F335437

General Info

Members Datasets Scaffolds Average Seq Length
223 128 446 155

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10081198|Ga0075365_100811982
Length 174
Sequence MSFDRDPSLLVTSNDGSAGVRVGTRLGLDPGDARIGVARSDPSGFLATPVETVKRGRGDLARIEELVAEIGEDGTVLEVVVGLPRSLSGREGPAAVKVREWAVKLARRLAPVPVRLADERLTTVSAEAMLRDRGRSGAKRRAVVDQAAAVVILQHVLDTERASGTAPGEIVEGN

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
21 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
28 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
29 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
30 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
31 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
32 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
33 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
36 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
37 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
38 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
39 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
40 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
41 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
42 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
45 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
55 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
56 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
57 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
58 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
59 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
60 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
61 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
62 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
63 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
64 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
65 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
66 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
67 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
81 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
91 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
92 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
97 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
98 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
99 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
105 2643221576 Nocardioides sp. Root614 Isolate Unclassified
106 2643221590 Nocardioides sp. Root682 Isolate Unclassified
107 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
108 2643221615 Nocardioides sp. Root224 Isolate Unclassified
109 2643221617 Nocardioides sp. Root79 Isolate Unclassified
110 2643221620 Nocardioides sp. Root240 Isolate Unclassified
111 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
112 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
113 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
114 2738541305 Nocardioides sp. CF167 Isolate Unclassified
115 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
116 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
117 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
118 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
119 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
120 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
121 2891562705 Microbispora tritici MT50 Isolate Unclassified
122 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
123 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
