F335388

General Info

Members Datasets Scaffolds Average Seq Length
223 152 446 226

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100151831|Ga0068856_1001518312
Length 264
Sequence MPGTSGASCRRCVKLRQTALNGLLLRIIGSSCAVNLSIIMEDMRILVAEDDEKIASFVVKGLKQNSYAVDHRADGEQALALAQTVAYDAAVVDIMLPKLDGLSLIQQVRAKKIHLPILILSAKASVDDRVRGLQAGGDDYLTKPFAFSELLARIQALIRRSTQTIEPTRLTASNLTMDLLTREVRRGGEKIELQPREFALLEYLMRSANRAVTKTMILEHIFDYSFDPQTNVVDVLVHRLRNKVDPDKTMIHTMRGVGYVLRTG

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
152 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.45
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 0.45
Rhizoplane 0.9
Rhizosphere 90.13
Stem 0
Stem Tuber 0
Unclassified 6.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100151831 3300005614 Bacteria 2325
2 rootH2_10186354 3300003320 Bacteria 5567
3 rootL2_10102042 3300003322 Bacteria 2104
4 rootH1_10011222 3300003323 Bacteria 1820
5 Ga0070658_10261422 3300005327 Unclassified 1470
6 Ga0070690_100061293 3300005330 Bacteria 2423
7 Ga0070690_100173202 3300005330 Bacteria 1486
8 Ga0070670_100620176 3300005331 Bacteria 969
9 Ga0068869_100249075 3300005334 Bacteria 1418
10 Ga0070666_10102235 3300005335 Bacteria 1976
11 Ga0070666_10153850 3300005335 Bacteria 1605
12 Ga0070680_100171528 3300005336 Bacteria 1825
13 Ga0068868_100546530 3300005338 Bacteria 1020
14 Ga0070689_100014054 3300005340 Bacteria 5808
15 Ga0070689_100047848 3300005340 Bacteria 3297
16 Ga0070713_100513990 3300005436 Bacteria 1131
17 Ga0070711_100474709 3300005439 Bacteria 1027
18 Ga0070708_100141074 3300005445 Bacteria 2235
19 Ga0070681_10158635 3300005458 Bacteria 2186
20 Ga0070685_10165966 3300005466 Unclassified 1411
21 Ga0070706_100354734 3300005467 Bacteria 1367
22 Ga0070684_100230814 3300005535 Bacteria 1690
23 Ga0070704_100334763 3300005549 Bacteria 1273
24 Ga0068855_100093085 3300005563 Bacteria 3476
25 Ga0068857_100000867 3300005577 Bacteria 22747
26 Ga0068857_100615125 3300005577 Bacteria 1028
27 Ga0070702_100068284 3300005615 Bacteria 2091
28 Ga0068859_100022877 3300005617 Bacteria 6267
29 Ga0068859_100698606 3300005617 Bacteria 1105
30 Ga0068864_100063408 3300005618 Bacteria 3203
31 Ga0068864_100761970 3300005618 Bacteria 949
32 Ga0068863_100032409 3300005841 Bacteria 4982
33 Ga0068863_100038437 3300005841 Bacteria 4553
34 Ga0068858_100524319 3300005842 Bacteria 1146
35 Ga0075363_100032015 3300006048 Bacteria 2729
36 Ga0070716_100020238 3300006173 Bacteria 3491
37 Ga0075362_10000145 3300006177 Bacteria 19361
38 Ga0075362_10093500 3300006177 Bacteria 1398
39 Ga0097621_100012132 3300006237 Bacteria 6376
40 Ga0097621_100051878 3300006237 Bacteria 3339
41 Ga0097621_100140910 3300006237 Bacteria 2060
42 Ga0075370_10093164 3300006353 Unclassified 1739
43 Ga0068871_100560798 3300006358 Bacteria 1035
44 Ga0075430_100095776 3300006846 Bacteria 2481
45 Ga0075430_100229305 3300006846 Unclassified 1540
46 Ga0075429_100067185 3300006880 Bacteria 3120
47 Ga0097620_100022878 3300006931 Bacteria 6267
