F335467

General Info

Members Datasets Scaffolds Average Seq Length
223 119 446 243

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100695316|Ga0075428_1006953162
Length 257
Sequence LSFVDLYPSIDLRGGQCVRLYQGDYDRETVYGDDPVGQARTFADAGAPWIHVVDLDAARTGEGANRELVAEIAGAVDVPVQAGGGVRDDAAADALLGAGVRRVVVGTAALDDPAWVRRLAGRYPGQVAVGLDARGHAVAVRGWVKGSGHDLVEMARSFDDAGVAALVVTEIGRDGTLTGPALDQLADVLAETRLDVVASGGVGSLADLRTLAAFEVDGRRPAGVIVGRALYEGAFRLSDALETLSDVKLTGPETDDA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
47 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
59 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
60 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
61 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
62 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
63 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
64 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
65 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
78 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
114 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
115 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
116 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 0.45
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100695316 3300006844 Bacteria 1083
2 JGI25407J50210_10001126 3300003373 Bacteria 5892
3 Ga0070670_100771521 3300005331 Bacteria 867
4 Ga0070675_100338064 3300005354 Unclassified 1333
5 Ga0070667_100191489 3300005367 Bacteria 1812
6 Ga0070714_100007009 3300005435 Bacteria 8739
7 Ga0070714_100280413 3300005435 Unclassified 1548
8 Ga0070681_10152310 3300005458 Bacteria 2239
9 Ga0070681_10373402 3300005458 Bacteria 1337
10 Ga0070679_100237909 3300005530 Bacteria 1779
11 Ga0070679_100271791 3300005530 Bacteria 1649
12 Ga0070696_100578459 3300005546 Bacteria 903
13 Ga0068855_100727584 3300005563 Bacteria 1060
14 Ga0068856_100507563 3300005614 Bacteria 1227
15 Ga0068861_100281079 3300005719 Bacteria 1433
16 Ga0068862_100570683 3300005844 Bacteria 1083
17 Ga0081455_10001151 3300005937 Bacteria 33143
18 Ga0081455_10001185 3300005937 Bacteria 32662
19 Ga0081538_10000131 3300005981 Bacteria 77253
20 Ga0081538_10009136 3300005981 Bacteria 8313
21 Ga0081538_10025155 3300005981 Bacteria 4210
22 Ga0075363_100081539 3300006048 Bacteria 1770
23 Ga0075428_100015292 3300006844 Bacteria 8510
24 Ga0075428_100023210 3300006844 Bacteria 6861
25 Ga0075428_100150749 3300006844 Bacteria 2526
26 Ga0075428_100219095 3300006844 Bacteria 2055
27 Ga0075428_100276750 3300006844 Bacteria 1806
28 Ga0075430_100000590 3300006846 Bacteria 27564
29 Ga0075430_100025653 3300006846 Bacteria 5016
30 Ga0075430_100033146 3300006846 Bacteria 4384
31 Ga0075430_100035936 3300006846 Bacteria 4202
32 Ga0075430_100206617 3300006846 Bacteria 1630
33 Ga0075431_100002015 3300006847 Bacteria 19394
34 Ga0075431_100002898 3300006847 Bacteria 16590
35 Ga0075431_100040042 3300006847 Bacteria 4829
36 Ga0075431_100078605 3300006847 Bacteria 3405
37 Ga0075429_100000279 3300006880 Bacteria 36024
38 Ga0075429_100014411 3300006880 Bacteria 6851
39 Ga0075429_100018808 3300006880 Bacteria 5984