124 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
125 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
126 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
127 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
128 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.24
Metatranscriptomes 0
Isolates 10.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.9
Bulb 0
Endosphere 20.63
Nodule 0
Rhizoplane 5.38
Rhizosphere 60.99
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10081198 3300006038 Bacteria 2196
2 Ga0070682_100454266 3300005337 Bacteria 982
3 Ga0070692_10184242 3300005345 Bacteria 1212
4 Ga0070700_100053858 3300005441 Bacteria 2513
5 Ga0070708_100233008 3300005445 Bacteria 1728
6 Ga0070684_100228358 3300005535 Bacteria 1699
7 Ga0070684_101494120 3300005535 Bacteria 637
8 Ga0068862_100379594 3300005844 Bacteria 1318
9 Ga0081455_10690481 3300005937 Bacteria 652
10 Ga0081539_10066622 3300005985 Bacteria 1951
11 Ga0075365_10003255 3300006038 Bacteria 8323
12 Ga0075365_10029813 3300006038 Bacteria 3490
13 Ga0075365_10036944 3300006038 Bacteria 3168
14 Ga0075365_10039291 3300006038 Bacteria 3080
15 Ga0075365_10170191 3300006038 Bacteria 1520
16 Ga0075365_10271491 3300006038 Bacteria 1193
17 Ga0075365_10292833 3300006038 Bacteria 1145
18 Ga0075365_10511836 3300006038 Bacteria 848
19 Ga0075365_10912632 3300006038 Bacteria 619
20 Ga0075368_10003809 3300006042 Bacteria 5074
21 Ga0075368_10016120 3300006042 Bacteria 2781
22 Ga0075363_100013116 3300006048 Bacteria 4007
23 Ga0075363_100037848 3300006048 Bacteria 2534
24 Ga0075363_100146243 3300006048 Bacteria 1332
25 Ga0075364_10010807 3300006051 Bacteria 5525
26 Ga0075364_10054032 3300006051 Bacteria 2626
27 Ga0075362_10072177 3300006177 Bacteria 1578
28 Ga0075367_10038160 3300006178 Bacteria 2795
29 Ga0075369_10150522 3300006186 Bacteria 1064
30 Ga0075370_10006378 3300006353 Bacteria 5926
31 Ga0075370_10047628 3300006353 Bacteria 2428
32 Ga0068865_100403617 3300006881 Bacteria 1120
33 Ga0105243_11566568 3300009148 Bacteria 684
34 Ga0157375_10116067 3300013308 Bacteria 2781
35 Ga0157380_11995854 3300014326 Bacteria 642
36 Ga0163161_10751760 3300017792 Bacteria 816
37 Ga0207647_10019014 3300025904 Bacteria 4628
38 Ga0207687_10335985 3300025927 Bacteria 1227
39 Ga0207708_10186787 3300026075 Bacteria 1648
40 Ga0207708_10739709 3300026075 Bacteria 843
41 Ga0207675_100279237 3300026118 Bacteria 1623
42 Ga0207675_101212382 3300026118 Bacteria 775
43 Ga0207683_10625690 3300026121 Bacteria 997
44 Ga0307509_10097719 3300031507 Bacteria 2984
45 Ga0307410_10144708 3300031852 Bacteria 1763
46 Ga0307410_10644485 3300031852 Bacteria 888
47 Ga0307407_10084044 3300031903 Bacteria 1933
48 Ga0307416_101173851 3300032002 Bacteria 873
49 Ga0307415_100815166 3300032126 Bacteria 853
50 Ga0307415_101050758 3300032126 Bacteria 760
51 Ga0373931_0321353 3300035691 Bacteria 961
52 Ga0395900_0048216 3300037418 Bacteria 4388
53 Ga0395900_0049218 3300037418 Bacteria 4342
54 Ga0395900_0600700 3300037418 Bacteria 1041
55 Ga0395900_0860389 3300037418 Bacteria 832
56 Ga0395898_0276126 3300037466 Bacteria 1603
57 Ga0395898_0481799 3300037466 Bacteria 1180
58 Ga0395901_0080844 3300038443 Bacteria 3394
59 Ga0451791_1591045 3300041451 Bacteria 927
60 Ga0451837_0503838 3300041494 Bacteria 1403
61 Ga0451837_0764297 3300041494 Bacteria 518
62 Ga0451853_0668643 3300041512 Bacteria 674
63 Ga0451853_2912123 3300041512 Bacteria 2104
64 Ga0451853_3247210 3300041512 Bacteria 535
65 Ga0451853_3521264 3300041512 Bacteria 1602
