F335414

General Info

Members Datasets Scaffolds Average Seq Length
223 169 446 162

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10000013|Ga0081455_1000001364
Length 194
Sequence MRVVLRLAVRSPSAVDREFRTARPTDWHSGGVTTPVVDLRPPANLVSRKALLFWATRAAIGWVVVLGGEGVWLGLTGWFSLVVALIVTAALAIAHLAVMPQWRFRVHRWETTPQVVYTQSGWINQERRIAPVSRIQTVDTERGPLERLFGLANLTVTTASARGPVHIHGLDYEVAQRLTQELATQTQATPGDAT

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
158 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
159 2643221692 Nocardia sp. Root136 Isolate Unclassified
160 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
161 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
162 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
163 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
164 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
165 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
166 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
167 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
168 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
169 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.17
Metatranscriptomes 0
Isolates 5.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.87
Rhizosphere 78.92
Stem 0
Stem Tuber 0.45
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10000013 3300005937 Bacteria 196011
2 JGI24746J21847_1004795 3300001977 Bacteria 2125
3 JGI24751J29686_10014580 3300002459 Bacteria 1621
4 Ga0070676_10678298 3300005328 Bacteria 751
5 Ga0070683_100037791 3300005329 Bacteria 4421
6 Ga0070690_100126427 3300005330 Bacteria 1721
7 Ga0068869_100155946 3300005334 Bacteria 1774
8 Ga0068869_100212029 3300005334 Bacteria 1531
9 Ga0068868_100018930 3300005338 Bacteria 5154
10 Ga0068868_100148380 3300005338 Bacteria 1930
11 Ga0068868_101132707 3300005338 Bacteria 721
12 Ga0070660_100183756 3300005339 Bacteria 1692
13 Ga0070689_100097356 3300005340 Bacteria 2326
14 Ga0070691_10250401 3300005341 Bacteria 950
15 Ga0070692_10011131 3300005345 Bacteria 4122
16 Ga0070668_100001143 3300005347 Bacteria 18674
17 Ga0070668_100098892 3300005347 Bacteria 2309
18 Ga0070675_100666803 3300005354 Bacteria 946
19 Ga0070688_100199409 3300005365 Bacteria 1399
20 Ga0070659_100049728 3300005366 Bacteria 3297
21 Ga0070714_100591734 3300005435 Bacteria 1065
22 Ga0070701_10054494 3300005438 Bacteria 2085
23 Ga0070711_100017063 3300005439 Bacteria 4618
24 Ga0070705_100034134 3300005440 Bacteria 2842
25 Ga0070700_100501210 3300005441 Bacteria 934
26 Ga0070663_100030683 3300005455 Bacteria 3687
27 Ga0068867_100197829 3300005459 Bacteria 1607
28 Ga0070685_10011970 3300005466 Bacteria 4549
29 Ga0070698_101187413 3300005471 Bacteria 712
30 Ga0070684_100656134 3300005535 Bacteria 977
31 Ga0068853_101297617 3300005539 Bacteria 704
32 Ga0070695_100300195 3300005545 Bacteria 1187
33 Ga0070664_100250730 3300005564 Bacteria 1591
34 Ga0068856_100226290 3300005614 Bacteria 1886
35 Ga0068856_100433762 3300005614 Bacteria 1334
36 Ga0070702_100009582 3300005615 Bacteria 4747
37 Ga0068852_100060301 3300005616 Bacteria 3293
