F335727

General Info

Members Datasets Scaffolds Average Seq Length
223 159 446 458

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10051762|Ga0265338_100517622
Length 482
Sequence MALPSSAHRLSPAPEETAQSGSDRAPGTPRARLFARVKGILTDRSENRLAQLVAGKVFLVRAFSALLALGTQVLLARWMGSRQYGLFIYVWTWVLMIGALSDVGLSSAARRFIPEYTELKSPELLRGFLSGSRKLAFAIATAIGALGAIVISLIQPHLDPSEVVPLYLACATIPVYGLVQTQAGIAQSYDWPNLALMPFYIWRQLGMVGLMGAAWYFGAPTSAVTAMLAAVATTWLVTLAQSQVLDRRLKVKVEDGLKRHDVKTWLATSLPIFVVESFYLLLTYVDILALEHLRSPDEVAVYYAGARLLAMVAFVYFAIAGATTHKFTKYHVAGDAEKLKSFFAETARWTFWPSLAACAVILAFGKPLLSLFGSNFESGYGVMFILAIXMLARAAVGPAERLLNMLGDRKQCAGVYALAFAVNLVLCFLLIPHIGIEGAAAATSAALVIESALLYRMAKKRLGHHLFLMQSGEKPEQLRSGG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
71 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
74 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
75 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
147 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
148 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
149 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
152 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
153 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.56
Nodule 0
Rhizoplane 1.79
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10051762 3300028800 Bacteria 3693
2 rootH2_10041494 3300003320 Bacteria 2060
3 Ga0070658_10002625 3300005327 Bacteria 14970
4 Ga0070658_10239185 3300005327 Bacteria 1538
5 Ga0070690_100008869 3300005330 Bacteria 5810
6 Ga0070680_100006876 3300005336 Bacteria 8674
7 Ga0070680_100089904 3300005336 Bacteria 2541
8 Ga0070680_100188906 3300005336 Bacteria 1736
9 Ga0068868_100011223 3300005338 Bacteria 6523
10 Ga0070660_100001786 3300005339 Bacteria 14769
11 Ga0070660_100120445 3300005339 Bacteria 2094
12 Ga0070689_100045047 3300005340 Bacteria 3396
13 Ga0070689_100245080 3300005340 Bacteria 1477
14 Ga0070675_100278272 3300005354 Bacteria 1470
15 Ga0070673_100115597 3300005364 Bacteria 2231
16 Ga0070667_100175476 3300005367 Bacteria 1894
17 Ga0070709_10077609 3300005434 Bacteria 2159
18 Ga0070714_100119314 3300005435 Bacteria 2344
19 Ga0070711_100045614 3300005439 Bacteria 2983
20 Ga0070678_100049396 3300005456 Bacteria 3036
21 Ga0070681_10002613 3300005458 Bacteria 16532
22 Ga0068867_100153901 3300005459 Bacteria 1808
23 Ga0070679_100031986 3300005530 Bacteria 5203
24 Ga0070672_100108533 3300005543 Bacteria 2260
25 Ga0070693_100019250 3300005547 Bacteria 3576
26 Ga0068855_100009889 3300005563 Bacteria 11503
27 Ga0068855_100012239 3300005563 Bacteria 10369
28 Ga0068855_100013776 3300005563 Bacteria 9747
29 Ga0068856_100051961 3300005614 Bacteria 4041
30 Ga0068852_100171014 3300005616 Bacteria 2037
31 Ga0068859_100201174 3300005617 Bacteria 2077
32 Ga0070717_10144292 3300006028 Bacteria 2055
33 Ga0075363_100059233 3300006048 Bacteria 2059
34 Ga0075362_10019640 3300006177 Bacteria 2813
35 Ga0075366_10002493 3300006195 Bacteria 9443
36 Ga0075366_10034441 3300006195 Bacteria 2983
37 Ga0075366_10035178 3300006195 Bacteria 2953
38 Ga0068871_100025541 3300006358 Bacteria 4598
39 Ga0097620_100201181 3300006931 Bacteria 2077
40 Ga0105240_10031165 3300009093 Bacteria 6919
41 Ga0105240_10352720 3300009093 Unclassified 1669
42 Ga0105245_10003726 3300009098 Bacteria 13583
43 Ga0114129_10366929 3300009147 Unclassified 1904
44 Ga0105242_10080602 3300009176 Bacteria 2721
45 Ga0105248_10027882 3300009177 Bacteria 6288
