F335410

General Info

Members Datasets Scaffolds Average Seq Length
223 137 446 285

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100374546|Ga0068860_1003745462
Length 304
Sequence MDPGERATSSYRSRRFTRINADMKLILVLVVCLVVNIAVQAQSPLQEMVKTEQAFSKMAEEKNARDAFMAFIADDGLLFRPGAVNGKKWMSEHPVPPPKNPDKKPLLAWQPSFAGMSASGDMGFTTGPWEAKEDIKDEKPQAYGHFMTVWKKQTDGSWKFVVDLGISHPQSGGPQTLWQPADAKMPSFKPVNVAAATEELLTRDRKFNFASYASPDVRLYRIGNLPYIGKQAAVEALAKNKGHVTWQPIGGDVSRAGDLGYTHGTYEVADDTKNVTEHGSYVRIWQKQGVEWRIVMDVTNAHPK

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
122 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
123 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
124 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
125 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
126 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
127 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
128 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
129 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
130 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
131 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
132 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.79
Rhizosphere 96.86
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100374546 3300005843 Bacteria 1405
2 CNAas_1001272 3300000532 Unclassified 2216
3 JGI24751J29686_10000011 3300002459 Bacteria 117978
4 rootL2_10195901 3300003322 Bacteria 1897
5 Ga0065714_10064575 3300005288 Bacteria 33064
6 Ga0065712_10000114 3300005290 Bacteria 191810
7 Ga0065712_10073073 3300005290 Bacteria 4513
8 Ga0065715_10011201 3300005293 Bacteria 3438
9 Ga0065715_10089469 3300005293 Bacteria 9986
10 Ga0065715_10092475 3300005293 Bacteria 5107
11 Ga0065715_10167615 3300005293 Bacteria 1573
12 Ga0065715_10245507 3300005293 Bacteria 1169
13 Ga0070690_100196640 3300005330 Bacteria 1401
14 Ga0070670_100000295 3300005331 Bacteria 43851
15 Ga0070670_100186824 3300005331 Bacteria 1799
16 Ga0068869_100024824 3300005334 Bacteria 4155
17 Ga0068869_100223717 3300005334 Bacteria 1493
18 Ga0070680_100271416 3300005336 Bacteria 1436
19 Ga0070682_100027827 3300005337 Unclassified 3395
20 Ga0070682_100067254 3300005337 Bacteria 2282
21 Ga0070689_100000802 3300005340 Bacteria 19335
22 Ga0070674_100077893 3300005356 Bacteria 2361
23 Ga0070673_100197366 3300005364 Bacteria 1732
24 Ga0070659_100264112 3300005366 Bacteria 1429
25 Ga0070703_10018954 3300005406 Bacteria 1994
26 Ga0070701_10030960 3300005438 Bacteria 2652
27 Ga0070705_100046434 3300005440 Bacteria 2504
28 Ga0070700_100000103 3300005441 Bacteria 53591
29 Ga0070700_100016670 3300005441 Bacteria 4187
30 Ga0070700_100047679 3300005441 Bacteria 2652
31 Ga0070700_100113178 3300005441 Bacteria 1807
32 Ga0070700_100128136 3300005441 Bacteria 1709
33 Ga0070694_100014588 3300005444 Bacteria 4919
34 Ga0070694_100172788 3300005444 Bacteria 1593
35 Ga0070662_100314608 3300005457 Bacteria 1275
36 Ga0068867_100051463 3300005459 Bacteria 3038
37 Ga0070706_100000001 3300005467 Bacteria 342302
38 Ga0070699_100008562 3300005518 Bacteria 8862
39 Ga0070695_100297536 3300005545 Bacteria 1192
40 Ga0070696_100011021 3300005546 Bacteria 6054
41 Ga0070696_100169310 3300005546 Bacteria 1614
42 Ga0070693_100014270 3300005547 Bacteria 4067
43 Ga0070693_100029578 3300005547 Bacteria 2989
44 Ga0070704_100010753 3300005549 Bacteria 5578
45 Ga0070704_100052608 3300005549 Bacteria 2874
46 Ga0070704_100141680 3300005549 Bacteria 1878