48 Ga0097620_100698459 3300006931 Bacteria 1105
49 Ga0075435_100349309 3300007076 Bacteria 1268
50 Ga0105240_10004004 3300009093 Bacteria 22704
51 Ga0105240_10120856 3300009093 Bacteria 3154
52 Ga0105240_10409323 3300009093 Bacteria 1526
53 Ga0105240_10782048 3300009093 Bacteria 1035
54 Ga0111539_10237819 3300009094 Bacteria 2120
55 Ga0105245_10869637 3300009098 Bacteria 942
56 Ga0105247_10372364 3300009101 Bacteria 1010
57 Ga0105241_10148195 3300009174 Bacteria 1917
58 Ga0105237_10232315 3300009545 Bacteria 1845
59 Ga0105238_10024866 3300009551 Bacteria 6103
60 Ga0105249_10925594 3300009553 Bacteria 939
61 Ga0105239_10259904 3300010375 Bacteria 1951
62 Ga0157371_10244662 3300013102 Unclassified 1291
63 Ga0157370_10096391 3300013104 Bacteria 2775
64 Ga0157374_10000057 3300013296 Bacteria 117036
65 Ga0157374_10052503 3300013296 Bacteria 3797
66 Ga0157374_10448543 3300013296 Bacteria 1291
67 Ga0157372_10328809 3300013307 Unclassified 1780
68 Ga0157372_10334426 3300013307 Bacteria 1764
69 Ga0157375_10001024 3300013308 Bacteria 24137
70 Ga0157375_10015705 3300013308 Bacteria 6783
71 Ga0163163_10000018 3300014325 Bacteria 199503
72 Ga0163163_10017084 3300014325 Bacteria 6759
73 Ga0157376_10000357 3300014969 Bacteria 30379
74 Ga0224712_10067096 3300022467 Bacteria 1446
75 Ga0207680_10085475 3300025903 Bacteria 1993
76 Ga0207705_10106418 3300025909 Bacteria 2069
77 Ga0207707_10066234 3300025912 Bacteria 3146
78 Ga0207707_10123444 3300025912 Bacteria 2264
79 Ga0207695_10022032 3300025913 Bacteria 7249
80 Ga0207695_10114816 3300025913 Bacteria 2667
81 Ga0207694_10012808 3300025924 Bacteria 6317
82 Ga0207659_10099781 3300025926 Bacteria 2187
83 Ga0207700_10409186 3300025928 Bacteria 1190
84 Ga0207664_10011883 3300025929 Bacteria 6211
85 Ga0207661_10305116 3300025944 Bacteria 1428
86 Ga0207667_10403969 3300025949 Bacteria 1391
87 Ga0207667_10810641 3300025949 Unclassified 932
88 Ga0207677_10597928 3300026023 Bacteria 968
89 Ga0207703_10334148 3300026035 Bacteria 1391
90 Ga0207639_10521180 3300026041 Bacteria 1088
91 Ga0207702_10059530 3300026078 Bacteria 3253
92 Ga0207641_10258504 3300026088 Bacteria 1629
93 Ga0207674_10007655 3300026116 Bacteria 12579
94 Ga0207683_10613751 3300026121 Bacteria 1007
95 Ga0265337_1003865 3300028556 Bacteria 6358
96 Ga0265337_1016644 3300028556 Bacteria 2371
97 Ga0265326_10020698 3300028558 Bacteria 1885
98 Ga0265319_1007082 3300028563 Bacteria 5090
99 Ga0265319_1021028 3300028563 Bacteria 2404
100 Ga0265334_10006262 3300028573 Bacteria 5141
101 Ga0265323_10002690 3300028653 Bacteria 8027
102 Ga0265322_10023981 3300028654 Bacteria 1744
103 Ga0265336_10000570 3300028666 Bacteria 20798
104 Ga0307515_10073957 3300028794 Bacteria 4568
105 Ga0265338_10000140 3300028800 Bacteria 133666
106 Ga0265338_10000506 3300028800 Bacteria 69582
107 Ga0265338_10001340 3300028800 Bacteria 40157
108 Ga0265338_10012788 3300028800 Bacteria 9545
109 Ga0265338_10029082 3300028800 Bacteria 5491
110 Ga0265338_10065263 3300028800 Bacteria 3159