66 Ga0450907_009675 3300042146 Bacteria 1599
67 Ga0466972_0197283 3300044658 Bacteria 943
68 Ga0466972_0338826 3300044658 Bacteria 703
69 Ga0466965_0050086 3300044683 Bacteria 2071
70 Ga0466965_0060336 3300044683 Bacteria 1894
71 Ga0466965_0068108 3300044683 Bacteria 1787
72 Ga0466965_0250184 3300044683 Bacteria 950
73 Ga0466966_0010557 3300044684 Bacteria 6139
74 Ga0466966_0038632 3300044684 Bacteria 3076
75 Ga0466966_0660702 3300044684 Bacteria 630
76 Ga0466961_0031236 3300044693 Bacteria 3424
77 Ga0466961_0079310 3300044693 Bacteria 2079
78 Ga0466961_0094432 3300044693 Bacteria 1887
79 Ga0466961_0127271 3300044693 Bacteria 1597
80 Ga0466963_0664641 3300044694 Bacteria 735
81 Ga0466963_0788103 3300044694 Bacteria 670
82 Ga0466964_0322347 3300044706 Bacteria 785
83 Ga0466971_0009088 3300044719 Bacteria 4345
84 Ga0466971_0029068 3300044719 Bacteria 2472
85 Ga0466968_0093656 3300044735 Bacteria 1335
86 Ga0466970_0002538 3300044765 Bacteria 8805
87 Ga0466970_0005343 3300044765 Bacteria 6372
88 Ga0466970_0025966 3300044765 Bacteria 3069
89 Ga0466970_0248845 3300044765 Bacteria 995
90 Ga0466957_0004764 3300044842 Bacteria 7593
91 Ga0466957_0057477 3300044842 Bacteria 2381
92 Ga0466957_0100657 3300044842 Bacteria 1821
93 Ga0466957_0607840 3300044842 Bacteria 766
94 Ga0466960_0000559 3300044901 Bacteria 12848
95 Ga0466960_0080915 3300044901 Bacteria 1637
96 Ga0466960_0227765 3300044901 Bacteria 1028
97 Ga0466960_0524526 3300044901 Bacteria 696
98 Ga0466959_0183363 3300045049 Bacteria 1463
99 Ga0466958_0429372 3300045836 Bacteria 854
100 Ga0466958_0438236 3300045836 Bacteria 845
101 Ga0466958_0988475 3300045836 Bacteria 549
102 Ga0466967_0163801 3300045976 Bacteria 2089
103 Ga0466967_1034043 3300045976 Bacteria 818
104 Ga0466967_1118745 3300045976 Bacteria 785
105 Ga0466967_1299487 3300045976 Bacteria 724
106 Ga0495623_0044119 3300046679 Bacteria 2834
107 Ga0495604_0022216 3300047317 Bacteria 5064
108 Ga0495676_0626394 3300047321 Bacteria 699
109 Ga0495675_0089631 3300047444 Bacteria 1930
110 Ga0495685_093567 3300047447 Bacteria 995
111 Ga0495686_0442112 3300047472 Unclassified 692
112 Ga0496101_0068161 3300048904 Bacteria 2600
113 Ga0496108_0073917 3300048911 Bacteria 2878
114 Ga0496109_0025407 3300048912 Bacteria 5278
115 Ga0496109_1280138 3300048912 Bacteria 669
116 Ga0496110_0659921 3300048913 Bacteria 946
117 Ga0496112_0261234 3300048915 Bacteria 1681
118 Ga0496113_0017423 3300048916 Bacteria 4987
119 Ga0496114_0022112 3300048917 Bacteria 5180
120 Ga0496114_0543966 3300048917 Bacteria 1026
121 Ga0496114_0886990 3300048917 Bacteria 773
122 Ga0496114_1236954 3300048917 Bacteria 633
123 Ga0501031_0039344 3300049568 Bacteria 3085
124 Ga0501032_0072255 3300049569 Bacteria 2299
125 Ga0501032_0085623 3300049569 Bacteria 2095
126 Ga0501033_0035719 3300049570 Bacteria 3726
127 Ga0501033_0224974 3300049570 Bacteria 1334
128 Ga0501033_1134551 3300049570 Bacteria 519
129 Ga0501034_0003876 3300049571 Bacteria 16841
130 Ga0501034_0891894 3300049571 Bacteria 778
131 Ga0501036_0005536 3300049572 Bacteria 10244
132 Ga0501036_0042975 3300049572 Bacteria 3826
133 Ga0501036_0967597 3300049572 Bacteria 697
134 Ga0501037_0013413 3300049573 Bacteria 6036
135 Ga0501037_0791459 3300049573 Bacteria 626
136 Ga0501038_0009920 3300049574 Bacteria 8721
137 Ga0501039_0059716 3300049575 Bacteria 2953
138 Ga0501039_0064478 3300049575 Bacteria 2840
139 Ga0501039_0108612 3300049575 Bacteria 2168
140 Ga0501042_0000776 3300049578 Bacteria 17429
141 Ga0501042_0022285 3300049578 Bacteria 4425
