F335353

General Info

Members Datasets Scaffolds Average Seq Length
223 134 446 544

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100004427|Ga0070697_1000044277
Length 597
Sequence LGSAGAEKGDGELGVEGCGLSWQASKAGTLNSQPGTLNLYIVAAVLSHLRIKNLALVEELEWQIESGFIVVTGETGAGKSIIIGALNLLLGERADKSLIRTGADLCTVEAVFTGNDLRALNPQLVETGVEPCQDDLIIKRTLSMGGMNRQFINGSPTTLAVLKQLGDELVDLHGPHDHQSLLSSDKQLVLLDGFARAEETLAEYRKHFAHLQSLVAEHAALNTAETARERELDLLRHQVNEITAAKLDPGEEEQIDARYKLASNSKRLIELASGISQRLAEADDSVLXXXXETQRLLRELEKIDSSASQFVSGHGTAVVELSEIARSLSDYAEKLDLDPTQLAALEQRVSLFETLKRKYGSSIGEVIEFGARAAERMRKIEGRDAELERLAGEIDVAQANVKRSGEMLRKLRVKAAPKLSDHIRRNLRDLGFRQSEFEATFTALEEPRASGFDSIELLFSPNPGEPLKPLRAIASSGEISRLMLALKSALAAQDAISLLVFDEIDANVGGEIAHAVGAKMQTLADKHQVICITHLPQVAAAASSHFVVTKDVRSGRTHSRLHEVTGKARREEIARMLGGKSDSALELAASLLKSRGD