111 Ga0265338_10408957 3300028800 Bacteria 966
112 Ga0265338_10471026 3300028800 Bacteria 887
113 Ga0265324_10023126 3300029957 Bacteria 2216
114 Ga0265328_10035607 3300031239 Bacteria 1841
115 Ga0265320_10045375 3300031240 Bacteria 2160
116 Ga0265320_10103965 3300031240 Bacteria 1306
117 Ga0265340_10145386 3300031247 Bacteria 1083
118 Ga0265339_10014146 3300031249 Bacteria 4815
119 Ga0265339_10141473 3300031249 Bacteria 1224
120 Ga0265327_10000538 3300031251 Bacteria 64869
121 Ga0265342_10244452 3300031712 Bacteria 960
122 Ga0316576_10306298 3300031727 Bacteria 1187
123 Ga0307410_10081220 3300031852 Bacteria 2277
124 Ga0307406_10377857 3300031901 Bacteria 1116
125 Ga0307416_100076221 3300032002 Bacteria 2810
126 Ga0307411_10298570 3300032005 Unclassified 1291
127 Ga0316583_10082393 3300032133 Bacteria 1124
128 Ga0373926_0040133 3300035083 Bacteria 1670
129 Ga0373953_0159380 3300035117 Bacteria 969
130 Ga0373954_0008893 3300035118 Bacteria 4419
131 Ga0373956_0011149 3300035119 Bacteria 3701
132 Ga0373955_0061274 3300035172 Bacteria 2078
133 Ga0373955_0076432 3300035172 Bacteria 1884
134 Ga0373931_0064256 3300035691 Bacteria 1986
135 Ga0373927_0114683 3300035695 Bacteria 1756
136 Ga0373927_0417755 3300035695 Unclassified 885
137 Ga0373933_0068591 3300035724 Bacteria 2154
138 Ga0373947_0415705 3300035725 Unclassified 908
139 Ga0373937_0013789 3300036401 Bacteria 7122
140 Ga0373937_0792396 3300036401 Unclassified 895
141 Ga0451793_0025539 3300041452 Bacteria 1105
142 Ga0451577_0001641 3300042876 Bacteria 28964
143 Ga0451577_0006185 3300042876 Bacteria 12023
144 Ga0453684_0006457 3300044712 Bacteria 22262
145 Ga0453684_0012907 3300044712 Bacteria 13686
146 Ga0453684_0143991 3300044712 Bacteria 2842
147 Ga0466960_0333850 3300044901 Bacteria 861
148 Ga0451576_0013714 3300045051 Bacteria 9055
149 Ga0451576_0057979 3300045051 Unclassified 4048
150 Ga0451576_0137765 3300045051 Bacteria 2546
151 Ga0451576_0219757 3300045051 Bacteria 1984
152 Ga0451576_0295823 3300045051 Bacteria 1693
153 Ga0451576_0581190 3300045051 Bacteria 1177
154 Ga0451576_0615538 3300045051 Bacteria 1141
155 Ga0451576_0826111 3300045051 Bacteria 973
156 Ga0495592_0102787 3300046454 Bacteria 2034
157 Ga0495603_0210196 3300046455 Bacteria 1123
158 Ga0495603_0280987 3300046455 Bacteria 957
159 Ga0495629_0334519 3300046459 Bacteria 1034
160 Ga0495582_0015879 3300046473 Bacteria 4129
161 Ga0495662_0013248 3300046476 Bacteria 4014
162 Ga0495664_0150534 3300046477 Bacteria 1411
163 Ga0495608_0191724 3300046511 Bacteria 1290
164 Ga0495618_0003088 3300046514 Bacteria 10504
165 Ga0495618_0055552 3300046514 Bacteria 2507
166 Ga0495628_0000256 3300046516 Bacteria 47095
167 Ga0495628_0331225 3300046516 Bacteria 1122
168 Ga0495630_0000063 3300046517 Bacteria 85919
169 Ga0495630_0051559 3300046517 Bacteria 3080
170 Ga0495630_0224986 3300046517 Bacteria 1433
171 Ga0495666_0010158 3300046526 Bacteria 4696
172 Ga0495666_0169160 3300046526 Bacteria 1011