142 Ga0501042_0769804 3300049578 Bacteria 700
143 Ga0501043_0095579 3300049579 Bacteria 2335
144 Ga0501043_0342005 3300049579 Bacteria 1138
145 Ga0501043_0453466 3300049579 Bacteria 963
146 Ga0501046_0000737 3300049580 Bacteria 31648
147 Ga0501046_0052800 3300049580 Bacteria 3202
148 Ga0501046_0061790 3300049580 Bacteria 2927
149 Ga0501047_0014424 3300049581 Bacteria 7514
150 Ga0501047_0156234 3300049581 Bacteria 2154
151 Ga0501048_0039801 3300049582 Bacteria 3370
152 Ga0501067_0002204 3300049583 Bacteria 10765
153 Ga0501067_0086091 3300049583 Bacteria 1744
154 Ga0501067_0232530 3300049583 Bacteria 1026
155 Ga0501068_0018431 3300049584 Bacteria 4043
156 Ga0501068_0120387 3300049584 Bacteria 1636
157 Ga0501069_0242029 3300049585 Bacteria 1051
158 Ga0501070_0424134 3300049586 Bacteria 1074
159 Ga0501070_1230319 3300049586 Bacteria 574
160 Ga0501074_0209525 3300049590 Bacteria 1389
161 Ga0501076_0976995 3300049592 Bacteria 698
162 Ga0501080_0031348 3300049742 Bacteria 4954
163 Ga0501083_0000003 3300049744 Bacteria 235949
164 Ga0501035_0001668 3300049822 Bacteria 22446
165 Ga0501035_0169839 3300049822 Bacteria 1884
166 Ga0501044_0008532 3300049823 Bacteria 11227
167 Ga0501044_0140211 3300049823 Bacteria 2406
168 Ga0501045_0110232 3300049824 Bacteria 2041
169 nmdc:mga03683_11666_c1 3300050489 Bacteria 3189
170 nmdc:mga03n38_124695_c1 3300050490 Bacteria 1270
171 nmdc:mga03n38_226577_c1 3300050490 Bacteria 978
172 nmdc:mga03n38_89606_c1 3300050490 Bacteria 1462
173 nmdc:mga00v17_1700_c1 3300050491 Bacteria 11457
174 nmdc:mga0yw44_1056986_c1 3300050492 Bacteria 549
175 nmdc:mga0yw44_12753_c1 3300050492 Bacteria 4395
176 nmdc:mga0yw44_36011_c1 3300050492 Bacteria 2914
177 nmdc:mga0yw44_444878_c1 3300050492 Bacteria 878
178 nmdc:mga0yw44_476137_c1 3300050492 Bacteria 847
179 nmdc:mga0yw44_77362_c1 3300050492 Bacteria 2078
180 nmdc:mga0yw44_78484_c1 3300050492 Bacteria 2065
181 nmdc:mga0yw44_872084_c1 3300050492 Bacteria 611
182 nmdc:mga0yw44_99329_c1 3300050492 Bacteria 1852
183 nmdc:mga06z11_186946_c1 3300050494 Bacteria 1197
184 nmdc:mga06z11_22571_c1 3300050494 Bacteria 2942
185 nmdc:mga06z11_285348_c1 3300050494 Bacteria 979
186 nmdc:mga06z11_510982_c1 3300050494 Bacteria 728
187 nmdc:mga07m45_45808_c1 3300050496 Bacteria 2456
188 nmdc:mga07m45_5065_c1 3300050496 Bacteria 6516
189 Ga0500644_0000129 3300053088 Bacteria 46233
190 Ga0500644_0113435 3300053088 Bacteria 1047
191 Ga0500556_0002576 3300053104 Bacteria 5719
192 Ga0500593_001395 3300053117 Bacteria 8687
193 Ga0501084_0595335 3300054114 Bacteria 934
194 Ga0590075_023564 3300059424 Bacteria 1543
195 Ga0501082_1322440 3300060353 Bacteria 630
196 Ga0466962_0022938 3300061719 Bacteria 3000
197 Ga0466962_0091196 3300061719 Bacteria 1460
198 Ga0530510_0268582 3300061734 Bacteria 1273
199 Ga0530510_0479196 3300061734 Bacteria 942
200 2643891649 2643221576 Bacteria 5214352
201 2643960697 2643221590 Bacteria 5214697
202 2644019142 2643221601 Bacteria 7493239
203 2644093910 2643221615 Bacteria 5487866
204 2644102317 2643221617 Bacteria 5139111
205 2644115541 2643221620 Bacteria 5134593
206 2644174044 2643221631 Bacteria 8168043
207 2644323754 2643221657 Bacteria 5490246
208 2676491293 2675903060 Bacteria 10051191
209 2738868101 2738541305 Bacteria 4910150
210 2812333169 2811994874 Bacteria 5367947
211 2856743273 2856741275 Bacteria 8096094
212 2873319292 2873314349 Bacteria 8512634
213 2884700703 2884693830 Bacteria 11273186
214 2891403636 2891395885 Bacteria 9251614