38 Ga0068852_100377871 3300005616 Bacteria 1389
39 Ga0068859_100461821 3300005617 Bacteria 1366
40 Ga0068861_100066879 3300005719 Bacteria 2771
41 Ga0068863_100410003 3300005841 Bacteria 1326
42 Ga0068858_100344091 3300005842 Bacteria 1428
43 Ga0068858_100713860 3300005842 Bacteria 976
44 Ga0068860_100858652 3300005843 Bacteria 923
45 Ga0068862_100017373 3300005844 Bacteria 5991
46 Ga0068862_100090788 3300005844 Bacteria 2659
47 Ga0081455_10123059 3300005937 Bacteria 2041
48 Ga0081540_1002257 3300005983 Bacteria 15853
49 Ga0081539_10017788 3300005985 Bacteria 4968
50 Ga0070715_10294059 3300006163 Bacteria 866
51 Ga0070712_100094566 3300006175 Bacteria 2196
52 Ga0075430_100434886 3300006846 Bacteria 1083
53 Ga0075433_10502074 3300006852 Bacteria 1068
54 Ga0068865_100049125 3300006881 Bacteria 2906
55 Ga0097620_100461834 3300006931 Bacteria 1366
56 Ga0075435_100722848 3300007076 Bacteria 866
57 Ga0105245_10035932 3300009098 Bacteria 4399
58 Ga0105245_10054739 3300009098 Bacteria 3583
59 Ga0105245_11240421 3300009098 Bacteria 794
60 Ga0105247_10357593 3300009101 Bacteria 1029
61 Ga0105243_10003019 3300009148 Bacteria 13880
62 Ga0105243_10011967 3300009148 Bacteria 6558
63 Ga0105243_10014461 3300009148 Bacteria 5974
64 Ga0105237_10330323 3300009545 Bacteria 1529
65 Ga0105249_10048869 3300009553 Bacteria 3857
66 Ga0105249_10927774 3300009553 Bacteria 938
67 Ga0157371_10383749 3300013102 Bacteria 1026
68 Ga0157369_11081622 3300013105 Bacteria 820
69 Ga0157374_10256813 3300013296 Bacteria 1720
70 Ga0157378_10043351 3300013297 Bacteria 3995
71 Ga0157378_10337494 3300013297 Bacteria 1468
72 Ga0163162_10176965 3300013306 Bacteria 2259
73 Ga0157372_10269465 3300013307 Bacteria 1978
74 Ga0157375_10291300 3300013308 Bacteria 1796
75 Ga0182008_10263033 3300014497 Bacteria 893
76 Ga0157377_10018899 3300014745 Bacteria 3592
77 Ga0157377_10315417 3300014745 Bacteria 1037
78 Ga0157379_10130759 3300014968 Bacteria 2259
79 Ga0157376_10844204 3300014969 Bacteria 931
80 Ga0163161_10169116 3300017792 Bacteria 1670
81 Ga0213876_10071107 3300021384 Bacteria 1838
82 Ga0213875_10000075 3300021388 Bacteria 117877
83 Ga0213875_10027026 3300021388 Bacteria 2730
84 Ga0207688_10012621 3300025901 Bacteria 4598
85 Ga0207643_10018248 3300025908 Bacteria 3842
86 Ga0207705_10447204 3300025909 Bacteria 1002
87 Ga0207695_10391746 3300025913 Bacteria 1274
88 Ga0207693_10218986 3300025915 Bacteria 1496
89 Ga0207663_10010133 3300025916 Bacteria 5002
90 Ga0207662_10106228 3300025918 Bacteria 1746
91 Ga0207657_10363724 3300025919 Bacteria 1140
92 Ga0207652_10449956 3300025921 Bacteria 1161
93 Ga0207694_11263657 3300025924 Bacteria 624
94 Ga0207659_10311529 3300025926 Bacteria 1296
95 Ga0207659_10468983 3300025926 Bacteria 1062
96 Ga0207687_10033695 3300025927 Bacteria 3475
97 Ga0207687_10034040 3300025927 Bacteria 3458
98 Ga0207664_10537315 3300025929 Bacteria 1048
99 Ga0207690_10217435 3300025932 Bacteria 1460
100 Ga0207709_10007249 3300025935 Bacteria 6185
101 Ga0207709_10018333 3300025935 Bacteria 3919
102 Ga0207709_10028469 3300025935 Bacteria 3231
103 Ga0207670_10205623 3300025936 Bacteria 1498
