F335673

General Info

Members Datasets Scaffolds Average Seq Length
223 148 446 203

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10085913|Ga0207652_100859133
Length 224
Sequence MERLLDELDGAGAGRAFVIINPSEHDYHNIYKLMVGAIVPRPVAFVSTISADGIRNLAPFSFFTGISANPPVICFSPMIRGSDGSRKDTLRNIEAVKEFVVNVVSEEFAEQMNICSAEFPPEVDEFEASGLTPVASDLVRPPRVKESHINMECRLLQIVDVSAKPLGGSIVLGEVLRFHVDDAVFDNYKIDPDKLHAIGRMGGPTYIRTTDRFDMARPKTGEIK

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
141 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.73
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 18.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10085913 3300025921 Bacteria 2758
2 Ga0070683_100019304 3300005329 Bacteria 6055
3 Ga0068869_100443343 3300005334 Bacteria 1075
4 Ga0068868_100177302 3300005338 Bacteria 1766
5 Ga0070673_100097834 3300005364 Bacteria 2410
6 Ga0070688_100454081 3300005365 Bacteria 959
7 Ga0070667_101388225 3300005367 Bacteria 659
8 Ga0070709_10055472 3300005434 Unclassified 2502
9 Ga0070709_10317655 3300005434 Unclassified 1142
10 Ga0070709_10469636 3300005434 Bacteria 951
11 Ga0070714_100033344 3300005435 Unclassified 4304
12 Ga0070714_100340706 3300005435 Bacteria 1406
13 Ga0070711_100011376 3300005439 Bacteria 5523
14 Ga0070694_100811058 3300005444 Unclassified 768
15 Ga0070694_100899354 3300005444 Bacteria 731
16 Ga0070708_101118383 3300005445 Bacteria 738
17 Ga0068867_100116447 3300005459 Bacteria 2060
18 Ga0070707_100655588 3300005468 Unclassified 1012
19 Ga0070698_100166990 3300005471 Unclassified 2143
20 Ga0070698_100339632 3300005471 Unclassified 1433
21 Ga0070679_100491621 3300005530 Bacteria 1171
22 Ga0070684_100114013 3300005535 Bacteria 2426
23 Ga0070697_100214610 3300005536 Bacteria 1639
24 Ga0070686_100059263 3300005544 Bacteria 2466
25 Ga0070696_100005861 3300005546 Bacteria 8203
26 Ga0070696_100047757 3300005546 Bacteria 2971
27 Ga0070665_100008479 3300005548 Bacteria 10400
28 Ga0070665_100058957 3300005548 Archaea 3848
29 Ga0070704_100151038 3300005549 Bacteria 1826
30 Ga0068864_100047867 3300005618 Bacteria 3675
31 Ga0068866_10252515 3300005718 Bacteria 1080
32 Ga0068863_100530247 3300005841 Bacteria 1161
33 Ga0068858_100472985 3300005842 Bacteria 1209
34 Ga0068860_100885120 3300005843 Bacteria 909
35 Ga0081539_10052593 3300005985 Unclassified 2285
36 Ga0070717_10015662 3300006028 Bacteria 5859
37 Ga0070717_10050651 3300006028 Unclassified 3414
38 Ga0097621_100253688 3300006237 Bacteria 1541
39 Ga0068871_100018351 3300006358 Bacteria 5315
40 Ga0068871_100103408 3300006358 Bacteria 2388
41 Ga0068871_101044776 3300006358 Unclassified 762
42 Ga0075428_100544892 3300006844 Bacteria 1240
43 Ga0075430_100330220 3300006846 Unclassified 1260
44 Ga0075433_10151883 3300006852 Bacteria 2060
45 Ga0075429_100018536 3300006880 Bacteria 6027
46 Ga0068865_100029772 3300006881 Bacteria 3626
47 Ga0068865_100422383 3300006881 Bacteria 1096
48 Ga0075436_100014644 3300006914 Bacteria 5376
49 Ga0075436_100094831 3300006914 Bacteria 2075