215 2891556116 2891554331 Bacteria 8812224
216 2891569403 2891562705 Bacteria 8039471
217 2895429167 2895427314 Bacteria 13147766
218 2895452580 2895442618 Bacteria 11027144
219 2984579941 2984576629 Bacteria 4248407
220 2990260380 2990256926 Bacteria 4252839
221 8055068504 8055066027 Bacteria 9479577
222 8055181466 8055172936 Bacteria 9305943
223 8056065462 8056060235 Bacteria 7259403
224 Ga0075365_10081198
225 Ga0070682_100454266
226 Ga0070692_10184242
227 Ga0070700_100053858
228 Ga0070708_100233008
229 Ga0070684_100228358
230 Ga0070684_101494120
231 Ga0068862_100379594
232 Ga0081455_10690481
233 Ga0081539_10066622
234 Ga0075365_10003255
235 Ga0075365_10029813
236 Ga0075365_10036944
237 Ga0075365_10039291
238 Ga0075365_10170191
239 Ga0075365_10271491
240 Ga0075365_10292833
241 Ga0075365_10511836
242 Ga0075365_10912632
243 Ga0075368_10003809
244 Ga0075368_10016120
245 Ga0075363_100013116
246 Ga0075363_100037848
247 Ga0075363_100146243
248 Ga0075364_10010807
249 Ga0075364_10054032
250 Ga0075362_10072177
251 Ga0075367_10038160
252 Ga0075369_10150522
253 Ga0075370_10006378
254 Ga0075370_10047628
255 Ga0068865_100403617
256 Ga0105243_11566568
257 Ga0157375_10116067
258 Ga0157380_11995854
259 Ga0163161_10751760
260 Ga0207647_10019014
261 Ga0207687_10335985
262 Ga0207708_10186787
263 Ga0207708_10739709
264 Ga0207675_100279237
265 Ga0207675_101212382
266 Ga0207683_10625690
267 Ga0307509_10097719
268 Ga0307410_10144708
269 Ga0307410_10644485
270 Ga0307407_10084044
271 Ga0307416_101173851
272 Ga0307415_100815166
273 Ga0307415_101050758
274 Ga0373931_0321353
275 Ga0395900_0048216
276 Ga0395900_0049218
277 Ga0395900_0600700
278 Ga0395900_0860389
279 Ga0395898_0276126
280 Ga0395898_0481799
281 Ga0395901_0080844
282 Ga0451791_1591045
283 Ga0451837_0503838
284 Ga0451837_0764297
285 Ga0451853_0668643
286 Ga0451853_2912123
287 Ga0451853_3247210
288 Ga0451853_3521264
289 Ga0450907_009675
290 Ga0466972_0197283
291 Ga0466972_0338826
292 Ga0466965_0050086
293 Ga0466965_0060336
294 Ga0466965_0068108
295 Ga0466965_0250184
296 Ga0466966_0010557
297 Ga0466966_0038632
298 Ga0466966_0660702
299 Ga0466961_0031236
300 Ga0466961_0079310
301 Ga0466961_0094432
302 Ga0466961_0127271
303 Ga0466963_0664641
304 Ga0466963_0788103
305 Ga0466964_0322347
306 Ga0466971_0009088
307 Ga0466971_0029068
308 Ga0466968_0093656
309 Ga0466970_0002538
310 Ga0466970_0005343
311 Ga0466970_0025966
312 Ga0466970_0248845
313 Ga0466957_0004764
314 Ga0466957_0057477
315 Ga0466957_0100657
316 Ga0466957_0607840
317 Ga0466960_0000559
318 Ga0466960_0080915
319 Ga0466960_0227765
320 Ga0466960_0524526
321 Ga0466959_0183363
322 Ga0466958_0429372
323 Ga0466958_0438236
324 Ga0466958_0988475
325 Ga0466967_0163801
326 Ga0466967_1034043
327 Ga0466967_1118745
328 Ga0466967_1299487
329 Ga0495623_0044119
330 Ga0495604_0022216
331 Ga0495676_0626394
332 Ga0495675_0089631
333 Ga0495685_093567
334 Ga0495686_0442112
335 Ga0496101_0068161
336 Ga0496108_0073917
337 Ga0496109_0025407
338 Ga0496109_1280138
339 Ga0496110_0659921
340 Ga0496112_0261234
341 Ga0496113_0017423
342 Ga0496114_0022112
343 Ga0496114_0543966
344 Ga0496114_0886990
345 Ga0496114_1236954
346 Ga0501031_0039344
347 Ga0501032_0072255
348 Ga0501032_0085623
349 Ga0501033_0035719
350 Ga0501033_0224974
351 Ga0501033_1134551
352 Ga0501034_0003876
353 Ga0501034_0891894
354 Ga0501036_0005536
355 Ga0501036_0042975
356 Ga0501036_0967597
357 Ga0501037_0013413
358 Ga0501037_0791459
359 Ga0501038_0009920
360 Ga0501039_0059716
361 Ga0501039_0064478
362 Ga0501039_0108612
363 Ga0501042_0000776