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.28
Rhizosphere 92.38
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100004427 3300005536 Bacteria 10788
2 JGI25406J46586_10002186 3300003203 Bacteria 9231
3 JGI25405J52794_10001479 3300003911 Bacteria 3875
4 Ga0065704_10006724 3300005289 Bacteria 4206
5 Ga0065704_10089767 3300005289 Bacteria 2830
6 Ga0065712_10003851 3300005290 Bacteria 8286
7 Ga0065715_10089135 3300005293 Bacteria 13674
8 Ga0065707_10003448 3300005295 Bacteria 5341
9 Ga0065707_10021718 3300005295 Bacteria 2990
10 Ga0070676_10003758 3300005328 Bacteria 7957
11 Ga0070676_10020556 3300005328 Bacteria 3687
12 Ga0070683_100006293 3300005329 Bacteria 9964
13 Ga0070670_100060248 3300005331 Bacteria 3258
14 Ga0070680_100071665 3300005336 Bacteria 2847
15 Ga0068868_100068143 3300005338 Bacteria 2833
16 Ga0070668_100039850 3300005347 Bacteria 3593
17 Ga0070668_100053142 3300005347 Bacteria 3124
18 Ga0070669_100001904 3300005353 Bacteria 15066
19 Ga0070669_100018205 3300005353 Bacteria 5017
20 Ga0070675_100001913 3300005354 Bacteria 15388
21 Ga0070675_100075673 3300005354 Bacteria 2799
22 Ga0070671_100032485 3300005355 Bacteria 4314
23 Ga0070671_100035819 3300005355 Unclassified 4112
24 Ga0070671_100076671 3300005355 Bacteria 2793
25 Ga0070674_100091066 3300005356 Bacteria 2201
26 Ga0070673_100092073 3300005364 Bacteria 2479
27 Ga0070673_100197899 3300005364 Bacteria 1729
28 Ga0070659_100006538 3300005366 Bacteria 8418
29 Ga0070659_100050495 3300005366 Bacteria 3269
30 Ga0070667_100026686 3300005367 Bacteria 4804
31 Ga0070709_10047971 3300005434 Bacteria 2663
32 Ga0070713_100042115 3300005436 Bacteria 3725
33 Ga0070713_100053645 3300005436 Bacteria 3341
34 Ga0070713_100147983 3300005436 Bacteria 2086
35 Ga0070713_100205032 3300005436 Bacteria 1783
36 Ga0070711_100004847 3300005439 Bacteria 7984
37 Ga0070705_100071536 3300005440 Bacteria 2098
38 Ga0070708_100004119 3300005445 Bacteria 11411
39 Ga0070708_100023113 3300005445 Bacteria 5280
40 Ga0070708_100028323 3300005445 Bacteria 4820
41 Ga0070708_100075191 3300005445 Unclassified 3048
42 Ga0070708_100216632 3300005445 Bacteria 1795
43 Ga0070678_100096336 3300005456 Bacteria 2282
44 Ga0070662_100001230 3300005457 Bacteria 15735
45 Ga0070681_10089186 3300005458 Bacteria 3035
46 Ga0070685_10031301 3300005466 Bacteria 2972
47 Ga0070706_100000012 3300005467 Bacteria 195040
48 Ga0070706_100023793 3300005467 Bacteria 5639
49 Ga0070707_100002059 3300005468 Bacteria 19267
50 Ga0070707_100002852 3300005468 Bacteria 16454
51 Ga0070707_100005403 3300005468 Bacteria 11956
52 Ga0070707_100011888 3300005468 Bacteria 8125
53 Ga0070707_100056432 3300005468 Bacteria 3767
54 Ga0070698_100003409 3300005471 Bacteria 17487
55 Ga0070698_100046220 3300005471 Bacteria 4451
56 Ga0070698_100129002 3300005471 Bacteria 2485
57 Ga0070699_100014817 3300005518 Bacteria 6704
58 Ga0070699_100062118 3300005518 Bacteria 3237
59 Ga0070679_100086813 3300005530 Bacteria 3115
60 Ga0070684_100001480 3300005535 Bacteria 16949
61 Ga0070684_100169560 3300005535 Bacteria 1982
62 Ga0070697_100004210 3300005536 Bacteria 11022
63 Ga0070697_100010187 3300005536 Bacteria 7335
64 Ga0070697_100013104 3300005536 Bacteria 6500
65 Ga0070697_100021703 3300005536 Bacteria 5089
66 Ga0070697_100029246 3300005536 Bacteria 4416
67 Ga0070697_100056280 3300005536 Unclassified 3199
68 Ga0070672_100103688 3300005543 Bacteria 2310
69 Ga0070695_100030150 3300005545 Bacteria 3375
70 Ga0070665_100015262 3300005548 Bacteria 7712
71 Ga0070665_100016288 3300005548 Bacteria 7457
72 Ga0070665_100167735 3300005548 Bacteria 2197
73 Ga0070704_100044631 3300005549 Bacteria 3081
74 Ga0068855_100106081 3300005563 Bacteria 3230
75 Ga0068856_100162282 3300005614 Bacteria 2246
76 Ga0068863_100003877 3300005841 Bacteria 14790
77 Ga0068858_100009081 3300005842 Bacteria 9508
78 Ga0068858_100022079 3300005842 Bacteria 5942
79 Ga0068858_100156697 3300005842 Bacteria 2143
80 Ga0068860_100001129 3300005843 Bacteria 29372
81 Ga0068860_100058557 3300005843 Bacteria 3662