47 Ga0070664_100331420 3300005564 Bacteria 1381
48 Ga0068857_100048927 3300005577 Bacteria 3751
49 Ga0068857_100286513 3300005577 Bacteria 1516
50 Ga0068857_100621948 3300005577 Bacteria 1022
51 Ga0068854_100478914 3300005578 Bacteria 1045
52 Ga0070702_100276052 3300005615 Unclassified 1152
53 Ga0068852_100079441 3300005616 Bacteria 2906
54 Ga0068852_100181565 3300005616 Bacteria 1979
55 Ga0068859_100013561 3300005617 Bacteria 8172
56 Ga0068859_100017567 3300005617 Bacteria 7193
57 Ga0068859_100066527 3300005617 Bacteria 3639
58 Ga0068859_100123675 3300005617 Bacteria 2654
59 Ga0068859_100468961 3300005617 Bacteria 1355
60 Ga0068864_100034676 3300005618 Bacteria 4293
61 Ga0068864_100065922 3300005618 Bacteria 3142
62 Ga0068864_100151541 3300005618 Bacteria 2101
63 Ga0068864_100244510 3300005618 Bacteria 1663
64 Ga0068861_100354094 3300005719 Bacteria 1289
65 Ga0068851_10004085 3300005834 Bacteria 6558
66 Ga0068870_10010182 3300005840 Bacteria 4306
67 Ga0068863_100025949 3300005841 Bacteria 5591
68 Ga0068863_100050201 3300005841 Bacteria 3955
69 Ga0068863_100628427 3300005841 Bacteria 1064
70 Ga0068858_100033967 3300005842 Bacteria 4731
71 Ga0068858_100073440 3300005842 Bacteria 3174
72 Ga0068858_100093675 3300005842 Bacteria 2796
73 Ga0068858_100150024 3300005842 Bacteria 2191
74 Ga0068860_100013630 3300005843 Bacteria 7968
75 Ga0068862_100147074 3300005844 Bacteria 2095
76 Ga0068862_100306875 3300005844 Bacteria 1462
77 Ga0081539_10000413 3300005985 Bacteria 91117
78 Ga0070716_100011168 3300006173 Bacteria 4520
79 Ga0097621_100001200 3300006237 Bacteria 17937
80 Ga0097621_100183996 3300006237 Unclassified 1806
81 Ga0068871_100033051 3300006358 Bacteria 4092
82 Ga0075433_10060002 3300006852 Bacteria 3329
83 Ga0075433_10203139 3300006852 Bacteria 1762
84 Ga0075433_10235126 3300006852 Bacteria 1627
85 Ga0075433_10266148 3300006852 Unclassified 1519
86 Ga0075433_10329940 3300006852 Bacteria 1349
87 Ga0075434_100044930 3300006871 Bacteria 4381
88 Ga0075434_100079923 3300006871 Bacteria 3266
89 Ga0075434_100249391 3300006871 Bacteria 1794
90 Ga0075436_100020593 3300006914 Bacteria 4527
91 Ga0097620_100013559 3300006931 Bacteria 8172
92 Ga0097620_100017567 3300006931 Bacteria 7193
93 Ga0097620_100066527 3300006931 Bacteria 3639
94 Ga0097620_100123671 3300006931 Bacteria 2654
95 Ga0075435_100012562 3300007076 Bacteria 6273
96 Ga0105251_10025884 3300009011 Bacteria 2994
97 Ga0111539_10014305 3300009094 Bacteria 9908
98 Ga0111539_10099998 3300009094 Bacteria 3405
99 Ga0111539_10561308 3300009094 Bacteria 1329
100 Ga0105247_10001637 3300009101 Bacteria 15835
101 Ga0105247_10213798 3300009101 Bacteria 1302
102 Ga0114129_10239035 3300009147 Bacteria 2442
103 Ga0105243_10001165 3300009148 Bacteria 23834
104 Ga0105241_10198008 3300009174 Bacteria 1676
105 Ga0105241_10233346 3300009174 Bacteria 1552
106 Ga0105242_10405797 3300009176 Bacteria 1273
107 Ga0105248_10013068 3300009177 Bacteria 9147
108 Ga0105237_10002156 3300009545 Bacteria 24760
109 Ga0105238_10011841 3300009551 Bacteria 8787
110 Ga0105238_10025525 3300009551 Bacteria 6024
111 Ga0105249_10002537 3300009553 Bacteria 15802
112 Ga0105249_10184372 3300009553 Bacteria 2033
113 Ga0105239_10180789 3300010375 Bacteria 2360
114 Ga0105246_10124645 3300011119 Bacteria 1915
115 Ga0157373_10046775 3300013100 Bacteria 3087
116 Ga0157373_10067521 3300013100 Bacteria 2528
117 Ga0157373_10210546 3300013100 Bacteria 1371