104 Ga0207670_10437410 3300025936 Bacteria 1052
105 Ga0207704_10049461 3300025938 Bacteria 2529
106 Ga0207704_10214588 3300025938 Bacteria 1419
107 Ga0207711_10169092 3300025941 Bacteria 1983
108 Ga0207689_10018183 3300025942 Bacteria 5935
109 Ga0207661_10050806 3300025944 Bacteria 3306
110 Ga0207661_10060711 3300025944 Bacteria 3052
111 Ga0207679_10087076 3300025945 Bacteria 2404
112 Ga0207712_10036563 3300025961 Bacteria 3345
113 Ga0207712_10064132 3300025961 Bacteria 2618
114 Ga0207712_10304772 3300025961 Bacteria 1309
115 Ga0207668_10025502 3300025972 Bacteria 3826
116 Ga0207668_10116727 3300025972 Bacteria 2013
117 Ga0207677_10165651 3300026023 Bacteria 1722
118 Ga0207703_10389594 3300026035 Bacteria 1291
119 Ga0207703_10840375 3300026035 Bacteria 878
120 Ga0207678_10004096 3300026067 Bacteria 13110
121 Ga0207678_10239827 3300026067 Bacteria 1553
122 Ga0207708_10032988 3300026075 Bacteria 3932
123 Ga0207708_10245120 3300026075 Bacteria 1442
124 Ga0207702_10787173 3300026078 Bacteria 940
125 Ga0207702_11222998 3300026078 Bacteria 745
126 Ga0207641_10567286 3300026088 Bacteria 1108
127 Ga0207648_10051794 3300026089 Bacteria 3588
128 Ga0207674_10034646 3300026116 Bacteria 5275
129 Ga0207674_10739747 3300026116 Bacteria 949
130 Ga0207675_100093395 3300026118 Bacteria 2830
131 Ga0207675_101124788 3300026118 Bacteria 805
132 Ga0207683_11035179 3300026121 Bacteria 762
133 Ga0207698_10153914 3300026142 Bacteria 2000
134 Ga0207698_10319837 3300026142 Bacteria 1453
135 Ga0268265_10110223 3300028380 Bacteria 2245
136 Ga0268265_10140369 3300028380 Bacteria 2022
137 Ga0268265_11759077 3300028380 Bacteria 626
138 Ga0307515_10047695 3300028794 Bacteria 6502
139 Ga0307513_10004780 3300031456 Bacteria 17987
140 Ga0307509_10112335 3300031507 Bacteria 2725
141 Ga0307413_10014011 3300031824 Bacteria 4056
142 Ga0307507_10021747 3300033179 Bacteria 7120
143 Ga0307507_10028151 3300033179 Bacteria 5997
144 Ga0307510_10109622 3300033180 Bacteria 2508
145 Ga0373961_0129923 3300035241 Bacteria 843
146 Ga0395900_1356042 3300037418 Bacteria 625
147 Ga0436364_0059380 3300037853 Bacteria 21059
148 Ga0436364_0116250 3300037853 Bacteria 3579
149 Ga0436364_0899816 3300037853 Bacteria 74519
150 Ga0395901_0092920 3300038443 Bacteria 3158
151 Ga0436365_1708144 3300039437 Bacteria 2314
152 Ga0436362_0967422 3300039453 Bacteria 734
153 Ga0439448_0176732 3300042005 Bacteria 746
154 Ga0439440_0053452 3300042993 Bacteria 1015
155 Ga0466969_0121633 3300044656 Bacteria 1215
156 Ga0466972_0079956 3300044658 Bacteria 1556
157 Ga0466965_0026376 3300044683 Bacteria 2817
158 Ga0466965_0055075 3300044683 Bacteria 1979
159 Ga0466966_0001846 3300044684 Bacteria 13733
160 Ga0466966_0214867 3300044684 Bacteria 1162
161 Ga0466961_0275669 3300044693 Bacteria 1030
162 Ga0466963_0003929 3300044694 Bacteria 8593
163 Ga0466963_0872709 3300044694 Bacteria 634
164 Ga0466964_0179143 3300044706 Bacteria 1004
165 Ga0466971_0007819 3300044719 Bacteria 4659
166 Ga0466968_0072313 3300044735 Bacteria 1503
167 Ga0466970_0013804 3300044765 Bacteria 4142
