 Ga0070680_100059663 3300005336 Unclassified 3122
10 Ga0070689_100464215 3300005340 Unclassified 1079
11 Ga0070661_100012678 3300005344 Bacteria 5897
12 Ga0070661_100017048 3300005344 Bacteria 5147
13 Ga0070671_100313452 3300005355 Bacteria 1336
14 Ga0070659_100050618 3300005366 Bacteria 3265
15 Ga0070703_10022785 3300005406 Unclassified 1840
16 Ga0070705_100107460 3300005440 Unclassified 1775
17 Ga0070694_100029414 3300005444 Unclassified 3585
18 Ga0070694_100047277 3300005444 Bacteria 2891
19 Ga0070694_100400856 3300005444 Unclassified 1074
20 Ga0070663_100251087 3300005455 Bacteria 1400
21 Ga0070681_10068418 3300005458 Unclassified 3518
22 Ga0070706_100051423 3300005467 Unclassified 3803
23 Ga0070707_100303743 3300005468 Bacteria 1551
24 Ga0070698_100032347 3300005471 Bacteria 5419
25 Ga0070698_100033793 3300005471 Bacteria 5297
26 Ga0070699_100102141 3300005518 Unclassified 2514
27 Ga0070699_100229552 3300005518 Bacteria 1655
28 Ga0070679_100235974 3300005530 Bacteria 1788
29 Ga0070697_100182972 3300005536 Bacteria 1777
30 Ga0068853_100051504 3300005539 Bacteria 3543
31 Ga0070695_100036452 3300005545 Unclassified 3095
32 Ga0070696_100328320 3300005546 Bacteria 1179
33 Ga0070693_100005728 3300005547 Bacteria 6000
34 Ga0068855_100013575 3300005563 Bacteria 9822
35 Ga0068855_100020319 3300005563 Bacteria 7967
36 Ga0070664_100104965 3300005564 Bacteria 2461
37 Ga0068857_100045075 3300005577 Unclassified 3912
38 Ga0068857_100479673 3300005577 Bacteria 1165
39 Ga0068854_100035457 3300005578 Bacteria 3492
40 Ga0068856_100015444 3300005614 Bacteria 7378
41 Ga0068856_100018943 3300005614 Bacteria 6678
42 Ga0068856_100110907 3300005614 Unclassified 2740
43 Ga0068856_100269066 3300005614 Bacteria 1720
44 Ga0068852_100001031 3300005616 Bacteria 18329
45 Ga0068859_100018831 3300005617 Bacteria 6936
46 Ga0068859_100189691 3300005617 Bacteria 2140
47 Ga0068859_100401185 3300005617 Bacteria 1467
48 Ga0068864_100343930 3300005618 Unclassified 1406
49 Ga0068861_100251902 3300005719 Bacteria 1507
50 Ga0068851_10006166 3300005834 Bacteria 5470
51 Ga0068862_100068376 3300005844 Unclassified 3064
52 Ga0068862_100086531 3300005844 Bacteria 2725
53 Ga0081539_10015198 3300005985 Bacteria 5617
54 Ga0075428_100112475 3300006844 Bacteria 2966
55 Ga0075431_100061553 3300006847 Bacteria 3873
56 Ga0075433_10092877 3300006852 Bacteria 2669
57 Ga0075433_10121648 3300006852 Bacteria 2318
58 Ga0075429_100004305 3300006880 Bacteria 12229
59 Ga0075429_100028998 3300006880 Bacteria 4805
60 Ga0097620_100018830 3300006931 Bacteria 6936
61 Ga0097620_100189696 3300006931 Bacteria 2140
62 Ga0097620_100401178 3300006931 Bacteria 1467
63 Ga0105240_10019480 3300009093 Bacteria 9064
64 Ga0105240_10037854 3300009093 Bacteria 6195
65 Ga0111539_10057051 3300009094 Unclassified 4639
66 Ga0114129_10006552 3300009147 Bacteria 16522
67 Ga0114129_10010801 3300009147 Bacteria 13007
68 Ga0114129_10018849 3300009147 Bacteria 9829
69 Ga0114129_10039340 3300009147 Bacteria 6666
70 Ga0114129_10052392 3300009147 Bacteria 5727
71 Ga0114129_10060358 3300009147 Bacteria 5302
72 Ga0114129_10189477 3300009147 Unclassified 2794
73 Ga0105243_10004951 3300009148 Bacteria 10437
74 Ga0105241_10000565 3300009174 Bacteria 27946