82 Ga0068862_100022605 3300005844 Bacteria 5261
83 Ga0081455_10001583 3300005937 Bacteria 27844
84 Ga0081455_10005310 3300005937 Bacteria 14147
85 Ga0081455_10006228 3300005937 Bacteria 12846
86 Ga0081455_10028340 3300005937 Bacteria 5118
87 Ga0081455_10034490 3300005937 Bacteria 4532
88 Ga0081540_1000016 3300005983 Bacteria 165370
89 Ga0081540_1016917 3300005983 Bacteria 4539
90 Ga0081539_10000052 3300005985 Bacteria 268240
91 Ga0070717_10000538 3300006028 Bacteria 24005
92 Ga0070717_10007381 3300006028 Bacteria 8165
93 Ga0070717_10042863 3300006028 Unclassified 3692
94 Ga0070717_10045228 3300006028 Bacteria 3599
95 Ga0070717_10048240 3300006028 Bacteria 3492
96 Ga0070716_100097756 3300006173 Bacteria 1792
97 Ga0070712_100012836 3300006175 Bacteria 5334
98 Ga0070712_100027730 3300006175 Bacteria 3784
99 Ga0070712_100044902 3300006175 Bacteria 3048
100 Ga0068871_100062379 3300006358 Bacteria 3046
101 Ga0075428_100110078 3300006844 Bacteria 3001
102 Ga0068865_100039564 3300006881 Bacteria 3199
103 Ga0105240_10000007 3300009093 Bacteria 619357
104 Ga0105245_10004487 3300009098 Bacteria 12341
105 Ga0114129_10202651 3300009147 Bacteria 2686
106 Ga0105249_10002668 3300009553 Bacteria 15426
107 Ga0105249_10024095 3300009553 Bacteria 5467
108 Ga0105246_10035536 3300011119 Bacteria 3331
109 Ga0105246_10079018 3300011119 Bacteria 2338
110 Ga0157369_10136821 3300013105 Bacteria 2593
111 Ga0157374_10084953 3300013296 Bacteria 3009
112 Ga0157374_10128050 3300013296 Bacteria 2455
113 Ga0157378_10013724 3300013297 Bacteria 7086
114 Ga0157378_10048623 3300013297 Bacteria 3771
115 Ga0157378_10077634 3300013297 Bacteria 2994
116 Ga0157378_10106133 3300013297 Bacteria 2569
117 Ga0157378_10166945 3300013297 Bacteria 2062
118 Ga0163162_10009271 3300013306 Bacteria 9572
119 Ga0157372_10013476 3300013307 Bacteria 8737
120 Ga0157375_10003300 3300013308 Bacteria 13973
121 Ga0157375_10025020 3300013308 Bacteria 5537
122 Ga0157379_10054350 3300014968 Bacteria 3578
123 Ga0157376_10028203 3300014969 Bacteria 4459
124 Ga0163161_10030915 3300017792 Bacteria 3812
125 Ga0213876_10002585 3300021384 Bacteria 10579
126 Ga0207666_1001104 3300025271 Bacteria 3197
127 Ga0207697_10000633 3300025315 Bacteria 20039
128 Ga0207697_10000958 3300025315 Bacteria 16238
129 Ga0207697_10002202 3300025315 Bacteria 10199
130 Ga0207697_10004200 3300025315 Bacteria 6927
131 Ga0207697_10013631 3300025315 Bacteria 3388
132 Ga0207688_10002365 3300025901 Bacteria 10147
133 Ga0207680_10014945 3300025903 Bacteria 4037
134 Ga0207685_10032045 3300025905 Bacteria 1889
135 Ga0207645_10001920 3300025907 Bacteria 16778
136 Ga0207645_10002801 3300025907 Bacteria 13548
137 Ga0207645_10008401 3300025907 Bacteria 7203
138 Ga0207705_10023658 3300025909 Bacteria 4382
139 Ga0207684_10000028 3300025910 Bacteria 306450
140 Ga0207684_10013551 3300025910 Bacteria 7051
141 Ga0207684_10072455 3300025910 Bacteria 2926
142 Ga0207695_10000099 3300025913 Bacteria 259595
143 Ga0207671_10090679 3300025914 Bacteria 2302
144 Ga0207693_10000433 3300025915 Bacteria 38136
145 Ga0207693_10006226 3300025915 Bacteria 9897
146 Ga0207693_10010284 3300025915 Bacteria 7592
147 Ga0207693_10036553 3300025915 Bacteria 3871
148 Ga0207693_10055355 3300025915 Bacteria 3112
149 Ga0207662_10000531 3300025918 Bacteria 16918
150 Ga0207646_10000734 3300025922 Bacteria 42601
151 Ga0207646_10002142 3300025922 Bacteria 23602
152 Ga0207646_10006655 3300025922 Bacteria 11913
153 Ga0207646_10056572 3300025922 Bacteria 3505
154 Ga0207646_10083225 3300025922 Bacteria 2862
155 Ga0207646_10142769 3300025922 Bacteria 2157
156 Ga0207681_10012680 3300025923 Bacteria 5204
157 Ga0207659_10010235 3300025926 Bacteria 5883
158 Ga0207659_10034501 3300025926 Bacteria 3489
159 Ga0207659_10047352 3300025926 Bacteria 3041
160 Ga0207687_10055598 3300025927 Bacteria 2774
161 Ga0207700_10007425 3300025928 Bacteria 6697
162 Ga0207644_10022827 3300025931 Bacteria 4278
163 Ga0207644_10112640 3300025931 Bacteria 2059
164 Ga0207690_10065028 3300025932 Bacteria 2492