168 Ga0466970_0637331 3300044765 Bacteria 619
169 Ga0466957_0003591 3300044842 Bacteria 8554
170 Ga0466960_0050815 3300044901 Bacteria 2000
171 Ga0466960_0056996 3300044901 Bacteria 1904
172 Ga0466959_0016970 3300045049 Bacteria 5329
173 Ga0466958_0000930 3300045836 Bacteria 13194
174 Ga0466967_0081315 3300045976 Bacteria 2926
175 Ga0466967_0958599 3300045976 Bacteria 851
176 Ga0495626_0198355 3300048091 Bacteria 824
177 Ga0496102_0203835 3300048905 Bacteria 1864
178 Ga0496103_0023006 3300048906 Bacteria 3756
179 Ga0496104_0268231 3300048907 Bacteria 1619
180 Ga0496104_1065755 3300048907 Bacteria 712
181 Ga0496105_0051932 3300048908 Bacteria 3385
182 Ga0496106_0077211 3300048909 Bacteria 2554
183 Ga0496106_0252347 3300048909 Bacteria 1410
184 Ga0496106_0623896 3300048909 Bacteria 862
185 Ga0496107_0172115 3300048910 Bacteria 1607
186 Ga0496108_0213945 3300048911 Bacteria 1673
187 Ga0496108_0249814 3300048911 Bacteria 1543
188 Ga0496108_0620372 3300048911 Bacteria 941
189 Ga0496109_0111222 3300048912 Bacteria 2547
190 Ga0496110_0399135 3300048913 Bacteria 1254
191 Ga0496111_0266443 3300048914 Bacteria 1271
192 Ga0496112_0341272 3300048915 Bacteria 1441
193 Ga0496112_0571545 3300048915 Bacteria 1063
194 Ga0496113_0341673 3300048916 Bacteria 1200
195 Ga0496113_0499597 3300048916 Bacteria 976
196 Ga0496113_0626498 3300048916 Bacteria 861
197 Ga0496113_1219335 3300048916 Bacteria 587
198 Ga0496115_0134923 3300048918 Bacteria 2035
199 Ga0496126_0377917 3300048929 Bacteria 1154
200 Ga0501034_1260307 3300049571 Bacteria 617
201 Ga0501038_0007520 3300049574 Bacteria 10046
202 Ga0501071_0346512 3300049587 Bacteria 1130
203 Ga0501035_0480062 3300049822 Bacteria 1025
204 Ga0501044_0181188 3300049823 Bacteria 2073
205 nmdc:mga0qj67_172134_c1 3300050509 Bacteria 1758
206 nmdc:mga0rr50_474270_c1 3300050513 Bacteria 1062
207 nmdc:mga0a205_365117_c1 3300050515 Bacteria 1310
208 Ga0501084_1264213 3300054114 Bacteria 619
209 Ga0501082_0279416 3300060353 Bacteria 1453
210 Ga0466962_0003915 3300061719 Bacteria 7120
211 2552110373 2551306166 Bacteria 9731570
212 2644463456 2643221682 Bacteria 6743283
213 2644513712 2643221692 Bacteria 7282860
214 2739203942 2738543005 Bacteria 5278128
215 2816422630 2816332119 Bacteria 8120218
216 2899370229 2899370129 Bacteria 6781179
217 2917740246 2917736166 Bacteria 9690793
218 2974318239 2974315732 Bacteria 4602776
219 2984526451 2984523437 Bacteria 4508481
220 8003318523 8003314358 Bacteria 10575343
221 8033686217 8033684223 Bacteria 6906479
222 8055071047 8055066027 Bacteria 9479577
223 8055180281 8055172936 Bacteria 9305943
224 Ga0081455_10000013
225 JGI24746J21847_1004795
226 JGI24751J29686_10014580
227 Ga0070676_10678298
228 Ga0070683_100037791
229 Ga0070690_100126427
230 Ga0068869_100155946
231 Ga0068869_100212029
232 Ga0068868_100018930
233 Ga0068868_100148380
234 Ga0068868_101132707
235 Ga0070660_100183756
236 Ga0070689_100097356
237 Ga0070691_10250401
238 Ga0070692_10011131
239 Ga0070668_100001143
240 Ga0070668_100098892
241 Ga0070675_100666803
242 Ga0070688_100199409
243 Ga0070659_100049728
244 Ga0070714_100591734