75 Ga0105241_10006100 3300009174 Bacteria 8884
76 Ga0105241_10012413 3300009174 Bacteria 6244
77 Ga0105237_10049734 3300009545 Bacteria 4212
78 Ga0105238_10003154 3300009551 Bacteria 16457
79 Ga0105238_10003810 3300009551 Bacteria 14979
80 Ga0105238_10020041 3300009551 Bacteria 6808
81 Ga0105239_10011358 3300010375 Bacteria 9936
82 Ga0105239_10051324 3300010375 Unclassified 4522
83 Ga0105246_10058476 3300011119 Bacteria 2671
84 Ga0157369_10006261 3300013105 Bacteria 13811
85 Ga0157369_10007463 3300013105 Bacteria 12592
86 Ga0157369_10055118 3300013105 Bacteria 4292
87 Ga0157372_10005629 3300013307 Bacteria 13320
88 Ga0157372_10013065 3300013307 Bacteria 8859
89 Ga0157372_10153626 3300013307 Bacteria 2658
90 Ga0207654_10000508 3300025911 Bacteria 22239
91 Ga0207654_10002823 3300025911 Bacteria 8813
92 Ga0207695_10000814 3300025913 Bacteria 58050
93 Ga0207695_10206457 3300025913 Unclassified 1877
94 Ga0207671_10009652 3300025914 Bacteria 8044
95 Ga0207649_10084083 3300025920 Bacteria 2068
96 Ga0207694_10000209 3300025924 Bacteria 57282
97 Ga0207694_10008257 3300025924 Bacteria 7870
98 Ga0207709_10019452 3300025935 Unclassified 3819
99 Ga0207679_10243184 3300025945 Bacteria 1526
100 Ga0207667_10037775 3300025949 Bacteria 5161
101 Ga0207667_10057604 3300025949 Unclassified 4078
102 Ga0207667_10384163 3300025949 Bacteria 1430
103 Ga0207712_10154414 3300025961 Bacteria 1776
104 Ga0207640_10056223 3300025981 Bacteria 2581
105 Ga0207639_10000123 3300026041 Bacteria 57693
106 Ga0207708_10223115 3300026075 Unclassified 1511
107 Ga0207702_10002242 3300026078 Bacteria 18547
108 Ga0207702_10088343 3300026078 Bacteria 2707
109 Ga0207676_10164355 3300026095 Unclassified 1927
110 Ga0207674_10070731 3300026116 Unclassified 3508
111 Ga0207675_100122446 3300026118 Bacteria 2462
112 Ga0207698_10000094 3300026142 Bacteria 57787
113 Ga0207698_10293821 3300026142 Bacteria 1509
114 Ga0268265_10087097 3300028380 Bacteria 2484
115 Ga0265326_10008863 3300028558 Bacteria 3016
116 Ga0265334_10045857 3300028573 Bacteria 1692
117 Ga0265318_10002245 3300028577 Bacteria 10417
118 Ga0265323_10020537 3300028653 Bacteria 2542
119 Ga0265338_10131259 3300028800 Bacteria 1977
120 Ga0265320_10036511 3300031240 Bacteria 2482
121 Ga0265340_10005504 3300031247 Bacteria 7023
122 Ga0265316_10119897 3300031344 Bacteria 1987
123 Ga0316575_10024290 3300031665 Bacteria 2346
124 Ga0316579_10098462 3300031691 Unclassified 1399
125 Ga0307405_10074546 3300031731 Bacteria 2195
126 Ga0316577_10021088 3300031733 Bacteria 3613
127 Ga0316577_10027722 3300031733 Bacteria 3159
128 Ga0307413_10367842 3300031824 Bacteria 1116
129 Ga0307412_10219423 3300031911 Bacteria 1457
130 Ga0307415_100135004 3300032126 Bacteria 1875
131 Ga0316585_10027210 3300032137 Bacteria 1783
132 Ga0373948_0001248 3300034817 Bacteria 3475
133 Ga0373958_0000750 3300034819 Bacteria 4138
134 Ga0373938_0006308 3300034957 Bacteria 2045
135 Ga0373928_0005171 3300035084 Bacteria 2489
136 Ga0373949_0004679 3300035090 Bacteria 3109
137 Ga0373951_0000530 3300035091 Bacteria 10766
138 Ga0373952_0005390 3300035092 Bacteria 2339
139 Ga0373932_0000276 3300035112 Bacteria 15418
140 Ga0373941_0026185 3300035115 Bacteria 1691
141 Ga0373960_0000104 3300035121 Bacteria 13315