165 Ga0207706_10002639 3300025933 Bacteria 17466
166 Ga0207706_10030199 3300025933 Bacteria 4836
167 Ga0207706_10170667 3300025933 Unclassified 1911
168 Ga0207665_10012457 3300025939 Bacteria 5586
169 Ga0207665_10023238 3300025939 Bacteria 4083
170 Ga0207691_10000861 3300025940 Bacteria 30154
171 Ga0207679_10039741 3300025945 Bacteria 3362
172 Ga0207668_10013182 3300025972 Bacteria 5081
173 Ga0207677_10063889 3300026023 Bacteria 2561
174 Ga0207703_10018405 3300026035 Bacteria 5455
175 Ga0207703_10040691 3300026035 Bacteria 3721
176 Ga0207703_10123972 3300026035 Bacteria 2222
177 Ga0207639_10093909 3300026041 Bacteria 2407
178 Ga0207678_10003665 3300026067 Bacteria 13808
179 Ga0207708_10023402 3300026075 Bacteria 4669
180 Ga0207675_100036651 3300026118 Bacteria 4574
181 Ga0207683_10006964 3300026121 Bacteria 9687
182 Ga0207683_10015753 3300026121 Bacteria 6433
183 Ga0268266_10018222 3300028379 Bacteria 5986
184 Ga0268266_10034283 3300028379 Bacteria 4317
185 Ga0268264_10000626 3300028381 Bacteria 42069
186 Ga0268264_10036748 3300028381 Bacteria 4035
187 Ga0307513_10031403 3300031456 Bacteria 6016
188 Ga0373953_0027775 3300035117 Bacteria 2177
189 Ga0373955_0021396 3300035172 Bacteria 3264
190 Ga0373935_0016037 3300035692 Bacteria 4534
191 Ga0373937_0032376 3300036401 Bacteria 4742
192 Ga0395900_0002016 3300037418 Bacteria 22869
193 Ga0395900_0040192 3300037418 Bacteria 4820
194 Ga0395905_0005024 3300037471 Bacteria 13625
195 Ga0395901_0003034 3300038443 Bacteria 16918
196 Ga0436365_1555190 3300039437 Bacteria 11699
197 Ga0451576_0095604 3300045051 Bacteria 3090
198 Ga0495592_0023819 3300046454 Unclassified 4656
199 Ga0495629_0036953 3300046459 Bacteria 3444
200 Ga0495651_0017490 3300046462 Bacteria 5553
201 Ga0495630_0024155 3300046517 Bacteria 4495
202 Ga0495633_0043475 3300046558 Bacteria 2132
203 Ga0495599_0004467 3300046678 Bacteria 8286
204 Ga0495646_0014278 3300046680 Bacteria 5052
205 Ga0495674_0104283 3300047319 Unclassified 2410
206 Ga0495675_0013090 3300047444 Bacteria 5232
207 Ga0495684_0014921 3300047471 Bacteria 5984
208 Ga0495684_0030903 3300047471 Bacteria 4112
209 Ga0496100_0028026 3300048903 Bacteria 3470
210 Ga0496101_0001941 3300048904 Bacteria 12525
211 Ga0496102_0030785 3300048905 Bacteria 4805
212 Ga0496103_0091523 3300048906 Bacteria 1919
213 Ga0496104_0006204 3300048907 Bacteria 10502
214 Ga0496106_0002667 3300048909 Bacteria 13285
215 Ga0496107_0073993 3300048910 Bacteria 2478
216 Ga0496109_0018202 3300048912 Bacteria 6168
217 Ga0496109_0056365 3300048912 Bacteria 3587
218 Ga0496112_0042275 3300048915 Bacteria 4458
219 Ga0496112_0065981 3300048915 Bacteria 3572
220 Ga0496113_0003243 3300048916 Bacteria 9707
221 Ga0496115_0020928 3300048918 Bacteria 5048
222 Ga0496115_0023543 3300048918 Bacteria 4779
223 nmdc:mga08y16_192416_c1 3300050511 Bacteria 2115
224 Ga0070697_100004427
225 JGI25406J46586_10002186
226 JGI25405J52794_10001479
227 Ga0065704_10006724
228 Ga0065704_10089767
229 Ga0065712_10003851
230 Ga0065715_10089135
231 Ga0065707_10003448
232 Ga0065707_10021718
233 Ga0070676_10003758
234 Ga0070676_10020556
235 Ga0070683_100006293
236 Ga0070670_100060248
237 Ga0070680_100071665
238 Ga0068868_100068143
239 Ga0070668_100039850
240 Ga0070668_100053142
241 Ga0070669_100001904
242 Ga0070669_100018205
243 Ga0070675_100001913
244 Ga0070675_100075673
245 Ga0070671_100032485
246 Ga0070671_100035819
247 Ga0070671_100076671
248 Ga0070674_100091066
249 Ga0070673_100092073
250 Ga0070673_100197899
251 Ga0070659_100006538
252 Ga0070659_100050495
253 Ga0070667_100026686
254 Ga0070709_10047971
255 Ga0070713_100042115
256 Ga0070713_100053645
257 Ga0070713_100147983
258 Ga0070713_100205032
259 Ga0070711_100004847
260 Ga0070705_100071536
261 Ga0070708_100004119
262 Ga0070708_100023113
263 Ga0070708_100028323
264 Ga0070708_100075191
265 Ga0070708_100216632
266 Ga0070678_100096336
267 Ga0070662_100001230
268 Ga0070681_10089186
269 Ga0070685_10031301
270 Ga0070706_100000012
271 Ga0070706_100023793
272 Ga0070707_100002059
273 Ga0070707_100002852
274 Ga0070707_100005403