245 Ga0070701_10054494
246 Ga0070711_100017063
247 Ga0070705_100034134
248 Ga0070700_100501210
249 Ga0070663_100030683
250 Ga0068867_100197829
251 Ga0070685_10011970
252 Ga0070698_101187413
253 Ga0070684_100656134
254 Ga0068853_101297617
255 Ga0070695_100300195
256 Ga0070664_100250730
257 Ga0068856_100226290
258 Ga0068856_100433762
259 Ga0070702_100009582
260 Ga0068852_100060301
261 Ga0068852_100377871
262 Ga0068859_100461821
263 Ga0068861_100066879
264 Ga0068863_100410003
265 Ga0068858_100344091
266 Ga0068858_100713860
267 Ga0068860_100858652
268 Ga0068862_100017373
269 Ga0068862_100090788
270 Ga0081455_10123059
271 Ga0081540_1002257
272 Ga0081539_10017788
273 Ga0070715_10294059
274 Ga0070712_100094566
275 Ga0075430_100434886
276 Ga0075433_10502074
277 Ga0068865_100049125
278 Ga0097620_100461834
279 Ga0075435_100722848
280 Ga0105245_10035932
281 Ga0105245_10054739
282 Ga0105245_11240421
283 Ga0105247_10357593
284 Ga0105243_10003019
285 Ga0105243_10011967
286 Ga0105243_10014461
287 Ga0105237_10330323
288 Ga0105249_10048869
289 Ga0105249_10927774
290 Ga0157371_10383749
291 Ga0157369_11081622
292 Ga0157374_10256813
293 Ga0157378_10043351
294 Ga0157378_10337494
295 Ga0163162_10176965
296 Ga0157372_10269465
297 Ga0157375_10291300
298 Ga0182008_10263033
299 Ga0157377_10018899
300 Ga0157377_10315417
301 Ga0157379_10130759
302 Ga0157376_10844204
303 Ga0163161_10169116
304 Ga0213876_10071107
305 Ga0213875_10000075
306 Ga0213875_10027026
307 Ga0207688_10012621
308 Ga0207643_10018248
309 Ga0207705_10447204
310 Ga0207695_10391746
311 Ga0207693_10218986
312 Ga0207663_10010133
313 Ga0207662_10106228
314 Ga0207657_10363724
315 Ga0207652_10449956
316 Ga0207694_11263657
317 Ga0207659_10311529
318 Ga0207659_10468983
319 Ga0207687_10033695
320 Ga0207687_10034040
321 Ga0207664_10537315
322 Ga0207690_10217435
323 Ga0207709_10007249
324 Ga0207709_10018333
325 Ga0207709_10028469
326 Ga0207670_10205623
327 Ga0207670_10437410
328 Ga0207704_10049461
329 Ga0207704_10214588
330 Ga0207711_10169092
331 Ga0207689_10018183
332 Ga0207661_10050806
333 Ga0207661_10060711
334 Ga0207679_10087076
335 Ga0207712_10036563
336 Ga0207712_10064132
337 Ga0207712_10304772
338 Ga0207668_10025502
339 Ga0207668_10116727
340 Ga0207677_10165651
341 Ga0207703_10389594
342 Ga0207703_10840375
343 Ga0207678_10004096
344 Ga0207678_10239827
345 Ga0207708_10032988
346 Ga0207708_10245120
347 Ga0207702_10787173
348 Ga0207702_11222998
349 Ga0207641_10567286
350 Ga0207648_10051794
351 Ga0207674_10034646
352 Ga0207674_10739747
353 Ga0207675_100093395
354 Ga0207675_101124788
355 Ga0207683_11035179
356 Ga0207698_10153914
357 Ga0207698_10319837
358 Ga0268265_10110223
359 Ga0268265_10140369
360 Ga0268265_11759077
361 Ga0307515_10047695
362 Ga0307513_10004780
363 Ga0307509_10112335
364 Ga0307413_10014011
365 Ga0307507_10021747
366 Ga0307507_10028151
367 Ga0307510_10109622
368 Ga0373961_0129923
369 Ga0395900_1356042
370 Ga0436364_0059380
371 Ga0436364_0116250
372 Ga0436364_0899816
373 Ga0395901_0092920
374 Ga0436365_1708144
375 Ga0436362_0967422
376 Ga0439448_0176732
377 Ga0439440_0053452