46 Ga0105248_10366439 3300009177 Bacteria 1622
47 Ga0105238_10019721 3300009551 Bacteria 6867
48 Ga0157370_10045931 3300013104 Bacteria 4189
49 Ga0157370_10171146 3300013104 Bacteria 2019
50 Ga0157369_10041952 3300013105 Bacteria 4993
51 Ga0163162_10060368 3300013306 Bacteria 3827
52 Ga0163163_10003932 3300014325 Bacteria 12675
53 Ga0209758_1000302 3300025297 Bacteria 96619
54 Ga0207705_10074468 3300025909 Bacteria 2465
55 Ga0207707_10073463 3300025912 Bacteria 2982
56 Ga0207707_10079387 3300025912 Bacteria 2865
57 Ga0207707_10269067 3300025912 Bacteria 1477
58 Ga0207693_10012412 3300025915 Bacteria 6883
59 Ga0207693_10038590 3300025915 Bacteria 3760
60 Ga0207663_10034070 3300025916 Bacteria 3041
61 Ga0207663_10103776 3300025916 Bacteria 1915
62 Ga0207660_10023149 3300025917 Bacteria 4192
63 Ga0207660_10035094 3300025917 Bacteria 3479
64 Ga0207662_10017423 3300025918 Bacteria 4063
65 Ga0207659_10174927 3300025926 Bacteria 1696
66 Ga0207687_10008547 3300025927 Bacteria 6696
67 Ga0207709_10057783 3300025935 Bacteria 2407
68 Ga0207670_10008354 3300025936 Bacteria 5838
69 Ga0207667_10005244 3300025949 Bacteria 15813
70 Ga0207667_10185048 3300025949 Bacteria 2138
71 Ga0207658_10211056 3300025986 Bacteria 1627
72 Ga0207677_10022241 3300026023 Bacteria 3893
73 Ga0207702_10045291 3300026078 Bacteria 3701
74 Ga0207702_10090638 3300026078 Bacteria 2675
75 Ga0207641_10202008 3300026088 Bacteria 1833
76 Ga0207648_10058853 3300026089 Bacteria 3351
77 Ga0207683_10215012 3300026121 Bacteria 1750
78 Ga0207698_10015351 3300026142 Bacteria 5126
79 Ga0207698_10025791 3300026142 Bacteria 4147
80 Ga0268266_10060891 3300028379 Bacteria 3255
81 Ga0265337_1004464 3300028556 Bacteria 5799
82 Ga0265338_10010279 3300028800 Bacteria 11011
83 Ga0265338_10056541 3300028800 Bacteria 3478
84 Ga0265325_10000172 3300031241 Bacteria 45954
85 Ga0265325_10001225 3300031241 Bacteria 18282
86 Ga0265325_10026117 3300031241 Bacteria 3166
87 Ga0265325_10037369 3300031241 Bacteria 2566
88 Ga0265339_10000330 3300031249 Bacteria 38106
89 Ga0265339_10029162 3300031249 Bacteria 3132
90 Ga0265339_10047941 3300031249 Bacteria 2344
91 Ga0265331_10006164 3300031250 Bacteria 7122
92 Ga0265316_10135333 3300031344 Bacteria 1854
93 Ga0265313_10000572 3300031595 Bacteria 38438
94 Ga0265313_10019583 3300031595 Bacteria 3761
95 Ga0265313_10025558 3300031595 Bacteria 3125
96 Ga0316575_10024678 3300031665 Bacteria 2329
97 Ga0265314_10001133 3300031711 Bacteria 30864
98 Ga0265314_10002100 3300031711 Bacteria 20973
99 Ga0265342_10000196 3300031712 Bacteria 67364
100 Ga0265342_10010238 3300031712 Bacteria 6526
101 Ga0316583_10007353 3300032133 Bacteria 3966
102 Ga0373934_0081025 3300035086 Bacteria 1304
103 Ga0373953_0003022 3300035117 Bacteria 5153
104 Ga0373956_0015654 3300035119 Bacteria 3178
105 Ga0373955_0005694 3300035172 Bacteria 5607
106 Ga0373924_0039804 3300035410 Bacteria 1922
107 Ga0373933_0004188 3300035724 Bacteria 7948
108 Ga0373937_0000456 3300036401 Bacteria 37790
109 Ga0373925_0193618 3300037068 Bacteria 1614
110 Ga0395899_0011739 3300037312 Bacteria 6706
111 Ga0395900_0009787 3300037418 Bacteria 9824
112 Ga0395898_0016915 3300037466 Bacteria 7445
113 Ga0395901_0007277 3300038443 Bacteria 11169
114 Ga0395901_0017017 3300038443 Bacteria 7410
115 Ga0395901_0071523 3300038443 Bacteria 3615
116 Ga0395901_0171846 3300038443 Bacteria 2274
117 Ga0436365_0957394 3300039437 Bacteria 2606