40 Ga0075429_100218348 3300006880 Bacteria 1670
41 Ga0111539_10011448 3300009094 Bacteria 11137
42 Ga0111539_10039985 3300009094 Bacteria 5648
43 Ga0111539_10418571 3300009094 Bacteria 1560
44 Ga0105245_10008048 3300009098 Bacteria 9218
45 Ga0114129_10000179 3300009147 Bacteria 70108
46 Ga0114129_10099366 3300009147 Bacteria 4028
47 Ga0114129_10111604 3300009147 Bacteria 3772
48 Ga0114129_10119816 3300009147 Bacteria 3624
49 Ga0114129_10196989 3300009147 Bacteria 2731
50 Ga0105243_10669247 3300009148 Bacteria 1008
51 Ga0105241_10074569 3300009174 Bacteria 2642
52 Ga0105242_10412496 3300009176 Bacteria 1263
53 Ga0105239_10385093 3300010375 Bacteria 1586
54 Ga0157370_10415436 3300013104 Bacteria 1238
55 Ga0182008_10062609 3300014497 Bacteria 1833
56 Ga0213873_10005799 3300021358 Bacteria 2392
57 Ga0213876_10023878 3300021384 Bacteria 3228
58 Ga0213876_10068713 3300021384 Unclassified 1871
59 Ga0213876_10137066 3300021384 Bacteria 1302
60 Ga0207684_10039481 3300025910 Bacteria 4004
61 Ga0207654_10106927 3300025911 Bacteria 1734
62 Ga0207707_10130456 3300025912 Bacteria 2198
63 Ga0207707_10278576 3300025912 Bacteria 1449
64 Ga0207652_10183182 3300025921 Bacteria 1883
65 Ga0207652_10202253 3300025921 Bacteria 1788
66 Ga0207687_10107426 3300025927 Bacteria 2065
67 Ga0207664_10000783 3300025929 Bacteria 21456
68 Ga0207644_10493045 3300025931 Bacteria 1010
69 Ga0207669_10342011 3300025937 Bacteria 1153
70 Ga0207667_10142132 3300025949 Bacteria 2471
71 Ga0207658_10173251 3300025986 Bacteria 1780
72 Ga0207702_10469678 3300026078 Bacteria 1223
73 Ga0207675_100333139 3300026118 Bacteria 1484
74 Ga0207428_10025890 3300027907 Bacteria 4902
75 Ga0207428_10028292 3300027907 Bacteria 4658
76 Ga0207428_10087943 3300027907 Bacteria 2417
77 Ga0265327_10000569 3300031251 Bacteria 62732
78 Ga0316576_10006880 3300031727 Bacteria 7110
79 Ga0316576_10130451 3300031727 Bacteria 1891
80 Ga0316576_10266575 3300031727 Bacteria 1284
81 Ga0316578_10013228 3300031728 Bacteria 4370
82 Ga0316577_10055597 3300031733 Bacteria 2208
83 Ga0307409_100712609 3300031995 Bacteria 1004
84 Ga0307415_100447442 3300032126 Bacteria 1116
85 Ga0316574_0041585 3300035398 Bacteria 2834
86 Ga0316574_0042940 3300035398 Bacteria 2792
87 Ga0316574_0110754 3300035398 Bacteria 1760
88 Ga0316584_0000716 3300036712 Bacteria 18468
89 Ga0316584_0085224 3300036712 Bacteria 2366
90 Ga0395899_0015558 3300037312 Bacteria 5801
91 Ga0395900_0030818 3300037418 Bacteria 5507
92 Ga0395898_0012195 3300037466 Bacteria 8890
93 Ga0436364_0459539 3300037853 Bacteria 2488
94 Ga0395901_0067768 3300038443 Bacteria 3717
95 Ga0436365_0062171 3300039437 Unclassified 2926
96 Ga0436365_0238032 3300039437 Bacteria 8625
97 Ga0436365_0981113 3300039437 Bacteria 7776
98 Ga0436360_0938414 3300039438 Bacteria 802
99 Ga0436363_0471322 3300039450 Bacteria 7271
100 Ga0436363_1107223 3300039450 Bacteria 1176
101 Ga0436363_1169514 3300039450 Unclassified 2294
102 Ga0436362_0082773 3300039453 Bacteria 1790
103 Ga0436362_0119394 3300039453 Bacteria 1897
104 Ga0436362_0260691 3300039453 Unclassified 806