378 Ga0466969_0121633
379 Ga0466972_0079956
380 Ga0466965_0026376
381 Ga0466965_0055075
382 Ga0466966_0001846
383 Ga0466966_0214867
384 Ga0466961_0275669
385 Ga0466963_0003929
386 Ga0466963_0872709
387 Ga0466964_0179143
388 Ga0466971_0007819
389 Ga0466968_0072313
390 Ga0466970_0013804
391 Ga0466970_0637331
392 Ga0466957_0003591
393 Ga0466960_0050815
394 Ga0466960_0056996
395 Ga0466959_0016970
396 Ga0466958_0000930
397 Ga0466967_0081315
398 Ga0466967_0958599
399 Ga0495626_0198355
400 Ga0496102_0203835
401 Ga0496103_0023006
402 Ga0496104_0268231
403 Ga0496104_1065755
404 Ga0496105_0051932
405 Ga0496106_0077211
406 Ga0496106_0252347
407 Ga0496106_0623896
408 Ga0496107_0172115
409 Ga0496108_0213945
410 Ga0496108_0249814
411 Ga0496108_0620372
412 Ga0496109_0111222
413 Ga0496110_0399135
414 Ga0496111_0266443
415 Ga0496112_0341272
416 Ga0496112_0571545
417 Ga0496113_0341673
418 Ga0496113_0499597
419 Ga0496113_0626498
420 Ga0496113_1219335
421 Ga0496115_0134923
422 Ga0496126_0377917
423 Ga0501034_1260307
424 Ga0501038_0007520
425 Ga0501071_0346512
426 Ga0501035_0480062
427 Ga0501044_0181188
428 nmdc:mga0qj67_172134_c1
429 nmdc:mga0rr50_474270_c1
430 nmdc:mga0a205_365117_c1
431 Ga0501084_1264213
432 Ga0501082_0279416
433 Ga0466962_0003915
434 2552110373
435 2644463456
436 2644513712
437 2739203942
438 2816422630
439 2899370229
440 2917740246
441 2974318239
442 2984526451
443 8003318523
444 8033686217
445 8055071047
446 8055180281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03703

bPH_2

Bacterial PH domain

102

182

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yf0-assembly1.cif.gz_A-2 human myotubularin related protein 6 (mtmr6) 0.7945 73 152
2adz-assembly1.cif.gz_A solution structure of the joined ph domain of alpha1-syntrophin 0.7818 92 153
2cod-assembly1.cif.gz_A solution structure of the n-terminal ph domain of arap2 protein from human 0.7378 73 160
2al6-assembly2.cif.gz_B ferm domain of focal adhesion kinase 0.7325 73 160
7xsx-assembly1.cif.gz_j rna polymerase ii elongation complex transcribing a nucleosome (ec49) 0.7271 80 152
ID Description Score Start End Superfamily
af_O33223_7_176_3.90.320.10 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.9583 2 159 3.90.320.10
af_Q2FWI4_74_150_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9548 70 147 2.30.29.30
af_O33223_7_176_3.90.320.10 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.9409 2 159 3.90.320.10
af_Q2FWI4_74_150_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9314 70 147 2.30.29.30
af_O33222_395_466_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9191 71 140 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A0U1D7G2-F1-model_v4 Membrane flanked domain-containing protein 0.9602 1 144 GO:0016020
AF-A0A7K1H1Y1-F1-model_v4 YdbS-like PH domain-containing protein 0.9426 67 155 GO:0016020
AF-A0A6N9H9T8-F1-model_v4 PH domain-containing protein 0.9384 67 155 GO:0016020
AF-A0A429BTP9-F1-model_v4 YdbS-like PH domain-containing protein 0.9225 1 160 GO:0016020
AF-A0A429BTP9-F1-model_v4 YdbS-like PH domain-containing protein 0.917 1 160 GO:0016020

Map