364 Ga0501042_0022285
365 Ga0501042_0769804
366 Ga0501043_0095579
367 Ga0501043_0342005
368 Ga0501043_0453466
369 Ga0501046_0000737
370 Ga0501046_0052800
371 Ga0501046_0061790
372 Ga0501047_0014424
373 Ga0501047_0156234
374 Ga0501048_0039801
375 Ga0501067_0002204
376 Ga0501067_0086091
377 Ga0501067_0232530
378 Ga0501068_0018431
379 Ga0501068_0120387
380 Ga0501069_0242029
381 Ga0501070_0424134
382 Ga0501070_1230319
383 Ga0501074_0209525
384 Ga0501076_0976995
385 Ga0501080_0031348
386 Ga0501083_0000003
387 Ga0501035_0001668
388 Ga0501035_0169839
389 Ga0501044_0008532
390 Ga0501044_0140211
391 Ga0501045_0110232
392 nmdc:mga03683_11666_c1
393 nmdc:mga03n38_124695_c1
394 nmdc:mga03n38_226577_c1
395 nmdc:mga03n38_89606_c1
396 nmdc:mga00v17_1700_c1
397 nmdc:mga0yw44_1056986_c1
398 nmdc:mga0yw44_12753_c1
399 nmdc:mga0yw44_36011_c1
400 nmdc:mga0yw44_444878_c1
401 nmdc:mga0yw44_476137_c1
402 nmdc:mga0yw44_77362_c1
403 nmdc:mga0yw44_78484_c1
404 nmdc:mga0yw44_872084_c1
405 nmdc:mga0yw44_99329_c1
406 nmdc:mga06z11_186946_c1
407 nmdc:mga06z11_22571_c1
408 nmdc:mga06z11_285348_c1
409 nmdc:mga06z11_510982_c1
410 nmdc:mga07m45_45808_c1
411 nmdc:mga07m45_5065_c1
412 Ga0500644_0000129
413 Ga0500644_0113435
414 Ga0500556_0002576
415 Ga0500593_001395
416 Ga0501084_0595335
417 Ga0590075_023564
418 Ga0501082_1322440
419 Ga0466962_0022938
420 Ga0466962_0091196
421 Ga0530510_0268582
422 Ga0530510_0479196
423 2643891649
424 2643960697
425 2644019142
426 2644093910
427 2644102317
428 2644115541
429 2644174044
430 2644323754
431 2676491293
432 2738868101
433 2812333169
434 2856743273
435 2873319292
436 2884700703
437 2891403636
438 2891556116
439 2891569403
440 2895429167
441 2895452580
442 2984579941
443 2990260380
444 8055068504
445 8055181466
446 8056065462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

23

159

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ess-assembly1.cif.gz_A structure-guided studies of the holliday junction resolvase ruvx provide novel insights into atp-stimulated cleavage of branched dna and rna substrates 0.8772 3 142
7ess-assembly1.cif.gz_B structure-guided studies of the holliday junction resolvase ruvx provide novel insights into atp-stimulated cleavage of branched dna and rna substrates 0.8692 3 142
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8586 4 135
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8531 4 136
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8328 4 135
ID Description Score Start End Superfamily
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.9156 4 141 3.30.420.140
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8874 7 137 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.885 4 141 3.30.420.140
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8567 7 137 3.30.420.140
af_Q8GYR7_22_166_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8552 4 142 3.30.420.140
ID Description Score Start End GO Terms
AF-A0A838GQB7-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9874 1 151 GO:0000967
GO:0004518
GO:0005829
AF-A0A7W7R7G8-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9853 2 151 GO:0000967
GO:0004518
GO:0005829
AF-A0A838GQB7-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9809 1 151 GO:0000967
GO:0004518
GO:0005829
AF-F8UGW6-F1-model_v4 Resolvase holliday junction-type YqgF-like protein (EC 3.1.-.-) 0.9785 3 82 GO:0000967
GO:0004518
AF-A0A1M7QQF0-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9782 1 147 GO:0000967
GO:0004518
GO:0005829

Map