118 Ga0157373_10284108 3300013100 Bacteria 1173
119 Ga0163162_10097593 3300013306 Bacteria 3027
120 Ga0163162_10100955 3300013306 Bacteria 2977
121 Ga0157372_10006550 3300013307 Bacteria 12389
122 Ga0157375_10026902 3300013308 Bacteria 5369
123 Ga0157375_10116498 3300013308 Bacteria 2776
124 Ga0163163_10001637 3300014325 Bacteria 18849
125 Ga0163163_10133906 3300014325 Bacteria 2519
126 Ga0163163_10199101 3300014325 Bacteria 2051
127 Ga0157380_10148458 3300014326 Unclassified 2023
128 Ga0157380_10296862 3300014326 Bacteria 1486
129 Ga0157379_10086216 3300014968 Bacteria 2815
130 Ga0157376_10348137 3300014969 Unclassified 1417
131 Ga0163161_10589828 3300017792 Unclassified 915
132 Ga0213875_10017063 3300021388 Bacteria 3513
133 Ga0207656_10002556 3300025321 Bacteria 6155
134 Ga0207710_10001401 3300025900 Bacteria 12075
135 Ga0207647_10026167 3300025904 Bacteria 3820
136 Ga0207643_10014144 3300025908 Bacteria 4332
137 Ga0207643_10021913 3300025908 Bacteria 3515
138 Ga0207643_10025998 3300025908 Bacteria 3239
139 Ga0207643_10143958 3300025908 Bacteria 1425
140 Ga0207684_10000030 3300025910 Bacteria 300037
141 Ga0207671_10003800 3300025914 Bacteria 14811
142 Ga0207660_10208928 3300025917 Bacteria 1528
143 Ga0207694_10007364 3300025924 Bacteria 8348
144 Ga0207694_10033726 3300025924 Bacteria 3922
145 Ga0207650_10000001 3300025925 Bacteria 1545726
146 Ga0207650_10236763 3300025925 Bacteria 1474
147 Ga0207650_10310002 3300025925 Bacteria 1291
148 Ga0207706_10322377 3300025933 Bacteria 1345
149 Ga0207709_10000786 3300025935 Bacteria 24857
150 Ga0207670_10000663 3300025936 Bacteria 18187
151 Ga0207670_10203083 3300025936 Bacteria 1507
152 Ga0207670_10262607 3300025936 Bacteria 1339
153 Ga0207670_10296845 3300025936 Bacteria 1264
154 Ga0207669_10478075 3300025937 Bacteria 992
155 Ga0207665_10018956 3300025939 Bacteria 4521
156 Ga0207711_10007906 3300025941 Bacteria 8895
157 Ga0207711_10012392 3300025941 Bacteria 7087
158 Ga0207711_10090848 3300025941 Bacteria 2685
159 Ga0207711_10102089 3300025941 Bacteria 2539
160 Ga0207711_10573517 3300025941 Bacteria 1052
161 Ga0207689_10067644 3300025942 Bacteria 2936
162 Ga0207689_10254673 3300025942 Bacteria 1452
163 Ga0207689_10281260 3300025942 Bacteria 1378
164 Ga0207667_10226549 3300025949 Bacteria 1915
165 Ga0207651_10090232 3300025960 Bacteria 2240
166 Ga0207712_10031370 3300025961 Bacteria 3579
167 Ga0207640_10123254 3300025981 Bacteria 1861
168 Ga0207703_10093759 3300026035 Bacteria 2529
169 Ga0207703_10093904 3300026035 Bacteria 2528
170 Ga0207708_10000224 3300026075 Bacteria 44906
171 Ga0207708_10002850 3300026075 Bacteria 12721
172 Ga0207708_10071670 3300026075 Bacteria 2655
173 Ga0207708_10090233 3300026075 Bacteria 2362
174 Ga0207708_10216067 3300026075 Bacteria 1534
175 Ga0207641_10018800 3300026088 Bacteria 5666
176 Ga0207648_10273031 3300026089 Bacteria 1511
177 Ga0207676_10023494 3300026095 Bacteria 4549
178 Ga0207676_10067530 3300026095 Bacteria 2856
179 Ga0207675_100145756 3300026118 Bacteria 2251
180 Ga0207698_10052460 3300026142 Bacteria 3124
181 Ga0207698_10155407 3300026142 Bacteria 1992
182 Ga0207698_10624614 3300026142 Bacteria 1064
183 Ga0207428_10004711 3300027907 Bacteria 12900
184 Ga0268265_10448167 3300028380 Bacteria 1205
185 Ga0268264_10031965 3300028381 Bacteria 4317
186 Ga0307408_100031024 3300031548 Bacteria 3717
187 Ga0307408_100058769 3300031548 Bacteria 2797
188 Ga0307405_10045049 3300031731 Bacteria 2701
189 Ga0307406_10036589 3300031901 Bacteria 3025