275 Ga0070707_100011888
276 Ga0070707_100056432
277 Ga0070698_100003409
278 Ga0070698_100046220
279 Ga0070698_100129002
280 Ga0070699_100014817
281 Ga0070699_100062118
282 Ga0070679_100086813
283 Ga0070684_100001480
284 Ga0070684_100169560
285 Ga0070697_100004210
286 Ga0070697_100010187
287 Ga0070697_100013104
288 Ga0070697_100021703
289 Ga0070697_100029246
290 Ga0070697_100056280
291 Ga0070672_100103688
292 Ga0070695_100030150
293 Ga0070665_100015262
294 Ga0070665_100016288
295 Ga0070665_100167735
296 Ga0070704_100044631
297 Ga0068855_100106081
298 Ga0068856_100162282
299 Ga0068863_100003877
300 Ga0068858_100009081
301 Ga0068858_100022079
302 Ga0068858_100156697
303 Ga0068860_100001129
304 Ga0068860_100058557
305 Ga0068862_100022605
306 Ga0081455_10001583
307 Ga0081455_10005310
308 Ga0081455_10006228
309 Ga0081455_10028340
310 Ga0081455_10034490
311 Ga0081540_1000016
312 Ga0081540_1016917
313 Ga0081539_10000052
314 Ga0070717_10000538
315 Ga0070717_10007381
316 Ga0070717_10042863
317 Ga0070717_10045228
318 Ga0070717_10048240
319 Ga0070716_100097756
320 Ga0070712_100012836
321 Ga0070712_100027730
322 Ga0070712_100044902
323 Ga0068871_100062379
324 Ga0075428_100110078
325 Ga0068865_100039564
326 Ga0105240_10000007
327 Ga0105245_10004487
328 Ga0114129_10202651
329 Ga0105249_10002668
330 Ga0105249_10024095
331 Ga0105246_10035536
332 Ga0105246_10079018
333 Ga0157369_10136821
334 Ga0157374_10084953
335 Ga0157374_10128050
336 Ga0157378_10013724
337 Ga0157378_10048623
338 Ga0157378_10077634
339 Ga0157378_10106133
340 Ga0157378_10166945
341 Ga0163162_10009271
342 Ga0157372_10013476
343 Ga0157375_10003300
344 Ga0157375_10025020
345 Ga0157379_10054350
346 Ga0157376_10028203
347 Ga0163161_10030915
348 Ga0213876_10002585
349 Ga0207666_1001104
350 Ga0207697_10000633
351 Ga0207697_10000958
352 Ga0207697_10002202
353 Ga0207697_10004200
354 Ga0207697_10013631
355 Ga0207688_10002365
356 Ga0207680_10014945
357 Ga0207685_10032045
358 Ga0207645_10001920
359 Ga0207645_10002801
360 Ga0207645_10008401
361 Ga0207705_10023658
362 Ga0207684_10000028
363 Ga0207684_10013551
364 Ga0207684_10072455
365 Ga0207695_10000099
366 Ga0207671_10090679
367 Ga0207693_10000433
368 Ga0207693_10006226
369 Ga0207693_10010284
370 Ga0207693_10036553
371 Ga0207693_10055355
372 Ga0207662_10000531
373 Ga0207646_10000734
374 Ga0207646_10002142
375 Ga0207646_10006655
376 Ga0207646_10056572
377 Ga0207646_10083225
378 Ga0207646_10142769
379 Ga0207681_10012680
380 Ga0207659_10010235
381 Ga0207659_10034501
382 Ga0207659_10047352
383 Ga0207687_10055598
384 Ga0207700_10007425
385 Ga0207644_10022827
386 Ga0207644_10112640
387 Ga0207690_10065028
388 Ga0207706_10002639
389 Ga0207706_10030199
390 Ga0207706_10170667
391 Ga0207665_10012457
392 Ga0207665_10023238
393 Ga0207691_10000861
394 Ga0207679_10039741
395 Ga0207668_10013182
396 Ga0207677_10063889
397 Ga0207703_10018405
398 Ga0207703_10040691
399 Ga0207703_10123972
400 Ga0207639_10093909
401 Ga0207678_10003665
402 Ga0207708_10023402
403 Ga0207675_100036651
404 Ga0207683_10006964
405 Ga0207683_10015753
406 Ga0268266_10018222
407 Ga0268266_10034283
408 Ga0268264_10000626
409 Ga0268264_10036748
410 Ga0307513_10031403
411 Ga0373953_0027775
412 Ga0373955_0021396
413 Ga0373935_0016037
414 Ga0373937_0032376
415 Ga0395900_0002016
416 Ga0395900_0040192
417 Ga0395905_0005024
418 Ga0395901_0003034
419 Ga0436365_1555190
420 Ga0451576_0095604
421 Ga0495592_0023819
422 Ga0495629_0036953
423 Ga0495651_0017490
424 Ga0495630_0024155
425 Ga0495633_0043475
426 Ga0495599_0004467
427 Ga0495646_0014278
428 Ga0495674_0104283
429 Ga0495675_0013090
430 Ga0495684_0014921
431 Ga0495684_0030903
432 Ga0496100_0028026
433 Ga0496101_0001941
434 Ga0496102_0030785
435 Ga0496103_0091523
436 Ga0496104_0006204
437 Ga0496106_0002667
438 Ga0496107_0073993
439 Ga0496109_0018202
440 Ga0496109_0056365
441 Ga0496112_0042275
442 Ga0496112_0065981
443 Ga0496113_0003243
444 Ga0496115_0020928
445 Ga0496115_0023543
446 nmdc:mga08y16_192416_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02463