142 Ga0373942_0010532 3300035207 Bacteria 2177
143 Ga0373961_0005464 3300035241 Bacteria 3053
144 Ga0373962_0034733 3300035242 Unclassified 1397
145 Ga0316574_0002066 3300035398 Bacteria 9924
146 Ga0373931_0105626 3300035691 Bacteria 1590
147 Ga0316582_0008849 3300036647 Bacteria 5429
148 Ga0316582_0028296 3300036647 Bacteria 3394
149 Ga0316582_0068220 3300036647 Bacteria 2296
150 Ga0316584_0008534 3300036712 Bacteria 7062
151 Ga0316584_0044295 3300036712 Bacteria 3318
152 Ga0451577_0000511 3300042876 Bacteria 65077
153 Ga0451577_0006559 3300042876 Bacteria 11573
154 Ga0451577_0020494 3300042876 Bacteria 6067
155 Ga0451577_0078675 3300042876 Bacteria 2940
156 Ga0451577_0096133 3300042876 Unclassified 2645
157 Ga0451577_0303884 3300042876 Bacteria 1445
158 Ga0451577_0449380 3300042876 Bacteria 1170
159 Ga0451577_0479831 3300042876 Unclassified 1129
160 Ga0453683_0004398 3300044673 Bacteria 10012
161 Ga0453683_0005944 3300044673 Bacteria 8417
162 Ga0453683_0121643 3300044673 Bacteria 1643
163 Ga0453684_0000044 3300044712 Bacteria 585643
164 Ga0453684_0000267 3300044712 Bacteria 225314
165 Ga0453684_0001499 3300044712 Bacteria 65796
166 Ga0453684_0002372 3300044712 Bacteria 45994
167 Ga0453684_0003073 3300044712 Bacteria 38628
168 Ga0453684_0009449 3300044712 Bacteria 17055
169 Ga0453684_0037255 3300044712 Bacteria 6678
170 Ga0453684_0051618 3300044712 Bacteria 5388
171 Ga0453684_0071869 3300044712 Unclassified 4371
172 Ga0453684_0074217 3300044712 Bacteria 4284
173 Ga0453684_0079714 3300044712 Bacteria 4092
174 Ga0453684_0104528 3300044712 Bacteria 3456
175 Ga0453684_0114723 3300044712 Bacteria 3265
176 Ga0453684_0138645 3300044712 Bacteria 2908
177 Ga0453684_0141668 3300044712 Bacteria 2870
178 Ga0453684_0220943 3300044712 Bacteria 2195
179 Ga0453684_0262447 3300044712 Bacteria 1978
180 Ga0453684_0287012 3300044712 Unclassified 1875
181 Ga0453684_0310061 3300044712 Bacteria 1791
182 Ga0453684_0313745 3300044712 Unclassified 1778
183 Ga0453684_0406977 3300044712 Bacteria 1522
184 Ga0453684_0469372 3300044712 Unclassified 1398
185 Ga0453684_0503569 3300044712 Bacteria 1340
186 Ga0451576_0000058 3300045051 Bacteria 298769
187 Ga0451576_0002998 3300045051 Bacteria 23903
188 Ga0451576_0018735 3300045051 Bacteria 7571
189 Ga0451576_0027069 3300045051 Bacteria 6162
190 Ga0451576_0035526 3300045051 Bacteria 5286
191 Ga0451576_0168661 3300045051 Bacteria 2285
192 Ga0495602_0085939 3300048088 Bacteria 2627
193 Ga0496106_0242642 3300048909 Bacteria 1440
194 Ga0501298_010006 3300049521 Bacteria 1623
195 Ga0501041_0234324 3300049577 Bacteria 1153
196 Ga0501071_0170510 3300049587 Bacteria 1629
197 Ga0501071_0251847 3300049587 Bacteria 1333
198 Ga0501072_0412834 3300049588 Bacteria 1070
199 Ga0501075_0002862 3300049591 Bacteria 11567
200 Ga0501076_0091551 3300049592 Unclassified 2446
201 Ga0501076_0158227 3300049592 Bacteria 1845
202 Ga0501079_0064711 3300049741 Bacteria 2821
203 Ga0501079_0328304 3300049741 Bacteria 1198
204 Ga0501080_0117979 3300049742 Unclassified 2460
205 nmdc:mga05p37_1294_c1 3300050507 Bacteria 29076
206 nmdc:mga05p37_19010_c1 3300050507 Bacteria 8309
207 nmdc:mga05p37_274951_c1 3300050507 Bacteria 2011
208 nmdc:mga05p37_40229_c1 3300050507 Bacteria 3186
209 nmdc:mga05p37_70644_c1 3300050507 Bacteria 4294