118 Ga0466963_0069848 3300044694 Bacteria 2362
119 Ga0466963_0147226 3300044694 Bacteria 1634
120 Ga0451576_0010236 3300045051 Bacteria 10782
121 Ga0451576_0018005 3300045051 Bacteria 7752
122 Ga0466958_0043618 3300045836 Bacteria 2701
123 Ga0466967_0006503 3300045976 Bacteria 8280
124 Ga0466967_0206643 3300045976 Bacteria 1861
125 Ga0495592_0022271 3300046454 Bacteria 4820
126 Ga0495629_0001793 3300046459 Bacteria 16822
127 Ga0495651_0001716 3300046462 Bacteria 16939
128 Ga0495653_0013557 3300046463 Bacteria 6644
129 Ga0495582_0083332 3300046473 Bacteria 1777
130 Ga0495664_0016343 3300046477 Bacteria 4225
131 Ga0495608_0000549 3300046511 Bacteria 25949
132 Ga0495608_0026179 3300046511 Bacteria 3979
133 Ga0495618_0010180 3300046514 Bacteria 5688
134 Ga0495628_0007532 3300046516 Bacteria 9414
135 Ga0495630_0116505 3300046517 Bacteria 2025
136 Ga0495652_0012424 3300046529 Bacteria 7679
137 Ga0495640_0001563 3300046533 Bacteria 18022
138 Ga0495587_0014693 3300046536 Bacteria 4904
139 Ga0495645_0000399 3300046543 Bacteria 30028
140 Ga0495645_0009518 3300046543 Bacteria 6793
141 Ga0495667_0002610 3300046559 Bacteria 12032
142 Ga0495635_0001327 3300046663 Bacteria 16454
143 Ga0495635_0006787 3300046663 Bacteria 8001
144 Ga0495657_0047731 3300046675 Bacteria 2893
145 Ga0495599_0008006 3300046678 Bacteria 6414
146 Ga0495623_0003221 3300046679 Bacteria 10774
147 Ga0495623_0030227 3300046679 Bacteria 3484
148 Ga0495646_0035563 3300046680 Bacteria 3089
149 Ga0495600_0013518 3300046809 Bacteria 5132
150 Ga0495604_0000355 3300047317 Bacteria 41013
151 Ga0495604_0005162 3300047317 Bacteria 10340
152 Ga0495674_0002445 3300047319 Bacteria 18147
153 Ga0495680_0071631 3300047322 Bacteria 2638
154 Ga0495675_0001163 3300047444 Bacteria 15971
155 Ga0495684_0106738 3300047471 Bacteria 2115
156 Ga0495593_0135370 3300047673 Bacteria 1249
157 Ga0496104_0000061 3300048907 Bacteria 117394
158 Ga0496105_0000365 3300048908 Bacteria 30018
159 Ga0496112_0012665 3300048915 Bacteria 7755
160 Ga0496115_0007199 3300048918 Bacteria 8174
161 Ga0501032_0015078 3300049569 Bacteria 5459
162 Ga0501033_0010878 3300049570 Bacteria 6976
163 Ga0501033_0067934 3300049570 Bacteria 2621
164 Ga0501034_0003887 3300049571 Bacteria 16806
165 Ga0501034_0046003 3300049571 Bacteria 4410
166 Ga0501034_0070860 3300049571 Bacteria 3496
167 Ga0501034_0151268 3300049571 Bacteria 2296
168 Ga0501036_0029635 3300049572 Bacteria 4622
169 Ga0501037_0027016 3300049573 Bacteria 4240
170 Ga0501038_0006579 3300049574 Bacteria 10745
171 Ga0501038_0083978 3300049574 Bacteria 2680
172 Ga0501039_0007939 3300049575 Bacteria 8085
173 Ga0501043_0004954 3300049579 Bacteria 10773
174 Ga0501043_0100380 3300049579 Bacteria 2275
175 Ga0501046_0006231 3300049580 Bacteria 10589
176 Ga0501047_0009045 3300049581 Bacteria 9408
177 Ga0501047_0037906 3300049581 Bacteria 4662
178 Ga0501047_0056502 3300049581 Bacteria 3795
179 Ga0501047_0241002 3300049581 Bacteria 1659
180 Ga0501067_0007764 3300049583 Bacteria 5967
181 Ga0501068_0009315 3300049584 Bacteria 5491
182 Ga0501069_0001760 3300049585 Bacteria 10809
183 Ga0501070_0080429 3300049586 Bacteria 2696
184 Ga0501070_0194161 3300049586 Bacteria 1668
185 Ga0501071_0002297 3300049587 Bacteria 11532
186 Ga0501073_0004388 3300049589 Bacteria 10597
187 Ga0501074_0006366 3300049590 Bacteria 8524
188 Ga0501080_0023639 3300049742 Bacteria 5695