190 Ga0307414_10113814 3300032004 Bacteria 2066
191 Ga0307411_10333386 3300032005 Bacteria 1230
192 Ga0307415_100145365 3300032126 Bacteria 1817
193 Ga0307415_100166064 3300032126 Bacteria 1716
194 Ga0373951_0005035 3300035091 Bacteria 3093
195 Ga0395900_0665244 3300037418 Bacteria 977
196 Ga0436364_0563404 3300037853 Bacteria 14494
197 Ga0242420_011552 3300038996 Bacteria 1484
198 Ga0439448_0003115 3300042005 Bacteria 4569
199 Ga0451576_0301310 3300045051 Bacteria 1677
200 Ga0496106_0033484 3300048909 Bacteria 3834
201 Ga0496108_0158099 3300048911 Bacteria 1958
202 Ga0496110_0378277 3300048913 Bacteria 1290
203 Ga0496113_0141267 3300048916 Bacteria 1895
204 Ga0501292_018532 3300049515 Bacteria 1108
205 Ga0501199_007559 3300049650 Bacteria 1126
206 Ga0501202_007298 3300049652 Bacteria 1996
207 Ga0501217_004384 3300049661 Bacteria 2897
208 Ga0501217_033440 3300049661 Bacteria 1277
209 Ga0501223_005709 3300049663 Bacteria 2602
210 Ga0501227_005085 3300049665 Bacteria 2823
211 Ga0501227_007324 3300049665 Bacteria 2362
212 Ga0501230_006211 3300049667 Bacteria 1724
213 Ga0501235_005218 3300049669 Bacteria 2825
214 Ga0501236_013039 3300049670 Bacteria 1131
215 Ga0501249_018553 3300049679 Bacteria 1506
216 Ga0501212_018333 3300049851 Bacteria 1065
217 Ga0501226_006564 3300049853 Bacteria 1317
218 nmdc:mga08y16_11917_c1 3300050511 Bacteria 9132
219 nmdc:mga08y16_221723_c1 3300050511 Bacteria 1957
220 nmdc:mga0n895_154837_c1 3300050512 Bacteria 2322
221 nmdc:mga0rr50_470604_c1 3300050513 Bacteria 1067
222 nmdc:mga08x19_8066_c1 3300050514 Bacteria 6256
223 nmdc:mga0a205_421627_c1 3300050515 Bacteria 1196
224 Ga0068860_100374546
225 CNAas_1001272
226 JGI24751J29686_10000011
227 rootL2_10195901
228 Ga0065714_10064575
229 Ga0065712_10000114
230 Ga0065712_10073073
231 Ga0065715_10011201
232 Ga0065715_10089469
233 Ga0065715_10092475
234 Ga0065715_10167615
235 Ga0065715_10245507
236 Ga0070690_100196640
237 Ga0070670_100000295
238 Ga0070670_100186824
239 Ga0068869_100024824
240 Ga0068869_100223717
241 Ga0070680_100271416
242 Ga0070682_100027827
243 Ga0070682_100067254
244 Ga0070689_100000802
245 Ga0070674_100077893
246 Ga0070673_100197366
247 Ga0070659_100264112
248 Ga0070703_10018954
249 Ga0070701_10030960
250 Ga0070705_100046434
251 Ga0070700_100000103
252 Ga0070700_100016670
253 Ga0070700_100047679
254 Ga0070700_100113178
255 Ga0070700_100128136
256 Ga0070694_100014588
257 Ga0070694_100172788
258 Ga0070662_100314608
259 Ga0068867_100051463
260 Ga0070706_100000001
261 Ga0070699_100008562
262 Ga0070695_100297536
263 Ga0070696_100011021
264 Ga0070696_100169310
265 Ga0070693_100014270
266 Ga0070693_100029578
267 Ga0070704_100010753
268 Ga0070704_100052608
269 Ga0070704_100141680
270 Ga0070664_100331420
271 Ga0068857_100048927
272 Ga0068857_100286513
273 Ga0068857_100621948
274 Ga0068854_100478914
275 Ga0070702_100276052
276 Ga0068852_100079441
277 Ga0068852_100181565
278 Ga0068859_100013561
279 Ga0068859_100017567
280 Ga0068859_100066527
281 Ga0068859_100123675
282 Ga0068859_100468961
283 Ga0068864_100034676
284 Ga0068864_100065922
285 Ga0068864_100151541
286 Ga0068864_100244510
287 Ga0068861_100354094
288 Ga0068851_10004085
289 Ga0068870_10010182
290 Ga0068863_100025949
291 Ga0068863_100050201
292 Ga0068863_100628427
293 Ga0068858_100033967
294 Ga0068858_100073440
295 Ga0068858_100093675
296 Ga0068858_100150024
297 Ga0068860_100013630
298 Ga0068862_100147074
299 Ga0068862_100306875