173 Ga0495652_0191983 3300046529 Bacteria 1558
174 Ga0495640_0052571 3300046533 Bacteria 2797
175 Ga0495640_0069072 3300046533 Bacteria 2377
176 Ga0495640_0173830 3300046533 Bacteria 1375
177 Ga0495586_0000009 3300046535 Bacteria 144639
178 Ga0495586_0000901 3300046535 Bacteria 16942
179 Ga0495586_0001242 3300046535 Bacteria 14305
180 Ga0495586_0001954 3300046535 Bacteria 11243
181 Ga0495645_0011090 3300046543 Bacteria 6337
182 Ga0495645_0057861 3300046543 Bacteria 2813
183 Ga0495634_0001352 3300046642 Bacteria 22321
184 Ga0495634_0025187 3300046642 Bacteria 4168
185 Ga0495634_0152129 3300046642 Unclassified 1463
186 Ga0495657_0302963 3300046675 Bacteria 953
187 Ga0495599_0013642 3300046678 Bacteria 5021
188 Ga0495647_0045946 3300046681 Bacteria 1680
189 Ga0495647_0052698 3300046681 Bacteria 1585
190 Ga0495658_0004100 3300046683 Bacteria 7178
191 Ga0495658_0021354 3300046683 Bacteria 3412
192 Ga0495658_0064218 3300046683 Bacteria 2114
193 Ga0495613_0019883 3300046689 Bacteria 5004
194 Ga0495613_0024325 3300046689 Bacteria 4512
195 Ga0495624_0026421 3300046690 Bacteria 3805
196 Ga0495624_0059598 3300046690 Bacteria 2395
197 Ga0495674_0000451 3300047319 Bacteria 37104
198 Ga0495674_0245284 3300047319 Bacteria 1475
199 Ga0495676_0004825 3300047321 Bacteria 12365
200 Ga0495680_0004803 3300047322 Bacteria 12829
201 Ga0495675_0263762 3300047444 Unclassified 1031
202 Ga0495684_0052919 3300047471 Bacteria 3098
203 Ga0496115_0071042 3300048918 Bacteria 2823
204 Ga0496125_0353056 3300048928 Bacteria 877
205 Ga0496125_0388857 3300048928 Bacteria 819
206 Ga0501034_0611581 3300049571 Bacteria 994
207 Ga0501083_0300647 3300049744 Bacteria 1044
208 nmdc:mga03683_147_c1 3300050489 Bacteria 24092
209 nmdc:mga03n38_232504_c1 3300050490 Unclassified 967
210 nmdc:mga03n38_26678_c1 3300050490 Bacteria 2388
211 nmdc:mga07m45_6988_c1 3300050496 Bacteria 5741
212 nmdc:mga09592_35712_c1 3300050508 Bacteria 4161
213 nmdc:mga0qj67_98607_c1 3300050509 Bacteria 2354
214 nmdc:mga06r32_107322_c1 3300050510 Bacteria 2744
215 nmdc:mga08y16_132569_c1 3300050511 Bacteria 2590
216 nmdc:mga08y16_186353_c1 3300050511 Bacteria 2153
217 nmdc:mga0rr50_303216_c1 3300050513 Bacteria 1336
218 Ga0500572_000274 3300053111 Bacteria 18700
219 Ga0500559_0000053 3300053136 Bacteria 90779
220 Ga0500616_0035806 3300053153 Bacteria 2697
221 Ga0500616_0045870 3300053153 Bacteria 2326
222 Ga0500636_0032756 3300053177 Bacteria 3076
223 2894235854 2894232714 Bacteria 8834183
224 Ga0068856_100151831
225 rootH2_10186354
226 rootL2_10102042
227 rootH1_10011222
228 Ga0070658_10261422
229 Ga0070690_100061293
230 Ga0070690_100173202
231 Ga0070670_100620176
232 Ga0068869_100249075
233 Ga0070666_10102235
234 Ga0070666_10153850
235 Ga0070680_100171528
236 Ga0068868_100546530
237 Ga0070689_100014054
238 Ga0070689_100047848
239 Ga0070713_100513990
240 Ga0070711_100474709
241 Ga0070708_100141074
242 Ga0070681_10158635
243 Ga0070685_10165966
244 Ga0070706_100354734
245 Ga0070684_100230814
246 Ga0070704_100334763