189 Ga0501080_0040390 3300049742 Bacteria 4351
190 Ga0501083_0008360 3300049744 Bacteria 7316
191 Ga0501044_0022266 3300049823 Bacteria 6754
192 Ga0501044_0031796 3300049823 Bacteria 5550
193 Ga0501044_0127551 3300049823 Bacteria 2540
194 Ga0501044_0129132 3300049823 Bacteria 2522
195 nmdc:mga00v17_133044_c1 3300050491 Bacteria 1590
196 nmdc:mga0yw44_119717_c1 3300050492 Bacteria 1695
197 nmdc:mga0k408_10341_c1 3300050493 Bacteria 5046
198 nmdc:mga0k408_13850_c2 3300050493 Bacteria 3551
199 nmdc:mga0k408_34837_c1 3300050493 Bacteria 2884
200 nmdc:mga0sz30_2278_c1 3300050516 Bacteria 6862
201 Ga0495601_0000161 3300053077 Bacteria 36812
202 Ga0495601_0011280 3300053077 Bacteria 5341
203 Ga0495619_0006688 3300053085 Bacteria 7292
204 Ga0500644_0000605 3300053088 Bacteria 13553
205 Ga0500651_0008638 3300053093 Bacteria 6011
206 Ga0500566_0047611 3300053094 Bacteria 2461
207 Ga0500641_0006359 3300053096 Bacteria 4194
208 Ga0500641_0009851 3300053096 Bacteria 3442
209 Ga0500555_012162 3300053103 Bacteria 2475
210 Ga0500562_011950 3300053108 Bacteria 2204
211 Ga0500595_000001 3300053119 Bacteria 1088438
212 Ga0500595_002463 3300053119 Bacteria 9175
213 Ga0500642_0034982 3300053130 Bacteria 2129
214 Ga0500652_000010 3300053131 Bacteria 162810
215 Ga0500652_005982 3300053131 Bacteria 3879
216 Ga0500616_0000001 3300053153 Bacteria 1986011
217 Ga0500616_0045972 3300053153 Bacteria 2322
218 Ga0500636_0010933 3300053177 Bacteria 5308
219 Ga0500645_000288 3300053730 Bacteria 36240
220 Ga0501084_0009883 3300054114 Bacteria 7885
221 Ga0501082_0008093 3300060353 Bacteria 9070
222 Ga0501082_0008480 3300060353 Bacteria 8862
223 2643758457 2643221547 Bacteria 4740017
224 Ga0265338_10051762
225 rootH2_10041494
226 Ga0070658_10002625
227 Ga0070658_10239185
228 Ga0070690_100008869
229 Ga0070680_100006876
230 Ga0070680_100089904
231 Ga0070680_100188906
232 Ga0068868_100011223
233 Ga0070660_100001786
234 Ga0070660_100120445
235 Ga0070689_100045047
236 Ga0070689_100245080
237 Ga0070675_100278272
238 Ga0070673_100115597
239 Ga0070667_100175476
240 Ga0070709_10077609
241 Ga0070714_100119314
242 Ga0070711_100045614
243 Ga0070678_100049396
244 Ga0070681_10002613
245 Ga0068867_100153901
246 Ga0070679_100031986
247 Ga0070672_100108533
248 Ga0070693_100019250
249 Ga0068855_100009889
250 Ga0068855_100012239
251 Ga0068855_100013776
252 Ga0068856_100051961
253 Ga0068852_100171014
254 Ga0068859_100201174
255 Ga0070717_10144292
256 Ga0075363_100059233
257 Ga0075362_10019640
258 Ga0075366_10002493
259 Ga0075366_10034441
260 Ga0075366_10035178
261 Ga0068871_100025541
262 Ga0097620_100201181
263 Ga0105240_10031165
264 Ga0105240_10352720
265 Ga0105245_10003726
266 Ga0114129_10366929
267 Ga0105242_10080602
268 Ga0105248_10027882
269 Ga0105248_10366439
270 Ga0105238_10019721
271 Ga0157370_10045931
272 Ga0157370_10171146
273 Ga0157369_10041952
274 Ga0163162_10060368
275 Ga0163163_10003932
276 Ga0209758_1000302
277 Ga0207705_10074468
278 Ga0207707_10073463
279 Ga0207707_10079387
280 Ga0207707_10269067
281 Ga0207693_10012412
282 Ga0207693_10038590
283 Ga0207663_10034070
284 Ga0207663_10103776
285 Ga0207660_10023149
286 Ga0207660_10035094
287 Ga0207662_10017423
288 Ga0207659_10174927
289 Ga0207687_10008547
290 Ga0207709_10057783
291 Ga0207670_10008354
292 Ga0207667_10005244
293 Ga0207667_10185048
294 Ga0207658_10211056
295 Ga0207677_10022241
296 Ga0207702_10045291
297 Ga0207702_10090638