50 Ga0075435_100250687 3300007076 Bacteria 1507
51 Ga0075435_101092562 3300007076 Unclassified 697
52 Ga0105240_10015026 3300009093 Bacteria 10541
53 Ga0105240_10108786 3300009093 Bacteria 3358
54 Ga0105240_10137233 3300009093 Bacteria 2928
55 Ga0105240_10342646 3300009093 Bacteria 1697
56 Ga0111539_12026809 3300009094 Unclassified 667
57 Ga0105245_10003644 3300009098 Bacteria 13749
58 Ga0114129_10354445 3300009147 Bacteria 1943
59 Ga0105242_10064434 3300009176 Bacteria 3021
60 Ga0105242_10174902 3300009176 Bacteria 1889
61 Ga0105248_10068815 3300009177 Bacteria 3975
62 Ga0105248_10244519 3300009177 Bacteria 2020
63 Ga0105248_10442675 3300009177 Bacteria 1464
64 Ga0105248_10446938 3300009177 Bacteria 1456
65 Ga0105237_10052474 3300009545 Bacteria 4093
66 Ga0105238_10395351 3300009551 Bacteria 1375
67 Ga0105239_10036860 3300010375 Bacteria 5365
68 Ga0157374_10390038 3300013296 Bacteria 1388
69 Ga0157378_10873554 3300013297 Bacteria 929
70 Ga0163162_10118908 3300013306 Bacteria 2745
71 Ga0157375_10065750 3300013308 Unclassified 3616
72 Ga0157375_10360432 3300013308 Unclassified 1620
73 Ga0163163_10041017 3300014325 Bacteria 4524
74 Ga0163163_10202394 3300014325 Bacteria 2034
75 Ga0163163_11162204 3300014325 Bacteria 834
76 Ga0157379_10072666 3300014968 Bacteria 3078
77 Ga0157376_10728565 3300014969 Bacteria 999
78 Ga0213876_10097115 3300021384 Unclassified 1561
79 Ga0213875_10003185 3300021388 Bacteria 9436
80 Ga0213875_10014081 3300021388 Unclassified 3910
81 Ga0213875_10050184 3300021388 Unclassified 1955
82 Ga0207642_10186917 3300025899 Bacteria 1133
83 Ga0207699_10404454 3300025906 Unclassified 973
84 Ga0207707_10008447 3300025912 Bacteria 8931
85 Ga0207695_10005319 3300025913 Bacteria 17141
86 Ga0207695_10144459 3300025913 Bacteria 2325
87 Ga0207695_10251844 3300025913 Bacteria 1665
88 Ga0207695_10795099 3300025913 Bacteria 826
89 Ga0207671_10011740 3300025914 Bacteria 7098
90 Ga0207652_10432938 3300025921 Bacteria 1186
91 Ga0207694_10198908 3300025924 Bacteria 1630
92 Ga0207687_10464311 3300025927 Bacteria 1052
93 Ga0207664_10020143 3300025929 Unclassified 4939
94 Ga0207686_10019781 3300025934 Bacteria 3836
95 Ga0207689_10439665 3300025942 Bacteria 1089
96 Ga0207661_10015280 3300025944 Bacteria 5645
97 Ga0207658_10478949 3300025986 Bacteria 1106
98 Ga0207677_10095156 3300026023 Bacteria 2176
99 Ga0207677_10536578 3300026023 Bacteria 1017
100 Ga0207703_10145210 3300026035 Bacteria 2063
101 Ga0207639_10899132 3300026041 Bacteria 827
102 Ga0207708_10924078 3300026075 Bacteria 756
103 Ga0207641_10046525 3300026088 Bacteria 3658
104 Ga0207648_10041379 3300026089 Bacteria 4046
105 Ga0207676_10910178 3300026095 Bacteria 863
106 Ga0207675_100221773 3300026118 Bacteria 1822
107 Ga0207683_10068906 3300026121 Bacteria 3124
108 Ga0268266_10486073 3300028379 Unclassified 1177
109 Ga0268264_11288687 3300028381 Bacteria 741
110 Ga0265319_1112172 3300028563 Bacteria 852
111 Ga0265334_10009088 3300028573 Bacteria 4214
112 Ga0265322_10000341 3300028654 Bacteria 19633