300 Ga0081539_10000413
301 Ga0070716_100011168
302 Ga0097621_100001200
303 Ga0097621_100183996
304 Ga0068871_100033051
305 Ga0075433_10060002
306 Ga0075433_10203139
307 Ga0075433_10235126
308 Ga0075433_10266148
309 Ga0075433_10329940
310 Ga0075434_100044930
311 Ga0075434_100079923
312 Ga0075434_100249391
313 Ga0075436_100020593
314 Ga0097620_100013559
315 Ga0097620_100017567
316 Ga0097620_100066527
317 Ga0097620_100123671
318 Ga0075435_100012562
319 Ga0105251_10025884
320 Ga0111539_10014305
321 Ga0111539_10099998
322 Ga0111539_10561308
323 Ga0105247_10001637
324 Ga0105247_10213798
325 Ga0114129_10239035
326 Ga0105243_10001165
327 Ga0105241_10198008
328 Ga0105241_10233346
329 Ga0105242_10405797
330 Ga0105248_10013068
331 Ga0105237_10002156
332 Ga0105238_10011841
333 Ga0105238_10025525
334 Ga0105249_10002537
335 Ga0105249_10184372
336 Ga0105239_10180789
337 Ga0105246_10124645
338 Ga0157373_10046775
339 Ga0157373_10067521
340 Ga0157373_10210546
341 Ga0157373_10284108
342 Ga0163162_10097593
343 Ga0163162_10100955
344 Ga0157372_10006550
345 Ga0157375_10026902
346 Ga0157375_10116498
347 Ga0163163_10001637
348 Ga0163163_10133906
349 Ga0163163_10199101
350 Ga0157380_10148458
351 Ga0157380_10296862
352 Ga0157379_10086216
353 Ga0157376_10348137
354 Ga0163161_10589828
355 Ga0213875_10017063
356 Ga0207656_10002556
357 Ga0207710_10001401
358 Ga0207647_10026167
359 Ga0207643_10014144
360 Ga0207643_10021913
361 Ga0207643_10025998
362 Ga0207643_10143958
363 Ga0207684_10000030
364 Ga0207671_10003800
365 Ga0207660_10208928
366 Ga0207694_10007364
367 Ga0207694_10033726
368 Ga0207650_10000001
369 Ga0207650_10236763
370 Ga0207650_10310002
371 Ga0207706_10322377
372 Ga0207709_10000786
373 Ga0207670_10000663
374 Ga0207670_10203083
375 Ga0207670_10262607
376 Ga0207670_10296845
377 Ga0207669_10478075
378 Ga0207665_10018956
379 Ga0207711_10007906
380 Ga0207711_10012392
381 Ga0207711_10090848
382 Ga0207711_10102089
383 Ga0207711_10573517
384 Ga0207689_10067644
385 Ga0207689_10254673
386 Ga0207689_10281260
387 Ga0207667_10226549
388 Ga0207651_10090232
389 Ga0207712_10031370
390 Ga0207640_10123254
391 Ga0207703_10093759
392 Ga0207703_10093904
393 Ga0207708_10000224
394 Ga0207708_10002850
395 Ga0207708_10071670
396 Ga0207708_10090233
397 Ga0207708_10216067
398 Ga0207641_10018800
399 Ga0207648_10273031
400 Ga0207676_10023494
401 Ga0207676_10067530
402 Ga0207675_100145756
403 Ga0207698_10052460
404 Ga0207698_10155407
405 Ga0207698_10624614
406 Ga0207428_10004711
407 Ga0268265_10448167
408 Ga0268264_10031965
409 Ga0307408_100031024
410 Ga0307408_100058769
411 Ga0307405_10045049
412 Ga0307406_10036589
413 Ga0307414_10113814
414 Ga0307411_10333386
415 Ga0307415_100145365
416 Ga0307415_100166064
417 Ga0373951_0005035
418 Ga0395900_0665244
419 Ga0436364_0563404
420 Ga0242420_011552
421 Ga0439448_0003115
422 Ga0451576_0301310
423 Ga0496106_0033484
424 Ga0496108_0158099
425 Ga0496110_0378277
426 Ga0496113_0141267
427 Ga0501292_018532
428 Ga0501199_007559
429 Ga0501202_007298
430 Ga0501217_004384
431 Ga0501217_033440
432 Ga0501223_005709
433 Ga0501227_005085
434 Ga0501227_007324
435 Ga0501230_006211
436 Ga0501235_005218
437 Ga0501236_013039
438 Ga0501249_018553
439 Ga0501212_018333
440 Ga0501226_006564
441 nmdc:mga08y16_11917_c1
442 nmdc:mga08y16_221723_c1
443 nmdc:mga0n895_154837_c1
444 nmdc:mga0rr50_470604_c1
445 nmdc:mga08x19_8066_c1
446 nmdc:mga0a205_421627_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