298 Ga0207641_10202008
299 Ga0207648_10058853
300 Ga0207683_10215012
301 Ga0207698_10015351
302 Ga0207698_10025791
303 Ga0268266_10060891
304 Ga0265337_1004464
305 Ga0265338_10010279
306 Ga0265338_10056541
307 Ga0265325_10000172
308 Ga0265325_10001225
309 Ga0265325_10026117
310 Ga0265325_10037369
311 Ga0265339_10000330
312 Ga0265339_10029162
313 Ga0265339_10047941
314 Ga0265331_10006164
315 Ga0265316_10135333
316 Ga0265313_10000572
317 Ga0265313_10019583
318 Ga0265313_10025558
319 Ga0316575_10024678
320 Ga0265314_10001133
321 Ga0265314_10002100
322 Ga0265342_10000196
323 Ga0265342_10010238
324 Ga0316583_10007353
325 Ga0373934_0081025
326 Ga0373953_0003022
327 Ga0373956_0015654
328 Ga0373955_0005694
329 Ga0373924_0039804
330 Ga0373933_0004188
331 Ga0373937_0000456
332 Ga0373925_0193618
333 Ga0395899_0011739
334 Ga0395900_0009787
335 Ga0395898_0016915
336 Ga0395901_0007277
337 Ga0395901_0017017
338 Ga0395901_0071523
339 Ga0395901_0171846
340 Ga0436365_0957394
341 Ga0466963_0069848
342 Ga0466963_0147226
343 Ga0451576_0010236
344 Ga0451576_0018005
345 Ga0466958_0043618
346 Ga0466967_0006503
347 Ga0466967_0206643
348 Ga0495592_0022271
349 Ga0495629_0001793
350 Ga0495651_0001716
351 Ga0495653_0013557
352 Ga0495582_0083332
353 Ga0495664_0016343
354 Ga0495608_0000549
355 Ga0495608_0026179
356 Ga0495618_0010180
357 Ga0495628_0007532
358 Ga0495630_0116505
359 Ga0495652_0012424
360 Ga0495640_0001563
361 Ga0495587_0014693
362 Ga0495645_0000399
363 Ga0495645_0009518
364 Ga0495667_0002610
365 Ga0495635_0001327
366 Ga0495635_0006787
367 Ga0495657_0047731
368 Ga0495599_0008006
369 Ga0495623_0003221
370 Ga0495623_0030227
371 Ga0495646_0035563
372 Ga0495600_0013518
373 Ga0495604_0000355
374 Ga0495604_0005162
375 Ga0495674_0002445
376 Ga0495680_0071631
377 Ga0495675_0001163
378 Ga0495684_0106738
379 Ga0495593_0135370
380 Ga0496104_0000061
381 Ga0496105_0000365
382 Ga0496112_0012665
383 Ga0496115_0007199
384 Ga0501032_0015078
385 Ga0501033_0010878
386 Ga0501033_0067934
387 Ga0501034_0003887
388 Ga0501034_0046003
389 Ga0501034_0070860
390 Ga0501034_0151268
391 Ga0501036_0029635
392 Ga0501037_0027016
393 Ga0501038_0006579
394 Ga0501038_0083978
395 Ga0501039_0007939
396 Ga0501043_0004954
397 Ga0501043_0100380
398 Ga0501046_0006231
399 Ga0501047_0009045
400 Ga0501047_0037906
401 Ga0501047_0056502
402 Ga0501047_0241002
403 Ga0501067_0007764
404 Ga0501068_0009315
405 Ga0501069_0001760
406 Ga0501070_0080429
407 Ga0501070_0194161
408 Ga0501071_0002297
409 Ga0501073_0004388
410 Ga0501074_0006366
411 Ga0501080_0023639
412 Ga0501080_0040390
413 Ga0501083_0008360
414 Ga0501044_0022266
415 Ga0501044_0031796
416 Ga0501044_0127551
417 Ga0501044_0129132
418 nmdc:mga00v17_133044_c1
419 nmdc:mga0yw44_119717_c1
420 nmdc:mga0k408_10341_c1
421 nmdc:mga0k408_13850_c2
422 nmdc:mga0k408_34837_c1
423 nmdc:mga0sz30_2278_c1
424 Ga0495601_0000161
425 Ga0495601_0011280
426 Ga0495619_0006688
427 Ga0500644_0000605
428 Ga0500651_0008638
429 Ga0500566_0047611
430 Ga0500641_0006359
431 Ga0500641_0009851
432 Ga0500555_012162
433 Ga0500562_011950
434 Ga0500595_000001
435 Ga0500595_002463
436 Ga0500642_0034982
437 Ga0500652_000010
438 Ga0500652_005982
439 Ga0500616_0000001
440 Ga0500616_0045972
441 Ga0500636_0010933
442 Ga0500645_000288
443 Ga0501084_0009883
444 Ga0501082_0008093
445 Ga0501082_0008480
446 2643758457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01554