113 Ga0265338_10050142 3300028800 Bacteria 3777
114 Ga0265338_10064468 3300028800 Unclassified 3186
115 Ga0265330_10106207 3300031235 Bacteria 1201
116 Ga0265331_10068458 3300031250 Bacteria 1664
117 Ga0265331_10086577 3300031250 Bacteria 1451
118 Ga0265316_10106616 3300031344 Bacteria 2125
119 Ga0265316_10630461 3300031344 Bacteria 759
120 Ga0265314_10060436 3300031711 Bacteria 2586
121 Ga0265314_10064540 3300031711 Bacteria 2478
122 Ga0265314_10325983 3300031711 Bacteria 853
123 Ga0316578_10012792 3300031728 Bacteria 4431
124 Ga0316578_10280824 3300031728 Bacteria 997
125 Ga0373934_0006882 3300035086 Unclassified 4221
126 Ga0373934_0020441 3300035086 Archaea 2544
127 Ga0373923_0026385 3300035111 Bacteria 2311
128 Ga0373954_0002321 3300035118 Bacteria 7936
129 Ga0373954_0046872 3300035118 Bacteria 2021
130 Ga0373954_0123776 3300035118 Bacteria 1256
131 Ga0373957_0054346 3300035120 Bacteria 1538
132 Ga0373957_0233256 3300035120 Bacteria 772
133 Ga0373943_0062466 3300035170 Bacteria 1865
134 Ga0373946_0092933 3300035171 Unclassified 1340
135 Ga0373946_0262526 3300035171 Bacteria 845
136 Ga0373955_0003569 3300035172 Bacteria 6849
137 Ga0373955_0064548 3300035172 Bacteria 2030
138 Ga0373935_0014019 3300035692 Unclassified 4840
139 Ga0373927_0001821 3300035695 Bacteria 15837
140 Ga0373927_0003086 3300035695 Bacteria 12066
141 Ga0373927_0008086 3300035695 Bacteria 7100
142 Ga0373933_0013795 3300035724 Bacteria 4484
143 Ga0373933_0061961 3300035724 Bacteria 2258
144 Ga0373933_0370316 3300035724 Bacteria 932
145 Ga0373947_0013120 3300035725 Unclassified 4750
146 Ga0373937_0002609 3300036401 Bacteria 15017
147 Ga0373937_0003389 3300036401 Bacteria 13377
148 Ga0373937_0055410 3300036401 Unclassified 3639
149 Ga0373937_0159302 3300036401 Bacteria 2116
150 Ga0373937_0407458 3300036401 Bacteria 1290
151 Ga0316582_0056847 3300036647 Unclassified 2498
152 Ga0373925_0149805 3300037068 Unclassified 1831
153 Ga0373925_0262300 3300037068 Bacteria 1388
154 Ga0373925_0293704 3300037068 Bacteria 1311
155 Ga0373925_0473244 3300037068 Bacteria 1027
156 Ga0395905_0051439 3300037471 Bacteria 3859
157 Ga0436364_0119716 3300037853 Bacteria 12091
158 Ga0436364_0290513 3300037853 Unclassified 4352
159 Ga0395901_0364661 3300038443 Bacteria 1489
160 Ga0400486_13148 3300038742 Bacteria 1052
161 Ga0436365_1817301 3300039437 Unclassified 3310
162 Ga0451577_0024172 3300042876 Bacteria 5529
163 Ga0451577_0144630 3300042876 Bacteria 2138
164 Ga0453683_0004994 3300044673 Bacteria 9320
165 Ga0453683_0372116 3300044673 Bacteria 919
166 Ga0453684_0507481 3300044712 Bacteria 1334
167 Ga0451576_0009919 3300045051 Bacteria 10998
168 Ga0451576_0241176 3300045051 Unclassified 1888
169 Ga0451576_0466995 3300045051 Archaea 1325
170 Ga0451576_0522396 3300045051 Unclassified 1247
171 Ga0451576_1032353 3300045051 Bacteria 861
172 Ga0495580_0007975 3300046472 Bacteria 8462
173 Ga0495580_0253707 3300046472 Bacteria 1204
174 Ga0495580_0448304 3300046472 Bacteria 866
175 Ga0495580_0491150 3300046472 Bacteria 820