193

294

0.89

PF14534

DUF4440

Domain of unknown function (DUF4440)

49

160

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w3f-assembly2.cif.gz_B rd1ntf2_05_i64f_a80g_t94p_d101k_l106w 0.8337 175 288
4ovm-assembly3.cif.gz_F crystal structure of sgcj protein from streptomyces carzinostaticus 0.8198 175 288
3f7s-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution 0.8146 170 290
6w3f-assembly2.cif.gz_B rd1ntf2_05_i64f_a80g_t94p_d101k_l106w 0.814 175 288
4q53-assembly1.cif.gz_A crystal structure of a duf4783 family protein (bacuni_04292) from bacteroides uniformis atcc 8492 at 1.27 a resolution 0.8034 184 290
ID Description Score Start End Superfamily
2rgqA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8 178 290 3.10.450.50
af_Q8RYS9_157_289_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.787 168 290 3.10.450.50
af_Q9M2S5_167_289_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7782 195 290 3.10.450.50
af_A0A078BPG0_5_119_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7735 175 288 3.10.450.50
3f7sA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7726 175 286 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2V8Q3C4-F1-model_v4 DUF4440 domain-containing protein 0.9659 19 290
AF-A0A352F0Z2-F1-model_v4 DUF4440 domain-containing protein 0.9551 21 290
AF-A0A7C2YAA3-F1-model_v4 Nuclear transport factor 2 family protein 0.9502 168 290
AF-A0A1W2G5N9-F1-model_v4 DUF4440 domain-containing protein 0.9441 174 288
AF-A0A2V8QWQ3-F1-model_v4 DUF4440 domain-containing protein 0.9407 173 290

Map