MatE

MatE

271

429

0.97

PF14667

Polysacc_synt_C

Polysaccharide biosynthesis C-terminal domain

382

475

0.95

PF01943

Polysacc_synt

Polysaccharide biosynthesis protein

55

325

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7waw-assembly1.cif.gz_A murj inward closed form 0.7839 43 440
6fhz-assembly1.cif.gz_A inward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.7804 44 443
6cc4-assembly1.cif.gz_A structure of murj from escherichia coli 0.7754 43 440
7wag-assembly1.cif.gz_A crystal structure of murj squeezed form 0.7674 28 440
6nc6-assembly2.cif.gz_B lipid ii flippase murj, inward closed conformation 0.7444 36 443
ID Description Score Start End Superfamily
af_A0A0R0GV15_321_483_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8857 253 406 1.20.1250.20
af_P0AAA7_285_416_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8703 314 440 1.20.1070.10
af_Q9FNC1_271_433_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8673 253 407 1.20.1250.20
af_Q6I630_273_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8584 275 379 1.20.1250.20
af_A0A1D6P003_256_419_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8582 253 404 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7S8C4F2-F1-model_v4 Oligosaccharide flippase family protein 0.9268 24 442 GO:0005886
AF-A0A4P6FSD5-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.9255 21 439 GO:0005886
AF-A0A2G6NZR6-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.9229 35 442 GO:0005886
AF-A0A661CV01-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.9141 7 442 GO:0005886
AF-A0A1E8FAV9-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.9102 24 444 GO:0005886

Map