105 Ga0436362_0357207 3300039453 Unclassified 4177
106 Ga0436362_0409364 3300039453 Bacteria 1358
107 Ga0436362_0480611 3300039453 Bacteria 9296
108 Ga0436362_0938103 3300039453 Bacteria 3198
109 Ga0439448_0004841 3300042005 Bacteria 3816
110 Ga0439450_000590 3300042008 Bacteria 4799
111 Ga0439463_001387 3300042016 Bacteria 6444
112 Ga0439444_0047859 3300042437 Bacteria 860
113 Ga0439460_0023554 3300042461 Bacteria 1699
114 Ga0466966_0069032 3300044684 Bacteria 2217
115 Ga0466963_0003874 3300044694 Bacteria 8639
116 Ga0466957_0006915 3300044842 Bacteria 6412
117 Ga0466958_0059283 3300045836 Unclassified 2328
118 Ga0466958_0181325 3300045836 Unclassified 1336
119 Ga0466967_0581261 3300045976 Bacteria 1104
120 Ga0495651_0166171 3300046462 Bacteria 1576
121 Ga0495639_0120611 3300046475 Bacteria 1251
122 Ga0495640_0034759 3300046533 Bacteria 3570
123 Ga0495634_0222562 3300046642 Bacteria 1164
124 Ga0495658_0029135 3300046683 Bacteria 2985
125 Ga0495613_0000201 3300046689 Bacteria 58736
126 Ga0495613_0324510 3300046689 Bacteria 1062
127 Ga0495680_0138672 3300047322 Bacteria 1781
128 Ga0495593_0147226 3300047673 Bacteria 1192
129 Ga0496102_0031099 3300048905 Bacteria 4785
130 Ga0501031_0031880 3300049568 Bacteria 3437
131 Ga0501032_0134346 3300049569 Bacteria 1631
132 Ga0501033_0337748 3300049570 Bacteria 1056
133 Ga0501034_0000566 3300049571 Bacteria 58602
134 Ga0501034_0027022 3300049571 Bacteria 5838
135 Ga0501034_0386697 3300049571 Bacteria 1323
136 Ga0501036_0014479 3300049572 Bacteria 6570
137 Ga0501036_0264976 3300049572 Bacteria 1439
138 Ga0501037_0185780 3300049573 Bacteria 1473
139 Ga0501037_0295983 3300049573 Bacteria 1125
140 Ga0501038_0155217 3300049574 Bacteria 1864
141 Ga0501038_0199663 3300049574 Bacteria 1606
142 Ga0501039_0004326 3300049575 Bacteria 10708
143 Ga0501039_0018276 3300049575 Bacteria 5380
144 Ga0501039_0164392 3300049575 Bacteria 1745
145 Ga0501040_0013886 3300049576 Bacteria 5301
146 Ga0501040_0029204 3300049576 Bacteria 3721
147 Ga0501040_0402663 3300049576 Bacteria 983
148 Ga0501041_0003557 3300049577 Bacteria 8966
149 Ga0501041_0011148 3300049577 Bacteria 5309
150 Ga0501042_0002957 3300049578 Bacteria 10561
151 Ga0501042_0283107 3300049578 Bacteria 1197
152 Ga0501043_0333015 3300049579 Bacteria 1156
153 Ga0501046_0013878 3300049580 Bacteria 6806
154 Ga0501046_0161279 3300049580 Bacteria 1686
155 Ga0501046_0250396 3300049580 Bacteria 1304
156 Ga0501048_0055625 3300049582 Bacteria 2808
157 Ga0501048_0371109 3300049582 Bacteria 1021
158 Ga0501067_0109958 3300049583 Bacteria 1532
159 Ga0501068_0022256 3300049584 Bacteria 3705
160 Ga0501069_0220469 3300049585 Bacteria 1102
161 Ga0501071_0015376 3300049587 Bacteria 5253
162 Ga0501071_0041278 3300049587 Bacteria 3304
163 Ga0501071_0203608 3300049587 Bacteria 1487
164 Ga0501071_0203917 3300049587 Bacteria 1486
165 Ga0501072_0037671 3300049588 Bacteria 3793
166 Ga0501072_0040345 3300049588 Bacteria 3665
167 Ga0501072_0524899 3300049588 Bacteria 936
168 Ga0501074_0040120 3300049590 Bacteria 3391
169 Ga0501074_0364418 3300049590 Bacteria 1025
170 Ga0501074_0375321 3300049590 Bacteria 1009