247 Ga0068855_100093085
248 Ga0068857_100000867
249 Ga0068857_100615125
250 Ga0070702_100068284
251 Ga0068859_100022877
252 Ga0068859_100698606
253 Ga0068864_100063408
254 Ga0068864_100761970
255 Ga0068863_100032409
256 Ga0068863_100038437
257 Ga0068858_100524319
258 Ga0075363_100032015
259 Ga0070716_100020238
260 Ga0075362_10000145
261 Ga0075362_10093500
262 Ga0097621_100012132
263 Ga0097621_100051878
264 Ga0097621_100140910
265 Ga0075370_10093164
266 Ga0068871_100560798
267 Ga0075430_100095776
268 Ga0075430_100229305
269 Ga0075429_100067185
270 Ga0097620_100022878
271 Ga0097620_100698459
272 Ga0075435_100349309
273 Ga0105240_10004004
274 Ga0105240_10120856
275 Ga0105240_10409323
276 Ga0105240_10782048
277 Ga0111539_10237819
278 Ga0105245_10869637
279 Ga0105247_10372364
280 Ga0105241_10148195
281 Ga0105237_10232315
282 Ga0105238_10024866
283 Ga0105249_10925594
284 Ga0105239_10259904
285 Ga0157371_10244662
286 Ga0157370_10096391
287 Ga0157374_10000057
288 Ga0157374_10052503
289 Ga0157374_10448543
290 Ga0157372_10328809
291 Ga0157372_10334426
292 Ga0157375_10001024
293 Ga0157375_10015705
294 Ga0163163_10000018
295 Ga0163163_10017084
296 Ga0157376_10000357
297 Ga0224712_10067096
298 Ga0207680_10085475
299 Ga0207705_10106418
300 Ga0207707_10066234
301 Ga0207707_10123444
302 Ga0207695_10022032
303 Ga0207695_10114816
304 Ga0207694_10012808
305 Ga0207659_10099781
306 Ga0207700_10409186
307 Ga0207664_10011883
308 Ga0207661_10305116
309 Ga0207667_10403969
310 Ga0207667_10810641
311 Ga0207677_10597928
312 Ga0207703_10334148
313 Ga0207639_10521180
314 Ga0207702_10059530
315 Ga0207641_10258504
316 Ga0207674_10007655
317 Ga0207683_10613751
318 Ga0265337_1003865
319 Ga0265337_1016644
320 Ga0265326_10020698
321 Ga0265319_1007082
322 Ga0265319_1021028
323 Ga0265334_10006262
324 Ga0265323_10002690
325 Ga0265322_10023981
326 Ga0265336_10000570
327 Ga0307515_10073957
328 Ga0265338_10000140
329 Ga0265338_10000506
330 Ga0265338_10001340
331 Ga0265338_10012788
332 Ga0265338_10029082
333 Ga0265338_10065263
334 Ga0265338_10408957
335 Ga0265338_10471026
336 Ga0265324_10023126
337 Ga0265328_10035607
338 Ga0265320_10045375
339 Ga0265320_10103965
340 Ga0265340_10145386
341 Ga0265339_10014146
342 Ga0265339_10141473
343 Ga0265327_10000538
344 Ga0265342_10244452
345 Ga0316576_10306298
346 Ga0307410_10081220
347 Ga0307406_10377857
348 Ga0307416_100076221
349 Ga0307411_10298570
350 Ga0316583_10082393
351 Ga0373926_0040133
352 Ga0373953_0159380
353 Ga0373954_0008893
354 Ga0373956_0011149
355 Ga0373955_0061274
356 Ga0373955_0076432
357 Ga0373931_0064256
358 Ga0373927_0114683
359 Ga0373927_0417755
360 Ga0373933_0068591
361 Ga0373947_0415705
362 Ga0373937_0013789
363 Ga0373937_0792396
364 Ga0451793_0025539
365 Ga0451577_0001641
366 Ga0451577_0006185
367 Ga0453684_0006457
368 Ga0453684_0012907
369 Ga0453684_0143991
370 Ga0466960_0333850
371 Ga0451576_0013714
372 Ga0451576_0057979
373 Ga0451576_0137765
374 Ga0451576_0219757
375 Ga0451576_0295823
376 Ga0451576_0581190