176 Ga0495664_0010608 3300046477 Bacteria 5172
177 Ga0495594_0329106 3300046499 Bacteria 870
178 Ga0495586_0006297 3300046535 Bacteria 6342
179 Ga0495645_0322834 3300046543 Bacteria 1002
180 Ga0495667_0193368 3300046559 Unclassified 1303
181 Ga0495634_0002663 3300046642 Bacteria 14680
182 Ga0495635_0545551 3300046663 Unclassified 760
183 Ga0495657_0134457 3300046675 Bacteria 1546
184 Ga0495658_0228941 3300046683 Bacteria 1165
185 Ga0495581_0476536 3300047315 Bacteria 726
186 Ga0495674_0000325 3300047319 Bacteria 41944
187 Ga0495674_0121290 3300047319 Unclassified 2208
188 Ga0495674_0261734 3300047319 Bacteria 1421
189 Ga0495674_0764516 3300047319 Unclassified 754
190 Ga0495676_0459993 3300047321 Bacteria 839
191 Ga0495675_0185315 3300047444 Bacteria 1273
192 Ga0495684_0036767 3300047471 Unclassified 3754
193 Ga0495684_0325117 3300047471 Bacteria 1098
194 Ga0495684_0375519 3300047471 Unclassified 1004
195 Ga0495602_0046075 3300048088 Unclassified 3942
196 Ga0496100_0005606 3300048903 Bacteria 6780
197 Ga0496101_0000711 3300048904 Bacteria 19895
198 Ga0496102_0024980 3300048905 Bacteria 5316
199 Ga0496104_0063662 3300048907 Bacteria 3498
200 Ga0496104_0688140 3300048907 Bacteria 931
201 Ga0496105_0164930 3300048908 Bacteria 1818
202 Ga0496105_0492471 3300048908 Bacteria 963
203 Ga0496106_0329633 3300048909 Bacteria 1225
204 Ga0496107_0110584 3300048910 Bacteria 2019
205 Ga0496109_0274104 3300048912 Bacteria 1590
206 Ga0496110_0910285 3300048913 Bacteria 786
207 Ga0496114_0000224 3300048917 Bacteria 41100
208 Ga0496114_0000702 3300048917 Bacteria 24951
209 Ga0496115_0035239 3300048918 Bacteria 3959
210 Ga0496115_0129337 3300048918 Bacteria 2081
211 Ga0501034_0018928 3300049571 Bacteria 7054
212 Ga0501034_0533828 3300049571 Bacteria 1084
213 Ga0501239_002352 3300049672 Bacteria 1709
214 Ga0501249_010971 3300049679 Bacteria 1898
215 nmdc:mga05p37_386379_c1 3300050507 Bacteria 1638
216 nmdc:mga09592_27193_c1 3300050508 Bacteria 4747
217 nmdc:mga0qj67_304487_c1 3300050509 Bacteria 1291
218 nmdc:mga0rr50_838445_c1 3300050513 Unclassified 784
219 nmdc:mga0rr50_910197_c1 3300050513 Bacteria 750
220 nmdc:mga08x19_4831_c1 3300050514 Bacteria 7973
221 nmdc:mga08x19_85319_c1 3300050514 Bacteria 2078
222 nmdc:mga0a205_539808_c1 3300050515 Bacteria 1022
223 Ga0495601_0029357 3300053077 Bacteria 3411
224 Ga0207652_10085913
225 Ga0070683_100019304
226 Ga0068869_100443343
227 Ga0068868_100177302
228 Ga0070673_100097834
229 Ga0070688_100454081
230 Ga0070667_101388225
231 Ga0070709_10055472
232 Ga0070709_10317655
233 Ga0070709_10469636
234 Ga0070714_100033344
235 Ga0070714_100340706
236 Ga0070711_100011376
237 Ga0070694_100811058
238 Ga0070694_100899354
239 Ga0070708_101118383
240 Ga0068867_100116447
241 Ga0070707_100655588
242 Ga0070698_100166990
243 Ga0070698_100339632
244 Ga0070679_100491621
245 Ga0070684_100114013
246 Ga0070697_100214610
247 Ga0070686_100059263
248 Ga0070696_100005861
249 Ga0070696_100047757
250 Ga0070665_100008479
251 Ga0070665_100058957
252 Ga0070704_100151038