171 Ga0501075_0004844 3300049591 Bacteria 9164
172 Ga0501075_0097368 3300049591 Bacteria 2233
173 Ga0501075_0102410 3300049591 Bacteria 2175
174 Ga0501075_0267988 3300049591 Bacteria 1301
175 Ga0501076_0005731 3300049592 Bacteria 8956
176 Ga0501076_0011294 3300049592 Bacteria 6646
177 Ga0501076_0228246 3300049592 Bacteria 1522
178 Ga0501076_0384830 3300049592 Bacteria 1153
179 Ga0501076_0402106 3300049592 Bacteria 1126
180 Ga0501077_0004964 3300049593 Bacteria 8069
181 Ga0501077_0057681 3300049593 Bacteria 2465
182 Ga0501079_0002315 3300049741 Bacteria 13800
183 Ga0501079_0022075 3300049741 Bacteria 4877
184 Ga0501079_0027203 3300049741 Bacteria 4384
185 Ga0501079_0304054 3300049741 Bacteria 1248
186 Ga0501079_0371141 3300049741 Bacteria 1122
187 Ga0501080_0087527 3300049742 Bacteria 2894
188 Ga0501080_0173746 3300049742 Bacteria 1986
189 Ga0501081_0002686 3300049743 Bacteria 11240
190 Ga0501081_0010174 3300049743 Bacteria 6138
191 Ga0501081_0033294 3300049743 Bacteria 3501
192 Ga0501081_0084725 3300049743 Bacteria 2224
193 Ga0501035_0022255 3300049822 Bacteria 5821
194 Ga0501045_0028895 3300049824 Bacteria 4002
195 Ga0501045_0080555 3300049824 Bacteria 2401
196 Ga0501045_0108504 3300049824 Bacteria 2057
197 Ga0501045_0189760 3300049824 Bacteria 1532
198 nmdc:mga05p37_10953_c1 3300050507 Bacteria 10768
199 nmdc:mga05p37_18429_c1 3300050507 Bacteria 8433
200 nmdc:mga05p37_187947_c1 3300050507 Bacteria 2510
201 nmdc:mga05p37_277851_c1 3300050507 Bacteria 1999
202 nmdc:mga09592_16421_c1 3300050508 Bacteria 6056
203 nmdc:mga09592_625_c1 3300050508 Bacteria 27036
204 nmdc:mga0qj67_27670_c1 3300050509 Bacteria 4396
205 nmdc:mga0qj67_36568_c1 3300050509 Bacteria 3842
206 nmdc:mga0qj67_419036_c1 3300050509 Bacteria 1080
207 nmdc:mga06r32_117808_c1 3300050510 Bacteria 2618
208 nmdc:mga06r32_1235_c1 3300050510 Bacteria 23010
209 nmdc:mga06r32_943266_c1 3300050510 Bacteria 818
210 nmdc:mga06r32_9639_c1 3300050510 Bacteria 8725
211 nmdc:mga08y16_59658_c1 3300050511 Bacteria 3985
212 nmdc:mga08y16_7246_c1 3300050511 Bacteria 11639
213 Ga0495612_0060799 3300053078 Bacteria 1564
214 Ga0500593_149061 3300053117 Bacteria 910
215 Ga0500568_0000081 3300053139 Bacteria 92418
216 Ga0500604_0016182 3300053151 Bacteria 2052
217 Ga0501084_0003518 3300054114 Bacteria 12723
218 Ga0501084_0061712 3300054114 Bacteria 3139
219 Ga0501084_0105725 3300054114 Bacteria 2364
220 Ga0501082_0004433 3300060353 Bacteria 12257
221 Ga0530510_0000388 3300061734 Bacteria 28562
222 Ga0530510_0019869 3300061734 Bacteria 4773
223 Ga0530510_0150314 3300061734 Bacteria 1719
224 Ga0075428_100695316
225 JGI25407J50210_10001126
226 Ga0070670_100771521
227 Ga0070675_100338064
228 Ga0070667_100191489
229 Ga0070714_100007009
230 Ga0070714_100280413
231 Ga0070681_10152310
232 Ga0070681_10373402
233 Ga0070679_100237909
234 Ga0070679_100271791
235 Ga0070696_100578459
236 Ga0068855_100727584
237 Ga0068856_100507563
238 Ga0068861_100281079
239 Ga0068862_100570683
240 Ga0081455_10001151
241 Ga0081455_10001185
242 Ga0081538_10000131
243 Ga0081538_10009136
244 Ga0081538_10025155