210 nmdc:mga05p37_772237_c1 3300050507 Bacteria 1056
211 nmdc:mga09592_132449_c1 3300050508 Bacteria 2146
212 nmdc:mga09592_210139_c1 3300050508 Bacteria 1686
213 nmdc:mga09592_4903_c1 3300050508 Bacteria 10848
214 nmdc:mga09592_79175_c1 3300050508 Bacteria 2797
215 nmdc:mga0qj67_104298_c1 3300050509 Bacteria 2287
216 nmdc:mga08y16_100129_c1 3300050511 Unclassified 3017
217 nmdc:mga0n895_584357_c1 3300050512 Unclassified 1120
218 nmdc:mga0a205_214925_c1 3300050515 Bacteria 1810
219 Ga0501084_0108380 3300054114 Bacteria 2333
220 Ga0501084_0438383 3300054114 Bacteria 1104
221 Ga0501084_0526881 3300054114 Bacteria 999
222 Ga0501082_0202550 3300060353 Unclassified 1727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035242 Ga0373962_0034733 Ga0373962_0034733_19_819 266
2 3300044712 Ga0453684_0220943 Ga0453684_0220943_17_880 286
3 3300050512 nmdc:mga0n895_584357_c1 nmdc:mga0n895_584357_c1_36_905 289
4 3300050515 nmdc:mga0a205_214925_c1 nmdc:mga0a205_214925_c1_22_891 289
5 3300054114 Ga0501084_0526881 Ga0501084_0526881_10_879 289
6 3300005366 Ga0070659_100050618 Ga0070659_1000506183 299
7 3300005455 Ga0070663_100251087 Ga0070663_1002510872 299
8 3300005530 Ga0070679_100235974 Ga0070679_1002359741 299
9 3300005547 Ga0070693_100005728 Ga0070693_1000057284 299
10 iso_pu_bacteria 8055632911 8055636631 302
11 3300005518 Ga0070699_100229552 Ga0070699_1002295522 303
12 3300048088 Ga0495602_0085939 Ga0495602_0085939_1535_2446 303
13 3300005336 Ga0070680_100059663 Ga0070680_1000596632 306
14 3300005344 Ga0070661_100012678 Ga0070661_1000126783 306
15 3300005344 Ga0070661_100017048 Ga0070661_1000170482 306
16 3300005458 Ga0070681_10068418 Ga0070681_100684182 306
17 3300005539 Ga0068853_100051504 Ga0068853_1000515043 306
18 3300005563 Ga0068855_100013575 Ga0068855_1000135759 306
19 3300005563 Ga0068855_100020319 Ga0068855_1000203196 306
20 3300005564 Ga0070664_100104965 Ga0070664_1001049652 306
21 3300005577 Ga0068857_100045075 Ga0068857_1000450752 306
22 3300005578 Ga0068854_100035457 Ga0068854_1000354575 306
23 3300005614 Ga0068856_100015444 Ga0068856_1000154449 306
24 3300005614 Ga0068856_100018943 Ga0068856_1000189434 306
25 3300005614 Ga0068856_100110907 Ga0068856_1001109072 306
26 3300005614 Ga0068856_100269066 Ga0068856_1002690662 306
27 3300005616 Ga0068852_100001031 Ga0068852_1000010316 306
28 3300005834 Ga0068851_10006166 Ga0068851_100061664 306
29 3300006852 Ga0075433_10121648 Ga0075433_101216482 306
30 3300009093 Ga0105240_10019480 Ga0105240_100194808 306
31 3300009093 Ga0105240_10037854 Ga0105240_100378545 306
32 3300009174 Ga0105241_10000565 Ga0105241_100005654 306
33 3300009174 Ga0105241_10006100 Ga0105241_1000610010 306
34 3300009174 Ga0105241_10012413 Ga0105241_100124134 306
35 3300009545 Ga0105237_10049734 Ga0105237_100497343 306
36 3300009551 Ga0105238_10003154 Ga0105238_100031548 306
37 3300009551 Ga0105238_10003810 Ga0105238_100038109 306
38 3300009551 Ga0105238_10020041 Ga0105238_100200412 306
39 3300010375 Ga0105239_10011358 Ga0105239_100113584 306
40 3300010375 Ga0105239_10051324 Ga0105239_100513242 306
41 3300011119 Ga0105246_10058476 Ga0105246_100584763 306
42 3300013105 Ga0157369_10006261 Ga0157369_100062619 306
43 3300013105 Ga0157369_10007463 Ga0157369_100074632 306