253 Ga0068864_100047867
254 Ga0068866_10252515
255 Ga0068863_100530247
256 Ga0068858_100472985
257 Ga0068860_100885120
258 Ga0081539_10052593
259 Ga0070717_10015662
260 Ga0070717_10050651
261 Ga0097621_100253688
262 Ga0068871_100018351
263 Ga0068871_100103408
264 Ga0068871_101044776
265 Ga0075428_100544892
266 Ga0075430_100330220
267 Ga0075433_10151883
268 Ga0075429_100018536
269 Ga0068865_100029772
270 Ga0068865_100422383
271 Ga0075436_100014644
272 Ga0075436_100094831
273 Ga0075435_100250687
274 Ga0075435_101092562
275 Ga0105240_10015026
276 Ga0105240_10108786
277 Ga0105240_10137233
278 Ga0105240_10342646
279 Ga0111539_12026809
280 Ga0105245_10003644
281 Ga0114129_10354445
282 Ga0105242_10064434
283 Ga0105242_10174902
284 Ga0105248_10068815
285 Ga0105248_10244519
286 Ga0105248_10442675
287 Ga0105248_10446938
288 Ga0105237_10052474
289 Ga0105238_10395351
290 Ga0105239_10036860
291 Ga0157374_10390038
292 Ga0157378_10873554
293 Ga0163162_10118908
294 Ga0157375_10065750
295 Ga0157375_10360432
296 Ga0163163_10041017
297 Ga0163163_10202394
298 Ga0163163_11162204
299 Ga0157379_10072666
300 Ga0157376_10728565
301 Ga0213876_10097115
302 Ga0213875_10003185
303 Ga0213875_10014081
304 Ga0213875_10050184
305 Ga0207642_10186917
306 Ga0207699_10404454
307 Ga0207707_10008447
308 Ga0207695_10005319
309 Ga0207695_10144459
310 Ga0207695_10251844
311 Ga0207695_10795099
312 Ga0207671_10011740
313 Ga0207652_10432938
314 Ga0207694_10198908
315 Ga0207687_10464311
316 Ga0207664_10020143
317 Ga0207686_10019781
318 Ga0207689_10439665
319 Ga0207661_10015280
320 Ga0207658_10478949
321 Ga0207677_10095156
322 Ga0207677_10536578
323 Ga0207703_10145210
324 Ga0207639_10899132
325 Ga0207708_10924078
326 Ga0207641_10046525
327 Ga0207648_10041379
328 Ga0207676_10910178
329 Ga0207675_100221773
330 Ga0207683_10068906
331 Ga0268266_10486073
332 Ga0268264_11288687
333 Ga0265319_1112172
334 Ga0265334_10009088
335 Ga0265322_10000341
336 Ga0265338_10050142
337 Ga0265338_10064468
338 Ga0265330_10106207
339 Ga0265331_10068458
340 Ga0265331_10086577
341 Ga0265316_10106616
342 Ga0265316_10630461
343 Ga0265314_10060436
344 Ga0265314_10064540
345 Ga0265314_10325983
346 Ga0316578_10012792
347 Ga0316578_10280824
348 Ga0373934_0006882
349 Ga0373934_0020441
350 Ga0373923_0026385
351 Ga0373954_0002321
352 Ga0373954_0046872
353 Ga0373954_0123776
354 Ga0373957_0054346
355 Ga0373957_0233256
356 Ga0373943_0062466
357 Ga0373946_0092933
358 Ga0373946_0262526
359 Ga0373955_0003569
360 Ga0373955_0064548
361 Ga0373935_0014019
362 Ga0373927_0001821
363 Ga0373927_0003086
364 Ga0373927_0008086
365 Ga0373933_0013795
366 Ga0373933_0061961
367 Ga0373933_0370316
368 Ga0373947_0013120
369 Ga0373937_0002609
370 Ga0373937_0003389
371 Ga0373937_0055410
372 Ga0373937_0159302
373 Ga0373937_0407458
374 Ga0316582_0056847
375 Ga0373925_0149805
376 Ga0373925_0262300
377 Ga0373925_0293704
378 Ga0373925_0473244
379 Ga0395905_0051439
380 Ga0436364_0119716
381 Ga0436364_0290513
382 Ga0395901_0364661
383 Ga0400486_13148
384 Ga0436365_1817301