245 Ga0075363_100081539
246 Ga0075428_100015292
247 Ga0075428_100023210
248 Ga0075428_100150749
249 Ga0075428_100219095
250 Ga0075428_100276750
251 Ga0075430_100000590
252 Ga0075430_100025653
253 Ga0075430_100033146
254 Ga0075430_100035936
255 Ga0075430_100206617
256 Ga0075431_100002015
257 Ga0075431_100002898
258 Ga0075431_100040042
259 Ga0075431_100078605
260 Ga0075429_100000279
261 Ga0075429_100014411
262 Ga0075429_100018808
263 Ga0075429_100218348
264 Ga0111539_10011448
265 Ga0111539_10039985
266 Ga0111539_10418571
267 Ga0105245_10008048
268 Ga0114129_10000179
269 Ga0114129_10099366
270 Ga0114129_10111604
271 Ga0114129_10119816
272 Ga0114129_10196989
273 Ga0105243_10669247
274 Ga0105241_10074569
275 Ga0105242_10412496
276 Ga0105239_10385093
277 Ga0157370_10415436
278 Ga0182008_10062609
279 Ga0213873_10005799
280 Ga0213876_10023878
281 Ga0213876_10068713
282 Ga0213876_10137066
283 Ga0207684_10039481
284 Ga0207654_10106927
285 Ga0207707_10130456
286 Ga0207707_10278576
287 Ga0207652_10183182
288 Ga0207652_10202253
289 Ga0207687_10107426
290 Ga0207664_10000783
291 Ga0207644_10493045
292 Ga0207669_10342011
293 Ga0207667_10142132
294 Ga0207658_10173251
295 Ga0207702_10469678
296 Ga0207675_100333139
297 Ga0207428_10025890
298 Ga0207428_10028292
299 Ga0207428_10087943
300 Ga0265327_10000569
301 Ga0316576_10006880
302 Ga0316576_10130451
303 Ga0316576_10266575
304 Ga0316578_10013228
305 Ga0316577_10055597
306 Ga0307409_100712609
307 Ga0307415_100447442
308 Ga0316574_0041585
309 Ga0316574_0042940
310 Ga0316574_0110754
311 Ga0316584_0000716
312 Ga0316584_0085224
313 Ga0395899_0015558
314 Ga0395900_0030818
315 Ga0395898_0012195
316 Ga0436364_0459539
317 Ga0395901_0067768
318 Ga0436365_0062171
319 Ga0436365_0238032
320 Ga0436365_0981113
321 Ga0436360_0938414
322 Ga0436363_0471322
323 Ga0436363_1107223
324 Ga0436363_1169514
325 Ga0436362_0082773
326 Ga0436362_0119394
327 Ga0436362_0260691
328 Ga0436362_0357207
329 Ga0436362_0409364
330 Ga0436362_0480611
331 Ga0436362_0938103
332 Ga0439448_0004841
333 Ga0439450_000590
334 Ga0439463_001387
335 Ga0439444_0047859
336 Ga0439460_0023554
337 Ga0466966_0069032
338 Ga0466963_0003874
339 Ga0466957_0006915
340 Ga0466958_0059283
341 Ga0466958_0181325
342 Ga0466967_0581261
343 Ga0495651_0166171
344 Ga0495639_0120611
345 Ga0495640_0034759
346 Ga0495634_0222562
347 Ga0495658_0029135
348 Ga0495613_0000201
349 Ga0495613_0324510
350 Ga0495680_0138672
351 Ga0495593_0147226
352 Ga0496102_0031099
353 Ga0501031_0031880
354 Ga0501032_0134346
355 Ga0501033_0337748
356 Ga0501034_0000566
357 Ga0501034_0027022
358 Ga0501034_0386697
359 Ga0501036_0014479
360 Ga0501036_0264976
361 Ga0501037_0185780
362 Ga0501037_0295983
363 Ga0501038_0155217
364 Ga0501038_0199663
365 Ga0501039_0004326
366 Ga0501039_0018276
367 Ga0501039_0164392
368 Ga0501040_0013886
369 Ga0501040_0029204
370 Ga0501040_0402663
371 Ga0501041_0003557
372 Ga0501041_0011148
373 Ga0501042_0002957
374 Ga0501042_0283107
375 Ga0501043_0333015
376 Ga0501046_0013878
377 Ga0501046_0161279
378 Ga0501046_0250396
379 Ga0501048_0055625
380 Ga0501048_0371109
381 Ga0501067_0109958