44 3300013105 Ga0157369_10055118 Ga0157369_100551182 306
45 3300013307 Ga0157372_10005629 Ga0157372_1000562912 306
46 3300013307 Ga0157372_10013065 Ga0157372_100130656 306
47 3300013307 Ga0157372_10153626 Ga0157372_101536264 306
48 3300025911 Ga0207654_10000508 Ga0207654_1000050816 306
49 3300025911 Ga0207654_10002823 Ga0207654_1000282311 306
50 3300025913 Ga0207695_10000814 Ga0207695_1000081453 306
51 3300025913 Ga0207695_10206457 Ga0207695_102064572 306
52 3300025914 Ga0207671_10009652 Ga0207671_100096526 306
53 3300025920 Ga0207649_10084083 Ga0207649_100840833 306
54 3300025924 Ga0207694_10000209 Ga0207694_1000020953 306
55 3300025924 Ga0207694_10008257 Ga0207694_100082576 306
56 3300025945 Ga0207679_10243184 Ga0207679_102431841 306
57 3300025949 Ga0207667_10037775 Ga0207667_100377754 306
58 3300025949 Ga0207667_10057604 Ga0207667_100576043 306
59 3300025949 Ga0207667_10384163 Ga0207667_103841631 306
60 3300025981 Ga0207640_10056223 Ga0207640_100562232 306
61 3300026041 Ga0207639_10000123 Ga0207639_100001235 306
62 3300026075 Ga0207708_10223115 Ga0207708_102231152 306
63 3300026078 Ga0207702_10002242 Ga0207702_1000224211 306
64 3300026078 Ga0207702_10088343 Ga0207702_100883432 306
65 3300026116 Ga0207674_10070731 Ga0207674_100707312 306
66 3300026142 Ga0207698_10000094 Ga0207698_100000944 306
67 3300026142 Ga0207698_10293821 Ga0207698_102938211 306
68 3300005290 Ga0065712_10105230 Ga0065712_101052302 307
69 3300005295 Ga0065707_10089666 Ga0065707_100896661 307
70 3300005355 Ga0070671_100313452 Ga0070671_1003134522 307
71 3300005444 Ga0070694_100400856 Ga0070694_1004008561 307
72 3300005617 Ga0068859_100401185 Ga0068859_1004011852 307
73 3300006931 Ga0097620_100401178 Ga0097620_1004011782 307
74 3300009147 Ga0114129_10018849 Ga0114129_100188494 307
75 3300009147 Ga0114129_10060358 Ga0114129_100603582 307
76 3300034817 Ga0373948_0001248 Ga0373948_0001248_167_1096 307
77 3300034819 Ga0373958_0000750 Ga0373958_0000750_3157_4086 307
78 3300034957 Ga0373938_0006308 Ga0373938_0006308_88_1017 307
79 3300035084 Ga0373928_0005171 Ga0373928_0005171_157_1086 307
80 3300035090 Ga0373949_0004679 Ga0373949_0004679_184_1113 307
81 3300035091 Ga0373951_0000530 Ga0373951_0000530_3838_4767 307
82 3300035092 Ga0373952_0005390 Ga0373952_0005390_381_1310 307
83 3300035112 Ga0373932_0000276 Ga0373932_0000276_14334_15263 307
84 3300035115 Ga0373941_0026185 Ga0373941_0026185_702_1631 307
85 3300035121 Ga0373960_0000104 Ga0373960_0000104_124_1053 307
86 3300035207 Ga0373942_0010532 Ga0373942_0010532_1189_2118 307
87 3300035241 Ga0373961_0005464 Ga0373961_0005464_1622_2551 307
88 3300035691 Ga0373931_0105626 Ga0373931_0105626_503_1432 307
89 3300045051 Ga0451576_0027069 Ga0451576_0027069_4649_5578 307
90 3300005985 Ga0081539_10015198 Ga0081539_100151982 308
91 3300031731 Ga0307405_10074546 Ga0307405_100745462 310
92 3300031911 Ga0307412_10219423 Ga0307412_102194232 310
93 3300036647 Ga0316582_0068220 Ga0316582_0068220_384_1337 312
94 3300036647 Ga0316582_0028296 Ga0316582_0028296_2073_3050 313
95 3300005546 Ga0070696_100328320 Ga0070696_1003283201 318
96 3300028558 Ga0265326_10008863 Ga0265326_100088632 318
97 3300028573 Ga0265334_10045857 Ga0265334_100458572 318