377 Ga0451576_0615538
378 Ga0451576_0826111
379 Ga0495592_0102787
380 Ga0495603_0210196
381 Ga0495603_0280987
382 Ga0495629_0334519
383 Ga0495582_0015879
384 Ga0495662_0013248
385 Ga0495664_0150534
386 Ga0495608_0191724
387 Ga0495618_0003088
388 Ga0495618_0055552
389 Ga0495628_0000256
390 Ga0495628_0331225
391 Ga0495630_0000063
392 Ga0495630_0051559
393 Ga0495630_0224986
394 Ga0495666_0010158
395 Ga0495666_0169160
396 Ga0495652_0191983
397 Ga0495640_0052571
398 Ga0495640_0069072
399 Ga0495640_0173830
400 Ga0495586_0000009
401 Ga0495586_0000901
402 Ga0495586_0001242
403 Ga0495586_0001954
404 Ga0495645_0011090
405 Ga0495645_0057861
406 Ga0495634_0001352
407 Ga0495634_0025187
408 Ga0495634_0152129
409 Ga0495657_0302963
410 Ga0495599_0013642
411 Ga0495647_0045946
412 Ga0495647_0052698
413 Ga0495658_0004100
414 Ga0495658_0021354
415 Ga0495658_0064218
416 Ga0495613_0019883
417 Ga0495613_0024325
418 Ga0495624_0026421
419 Ga0495624_0059598
420 Ga0495674_0000451
421 Ga0495674_0245284
422 Ga0495676_0004825
423 Ga0495680_0004803
424 Ga0495675_0263762
425 Ga0495684_0052919
426 Ga0496115_0071042
427 Ga0496125_0353056
428 Ga0496125_0388857
429 Ga0501034_0611581
430 Ga0501083_0300647
431 nmdc:mga03683_147_c1
432 nmdc:mga03n38_232504_c1
433 nmdc:mga03n38_26678_c1
434 nmdc:mga07m45_6988_c1
435 nmdc:mga09592_35712_c1
436 nmdc:mga0qj67_98607_c1
437 nmdc:mga06r32_107322_c1
438 nmdc:mga08y16_132569_c1
439 nmdc:mga08y16_186353_c1
440 nmdc:mga0rr50_303216_c1
441 Ga0500572_000274
442 Ga0500559_0000053
443 Ga0500616_0035806
444 Ga0500616_0045870
445 Ga0500636_0032756
446 2894235854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

45

155

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

188

261

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9684 3 121
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9644 4 123
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9628 5 121
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9615 5 121
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9602 2 121
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9866 4 80 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.983 5 85 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9785 4 80 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9767 4 80 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9759 5 87 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1V5JWS4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9625 1 124 GO:0000155
GO:0005524
GO:0006355
AF-A0A0G3EDR7-F1-model_v4 Fis family transcriptional regulator 0.962 4 124 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A2N3AJC3-F1-model_v4 Two-component system response regulator 0.958 5 124 GO:0000160
GO:0005524
GO:0006355
GO:0016887
AF-A0A660W8P1-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9575 3 124 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-E1R266-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9555 1 124 GO:0000160
GO:0016301

Map