382 Ga0501068_0022256
383 Ga0501069_0220469
384 Ga0501071_0015376
385 Ga0501071_0041278
386 Ga0501071_0203608
387 Ga0501071_0203917
388 Ga0501072_0037671
389 Ga0501072_0040345
390 Ga0501072_0524899
391 Ga0501074_0040120
392 Ga0501074_0364418
393 Ga0501074_0375321
394 Ga0501075_0004844
395 Ga0501075_0097368
396 Ga0501075_0102410
397 Ga0501075_0267988
398 Ga0501076_0005731
399 Ga0501076_0011294
400 Ga0501076_0228246
401 Ga0501076_0384830
402 Ga0501076_0402106
403 Ga0501077_0004964
404 Ga0501077_0057681
405 Ga0501079_0002315
406 Ga0501079_0022075
407 Ga0501079_0027203
408 Ga0501079_0304054
409 Ga0501079_0371141
410 Ga0501080_0087527
411 Ga0501080_0173746
412 Ga0501081_0002686
413 Ga0501081_0010174
414 Ga0501081_0033294
415 Ga0501081_0084725
416 Ga0501035_0022255
417 Ga0501045_0028895
418 Ga0501045_0080555
419 Ga0501045_0108504
420 Ga0501045_0189760
421 nmdc:mga05p37_10953_c1
422 nmdc:mga05p37_18429_c1
423 nmdc:mga05p37_187947_c1
424 nmdc:mga05p37_277851_c1
425 nmdc:mga09592_16421_c1
426 nmdc:mga09592_625_c1
427 nmdc:mga0qj67_27670_c1
428 nmdc:mga0qj67_36568_c1
429 nmdc:mga0qj67_419036_c1
430 nmdc:mga06r32_117808_c1
431 nmdc:mga06r32_1235_c1
432 nmdc:mga06r32_943266_c1
433 nmdc:mga06r32_9639_c1
434 nmdc:mga08y16_59658_c1
435 nmdc:mga08y16_7246_c1
436 Ga0495612_0060799
437 Ga0500593_149061
438 Ga0500568_0000081
439 Ga0500604_0016182
440 Ga0501084_0003518
441 Ga0501084_0061712
442 Ga0501084_0105725
443 Ga0501082_0004433
444 Ga0530510_0000388
445 Ga0530510_0019869
446 Ga0530510_0150314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

5

236

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.9606 1 242
4x2r-assembly1.cif.gz_A crystal structure of pria from actinomyces urogenitalis 0.9575 1 245
4w9t-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9526 1 241
2vep-assembly1.cif.gz_A crystal structure of the full length bifunctional enzyme pria 0.9523 1 241
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9498 1 242
ID Description Score Start End Superfamily
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9583 1 242 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9576 1 245 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9505 1 242 3.20.20.70
af_Q2FUU2_4_232_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9424 4 232 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9364 3 243 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1G2WPJ8-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamideisomerase (EC 5.3.1.16) 0.9905 35 243 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A356NFM4-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9902 2 243 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A6P0Y1M8-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) 0.99 1 191 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A6J7JP54-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamideisomerase (EC 5.3.1.16) 0.9898 19 245 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A7V9SMR6-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9895 1 241 GO:0000105
GO:0000162
GO:0003949
GO:0005737

Map