98 3300028577 Ga0265318_10002245 Ga0265318_100022454 318
99 3300028800 Ga0265338_10131259 Ga0265338_101312592 318
100 3300031240 Ga0265320_10036511 Ga0265320_100365111 318
101 3300031247 Ga0265340_10005504 Ga0265340_100055044 318
102 3300031344 Ga0265316_10119897 Ga0265316_101198972 318
103 3300042876 Ga0451577_0000511 Ga0451577_0000511_22817_23776 318
104 3300042876 Ga0451577_0006559 Ga0451577_0006559_7894_8853 318
105 3300042876 Ga0451577_0078675 Ga0451577_0078675_337_1302 318
106 3300044673 Ga0453683_0004398 Ga0453683_0004398_93_1052 318
107 3300044673 Ga0453683_0005944 Ga0453683_0005944_7366_8325 318
108 3300044673 Ga0453683_0121643 Ga0453683_0121643_573_1532 318
109 3300044712 Ga0453684_0000044 Ga0453684_0000044_542312_543271 318
110 3300044712 Ga0453684_0000267 Ga0453684_0000267_142440_143399 318
111 3300044712 Ga0453684_0001499 Ga0453684_0001499_54712_55671 318
112 3300044712 Ga0453684_0009449 Ga0453684_0009449_5022_5981 318
113 3300044712 Ga0453684_0051618 Ga0453684_0051618_463_1422 318
114 3300044712 Ga0453684_0071869 Ga0453684_0071869_1981_2940 318
115 3300044712 Ga0453684_0079714 Ga0453684_0079714_1756_2715 318
116 3300044712 Ga0453684_0141668 Ga0453684_0141668_594_1559 318
117 3300044712 Ga0453684_0503569 Ga0453684_0503569_185_1150 318
118 3300045051 Ga0451576_0002998 Ga0451576_0002998_10229_11188 318
119 3300028653 Ga0265323_10020537 Ga0265323_100205372 319
120 3300031665 Ga0316575_10024290 Ga0316575_100242902 319
121 3300031691 Ga0316579_10098462 Ga0316579_100984622 319
122 3300031733 Ga0316577_10021088 Ga0316577_100210883 319
123 3300031733 Ga0316577_10027722 Ga0316577_100277222 319
124 3300032137 Ga0316585_10027210 Ga0316585_100272102 319
125 3300035398 Ga0316574_0002066 Ga0316574_0002066_561_1520 319
126 3300036647 Ga0316582_0008849 Ga0316582_0008849_1841_2800 319
127 3300036712 Ga0316584_0044295 Ga0316584_0044295_1220_2179 319
128 3300042876 Ga0451577_0096133 Ga0451577_0096133_207_1166 319
129 3300042876 Ga0451577_0449380 Ga0451577_0449380_189_1160 319
130 3300044712 Ga0453684_0074217 Ga0453684_0074217_3006_3965 319
131 3300044712 Ga0453684_0138645 Ga0453684_0138645_1616_2575 319
132 3300044712 Ga0453684_0287012 Ga0453684_0287012_846_1817 319
133 3300044712 Ga0453684_0310061 Ga0453684_0310061_289_1260 319
134 3300045051 Ga0451576_0035526 Ga0451576_0035526_2181_3152 319
135 3300045051 Ga0451576_0168661 Ga0451576_0168661_1233_2216 319
136 3300036712 Ga0316584_0008534 Ga0316584_0008534_2692_3654 320
137 3300042876 Ga0451577_0479831 Ga0451577_0479831_131_1093 320
138 3300044712 Ga0453684_0002372 Ga0453684_0002372_33525_34487 320
139 3300044712 Ga0453684_0003073 Ga0453684_0003073_28653_29615 320
140 3300044712 Ga0453684_0104528 Ga0453684_0104528_2279_3241 320
141 3300044712 Ga0453684_0262447 Ga0453684_0262447_765_1841 320
142 3300044712 Ga0453684_0313745 Ga0453684_0313745_272_1234 320
143 3300044712 Ga0453684_0469372 Ga0453684_0469372_197_1180 320
144 3300045051 Ga0451576_0000058 Ga0451576_0000058_246070_247032 320
145 3300045051 Ga0451576_0018735 Ga0451576_0018735_3689_4786 320
146 2162886007 SwRhRL2b_contig_3554542 SwRhRL2b_0196.00004110 321
147 3300005289 Ga0065704_10000291 Ga0065704_1000029123 321
148 3300005295 Ga0065707_10000435 Ga0065707_1000043552 321