SMC_N

RecF/RecN/SMC N terminal domain

45

557

0.92

PF13476

AAA_23

AAA domain

48

358

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fgk-assembly2.cif.gz_B crystal structure of the abc-cassette e631q mutant of hlyb with bound atp 0.7848 431 506
3kta-assembly1.cif.gz_B structural basis for adenylate kinase activity in abc atpases 0.7734 378 553
4aby-assembly3.cif.gz_C crystal structure of deinococcus radiodurans recn head domain 0.7699 4 551
3kta-assembly2.cif.gz_D structural basis for adenylate kinase activity in abc atpases 0.765 378 536
4aby-assembly3.cif.gz_C crystal structure of deinococcus radiodurans recn head domain 0.7647 4 551
ID Description Score Start End Superfamily
af_Q2FY50_278_554_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8219 280 552 3.40.50.300
af_P16679_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8104 428 506 3.40.50.300
af_Q2FY50_278_554_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8087 280 552 3.40.50.300
af_Q5KQG5_863_1025_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7942 337 492 3.40.50.300
af_Q5A4Y2_1215_1367_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7839 378 525 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V6HJY4-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9753 473 555 GO:0005524
GO:0006281
GO:0006310
GO:0009432
GO:0043590
AF-A0A2W5ZQP9-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9713 443 553 GO:0005524
GO:0006281
GO:0006310
GO:0009432
GO:0043590
AF-A0A645E6N4-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9654 449 554 GO:0005524
GO:0006281
GO:0006310
GO:0009432
GO:0043590
AF-A0A7Y2NW81-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9617 445 553 GO:0005524
GO:0006281
GO:0006310
GO:0009432
GO:0043590
AF-A0A837B598-F1-model_v4 DNA repair protein RecN (Recombination protein N) 0.9581 446 553 GO:0005524
GO:0006281
GO:0006310
GO:0009432
GO:0043590

Map