385 Ga0451577_0024172
386 Ga0451577_0144630
387 Ga0453683_0004994
388 Ga0453683_0372116
389 Ga0453684_0507481
390 Ga0451576_0009919
391 Ga0451576_0241176
392 Ga0451576_0466995
393 Ga0451576_0522396
394 Ga0451576_1032353
395 Ga0495580_0007975
396 Ga0495580_0253707
397 Ga0495580_0448304
398 Ga0495580_0491150
399 Ga0495664_0010608
400 Ga0495594_0329106
401 Ga0495586_0006297
402 Ga0495645_0322834
403 Ga0495667_0193368
404 Ga0495634_0002663
405 Ga0495635_0545551
406 Ga0495657_0134457
407 Ga0495658_0228941
408 Ga0495581_0476536
409 Ga0495674_0000325
410 Ga0495674_0121290
411 Ga0495674_0261734
412 Ga0495674_0764516
413 Ga0495676_0459993
414 Ga0495675_0185315
415 Ga0495684_0036767
416 Ga0495684_0325117
417 Ga0495684_0375519
418 Ga0495602_0046075
419 Ga0496100_0005606
420 Ga0496101_0000711
421 Ga0496102_0024980
422 Ga0496104_0063662
423 Ga0496104_0688140
424 Ga0496105_0164930
425 Ga0496105_0492471
426 Ga0496106_0329633
427 Ga0496107_0110584
428 Ga0496109_0274104
429 Ga0496110_0910285
430 Ga0496114_0000224
431 Ga0496114_0000702
432 Ga0496115_0035239
433 Ga0496115_0129337
434 Ga0501034_0018928
435 Ga0501034_0533828
436 Ga0501239_002352
437 Ga0501249_010971
438 nmdc:mga05p37_386379_c1
439 nmdc:mga09592_27193_c1
440 nmdc:mga0qj67_304487_c1
441 nmdc:mga0rr50_838445_c1
442 nmdc:mga0rr50_910197_c1
443 nmdc:mga08x19_4831_c1
444 nmdc:mga08x19_85319_c1
445 nmdc:mga0a205_539808_c1
446 Ga0495601_0029357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

35

215

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hx6-assembly1.cif.gz_B streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 0.9258 38 173
5zc2-assembly1.cif.gz_B acinetobacter baumannii p-hydroxyphenylacetate 3-hydroxylase (hpah), reductase component (c1) 0.9184 38 175
1eje-assembly1.cif.gz_A-2 crystal structure of an fmn-binding protein 0.9154 32 211
4hx6-assembly4.cif.gz_G streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6 0.9136 38 173
5zc2-assembly1.cif.gz_A acinetobacter baumannii p-hydroxyphenylacetate 3-hydroxylase (hpah), reductase component (c1) 0.9132 38 176
ID Description Score Start End Superfamily
1ejeA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9154 32 211 2.30.110.10
4l82C00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9114 38 175 2.30.110.10
2r6vA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9108 38 202 2.30.110.10
af_O53254_5_167_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8982 38 173 2.30.110.10
af_Q2FUW0_12_215_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8964 32 213 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A538TE11-F1-model_v4 Flavin reductase family protein 0.9628 52 214 GO:0010181
GO:0016646
AF-A0A3M7HSR5-F1-model_v4 Flavin reductase like domain-containing protein 0.9618 34 157 GO:0010181
AF-A0A382X5S8-F1-model_v4 Flavin reductase like domain-containing protein 0.9588 55 213 GO:0010181
AF-A0A258KHH3-F1-model_v4 Flavin reductase 0.9573 44 212 GO:0010181
GO:0016646
AF-A0A7Y9ZUM8-F1-model_v4 deleted 0.9532 35 156

Map