149 3300005295 Ga0065707_10086270 Ga0065707_100862702 321
150 3300005295 Ga0065707_10087636 Ga0065707_100876362 321
151 3300005295 Ga0065707_10088736 Ga0065707_100887362 321
152 3300005340 Ga0070689_100464215 Ga0070689_1004642151 321
153 3300005406 Ga0070703_10022785 Ga0070703_100227851 321
154 3300005440 Ga0070705_100107460 Ga0070705_1001074602 321
155 3300005444 Ga0070694_100029414 Ga0070694_1000294142 321
156 3300005444 Ga0070694_100047277 Ga0070694_1000472772 321
157 3300005467 Ga0070706_100051423 Ga0070706_1000514234 321
158 3300005468 Ga0070707_100303743 Ga0070707_1003037432 321
159 3300005471 Ga0070698_100032347 Ga0070698_1000323473 321
160 3300005471 Ga0070698_100033793 Ga0070698_1000337932 321
161 3300005518 Ga0070699_100102141 Ga0070699_1001021413 321
162 3300005536 Ga0070697_100182972 Ga0070697_1001829722 321
163 3300005545 Ga0070695_100036452 Ga0070695_1000364522 321
164 3300005577 Ga0068857_100479673 Ga0068857_1004796731 321
165 3300005617 Ga0068859_100018831 Ga0068859_1000188317 321
166 3300005617 Ga0068859_100189691 Ga0068859_1001896913 321
167 3300005618 Ga0068864_100343930 Ga0068864_1003439302 321
168 3300005719 Ga0068861_100251902 Ga0068861_1002519022 321
169 3300005844 Ga0068862_100068376 Ga0068862_1000683764 321
170 3300005844 Ga0068862_100086531 Ga0068862_1000865313 321
171 3300006844 Ga0075428_100112475 Ga0075428_1001124754 321
172 3300006847 Ga0075431_100061553 Ga0075431_1000615532 321
173 3300006852 Ga0075433_10092877 Ga0075433_100928772 321
174 3300006880 Ga0075429_100004305 Ga0075429_1000043055 321
175 3300006880 Ga0075429_100028998 Ga0075429_1000289984 321
176 3300006931 Ga0097620_100018830 Ga0097620_1000188307 321
177 3300006931 Ga0097620_100189696 Ga0097620_1001896961 321
178 3300009094 Ga0111539_10057051 Ga0111539_100570513 321
179 3300009147 Ga0114129_10006552 Ga0114129_100065523 321
180 3300009147 Ga0114129_10010801 Ga0114129_100108017 321
181 3300009147 Ga0114129_10039340 Ga0114129_100393404 321
182 3300009147 Ga0114129_10052392 Ga0114129_100523925 321
183 3300009147 Ga0114129_10189477 Ga0114129_101894772 321
184 3300009148 Ga0105243_10004951 Ga0105243_100049513 321
185 3300025935 Ga0207709_10019452 Ga0207709_100194522 321
186 3300025961 Ga0207712_10154414 Ga0207712_101544142 321
187 3300026095 Ga0207676_10164355 Ga0207676_101643552 321
188 3300026118 Ga0207675_100122446 Ga0207675_1001224463 321
189 3300028380 Ga0268265_10087097 Ga0268265_100870972 321
190 3300031824 Ga0307413_10367842 Ga0307413_103678421 321
191 3300032126 Ga0307415_100135004 Ga0307415_1001350042 321
192 3300042876 Ga0451577_0020494 Ga0451577_0020494_833_1798 321
193 3300042876 Ga0451577_0303884 Ga0451577_0303884_243_1208 321
194 3300044712 Ga0453684_0037255 Ga0453684_0037255_5302_6267 321
195 3300044712 Ga0453684_0114723 Ga0453684_0114723_639_1604 321
196 3300044712 Ga0453684_0406977 Ga0453684_0406977_305_1270 321
197 3300048909 Ga0496106_0242642 Ga0496106_0242642_399_1364 321
198 3300049521 Ga0501298_010006 Ga0501298_010006_635_1600 321
199 3300049577 Ga0501041_0234324 Ga0501041_0234324_151_1116 321
200 3300049587 Ga0501071_0170510 Ga0501071_0170510_200_1165 321
201 3300049587 Ga0501071_0251847 Ga0501071_0251847_202_1167 321
202 3300049588 Ga0501072_0412834 Ga0501072_0412834_71_1036 321
203 3300049591 Ga0501075_0002862 Ga0501075_0002862_4931_5896 321
204 3300049592 Ga0501076_0091551 Ga0501076_0091551_1158_2123 321
205 3300049592 Ga0501076_0158227 Ga0501076_0158227_697_1662 321
206 3300049741 Ga0501079_0064711 Ga0501079_0064711_1482_2447 321
207 3300049741 Ga0501079_0328304 Ga0501079_0328304_158_1123 321
208 3300049742 Ga0501080_0117979 Ga0501080_0117979_1351_2316 321
209 3300050507 nmdc:mga05p37_1294_c1 nmdc:mga05p37_1294_c1_7638_8603 321
210 3300050507 nmdc:mga05p37_19010_c1 nmdc:mga05p37_19010_c1_13_978 321
211 3300050507 nmdc:mga05p37_274951_c1 nmdc:mga05p37_274951_c1_591_1556 321
212 3300050507 nmdc:mga05p37_40229_c1 nmdc:mga05p37_40229_c1_763_1728 321
213 3300050507 nmdc:mga05p37_70644_c1 nmdc:mga05p37_70644_c1_628_1593 321
214 3300050507 nmdc:mga05p37_772237_c1 nmdc:mga05p37_772237_c1_60_1040 321
215 3300050508 nmdc:mga09592_132449_c1 nmdc:mga09592_132449_c1_658_1635 321
216 3300050508 nmdc:mga09592_210139_c1 nmdc:mga09592_210139_c1_497_1462 321
217 3300050508 nmdc:mga09592_4903_c1 nmdc:mga09592_4903_c1_1541_2506 321
218 3300050508 nmdc:mga09592_79175_c1 nmdc:mga09592_79175_c1_101_1066 321
219 3300050509 nmdc:mga0qj67_104298_c1 nmdc:mga0qj67_104298_c1_574_1551 321
220 3300050511 nmdc:mga08y16_100129_c1 nmdc:mga08y16_100129_c1_630_1595 321
221 3300054114 Ga0501084_0108380 Ga0501084_0108380_1138_2103 321
222 3300054114 Ga0501084_0438383 Ga0501084_0438383_14_979 321
223 3300060353 Ga0501082_0202550 Ga0501082_0202550_15_980 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01619

Pro_dh

Proline dehydrogenase

86

359

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m42-assembly1.cif.gz_A structure of thermus thermophilus l-proline dehydrogenase lacking alpha helices a, b and c 0.9678 36 293
5m42-assembly1.cif.gz_A structure of thermus thermophilus l-proline dehydrogenase lacking alpha helices a, b and c 0.96 36 293
2ekg-assembly1.cif.gz_B structure of thermus thermophilus proline dehydrogenase inactivated by n-propargylglycine 0.9469 2 307
2g37-assembly1.cif.gz_A structure of thermus thermophilus l-proline dehydrogenase 0.9426 2 308
4h6r-assembly1.cif.gz_A structure of reduced deinococcus radiodurans proline dehydrogenase 0.9324 26 308
ID Description Score Start End Superfamily
2ekgB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9697 34 293 3.20.20.220
2ekgB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9658 34 293 3.20.20.220
4h6rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9324 26 308 3.20.20.220
4h6rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9224 26 308 3.20.20.220
af_Q2FXG3_20_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9112 26 321 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A223EPI9-F1-model_v4 Proline dehydrogenase domain-containing protein 0.9903 67 150 GO:0016491
AF-A0A5C7G6C6-F1-model_v4 deleted 0.9864 39 139
AF-A0A3M1MWA1-F1-model_v4 Proline dehydrogenase 0.9833 1 134 GO:0004657
GO:0006562
AF-A0A524PG74-F1-model_v4 proline dehydrogenase (EC 1.5.5.2) 0.982 29 321 GO:0000166
GO:0004657
GO:0010133
AF-A0A2N2NMM2-F1-model_v4 proline dehydrogenase (EC 1.5.5.2) 0.979 1 321 GO:0000166
GO:0004657
GO:0010133

Feature Viewer

pLDDT pTM Quality
90.52 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map