F335323

General Info

Members Datasets Scaffolds Average Seq Length
223 138 446 209

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100009797|Ga0070706_1000097976
Length 255
Sequence VDLHVRQRYRERASTSSGILLRPAKVGTPEDKSSGIDRDKTKPVGLGSLARHLDALHACRACPLMQSEPVSGGPVVSKVMLVGQAPGVKEPILQRPFAWTAGKAMFKWFEQSAGVSEQEFRETVYMAAVCRCFPGKNGHGGDRVPSNKEVKQCSRWLRAEFAILKPDLVIAVGKLAIGQFLEELPLLTELIGRTYPVKKFGHTFDLIPLPHPSGASPWHRIEPGKSLTMQALKLIREHPAWKERVGVSACRRTGE

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.17
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 28.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100009797 3300005467 Bacteria 8907
2 MBSR1b_contig_2684275 2162886012 Unclassified 922
3 JGI25405J52794_10002646 3300003911 Unclassified 3098
4 JGI25405J52794_10029618 3300003911 Bacteria 1133
5 Ga0065715_10101574 3300005293 Unclassified 3190
6 Ga0065715_10343456 3300005293 Bacteria 963
7 Ga0070658_10087592 3300005327 Bacteria 2563
8 Ga0070690_100045730 3300005330 Unclassified 2781
9 Ga0070690_100600695 3300005330 Unclassified 835
10 Ga0070666_10089511 3300005335 Bacteria 2112
11 Ga0070660_100006893 3300005339 Bacteria 7882
12 Ga0070675_100003400 3300005354 Bacteria 12052
13 Ga0070675_100440308 3300005354 Unclassified 1167
14 Ga0070673_100265278 3300005364 Unclassified 1501
15 Ga0070673_101108264 3300005364 Unclassified 740
16 Ga0070688_100131908 3300005365 Bacteria 1687
17 Ga0070688_100175726 3300005365 Bacteria 1482
18 Ga0070688_100693772 3300005365 Bacteria 788
19 Ga0070659_100003503 3300005366 Bacteria 11177
20 Ga0070659_100050478 3300005366 Bacteria 3270
21 Ga0070667_100355481 3300005367 Bacteria 1327
22 Ga0070667_100810257 3300005367 Unclassified 869
23 Ga0070709_10236727 3300005434 Bacteria 1309
24 Ga0070714_100085742 3300005435 Bacteria 2751
25 Ga0070713_100324274 3300005436 Unclassified 1423
26 Ga0070713_100707845 3300005436 Unclassified 962
27 Ga0070711_100006507 3300005439 Bacteria 7045
28 Ga0070711_100124478 3300005439 Unclassified 1912
29 Ga0070711_100250098 3300005439 Bacteria 1390
30 Ga0070711_100548742 3300005439 Unclassified 958
31 Ga0070705_100030329 3300005440 Bacteria 2984
32 Ga0070705_100049049 3300005440 Bacteria 2449
33 Ga0070705_100223572 3300005440 Unclassified 1305
34 Ga0070708_100123468 3300005445 Bacteria 2391
35 Ga0070708_100146984 3300005445 Unclassified 2190
36 Ga0070708_100240539 3300005445 Unclassified 1699
37 Ga0070708_100501403 3300005445 Unclassified 1145
38 Ga0070663_100819552 3300005455 Unclassified 799
39 Ga0070678_100312847 3300005456 Unclassified 1339
40 Ga0070678_100442455 3300005456 Unclassified 1137
41 Ga0070662_100008378 3300005457 Bacteria 6740
42 Ga0070662_100046580 3300005457 Bacteria 3116
43 Ga0068867_100185140 3300005459 Bacteria 1658
44 Ga0070706_100015955 3300005467 Bacteria 6938
45 Ga0070706_100156955 3300005467 Bacteria 2124
46 Ga0070706_100885312 3300005467 Bacteria 825
47 Ga0070707_100008052 3300005468 Bacteria 9785
48 Ga0070707_100032877 3300005468 Bacteria 4943
49 Ga0070707_100081215 3300005468 Unclassified 3130
50 Ga0070707_100110926 3300005468 Bacteria 2660
51 Ga0070707_100117547 3300005468 Bacteria 2580
52 Ga0070707_100167601 3300005468 Bacteria 2141
53 Ga0070707_100386850 3300005468 Bacteria 1358
54 Ga0070698_100006310 3300005471 Bacteria 12874
55 Ga0070698_100019345 3300005471 Bacteria 7153
56 Ga0070698_100170840 3300005471 Bacteria 2115
57 Ga0070699_100289642 3300005518 Bacteria 1468
58 Ga0070684_100001795 3300005535 Bacteria 15694
59 Ga0070684_100736361 3300005535 Bacteria 920
60 Ga0070697_100009331 3300005536 Bacteria 7671
61 Ga0070697_100010662 3300005536 Bacteria 7172
62 Ga0070697_100058662 3300005536 Unclassified 3133
63 Ga0070697_100599100 3300005536 Unclassified 968
64 Ga0070697_100687865 3300005536 Unclassified 902
65 Ga0070697_100795979 3300005536 Unclassified 836
66 Ga0070672_100413017 3300005543 Bacteria 1158
67 Ga0070686_100079065 3300005544 Bacteria 2173
68 Ga0070695_100058278 3300005545 Unclassified 2497
69 Ga0070696_100059993 3300005546 Unclassified 2659
70 Ga0070665_100212402 3300005548 Bacteria 1936
71 Ga0070665_100629777 3300005548 Unclassified 1086
72 Ga0070665_100993270 3300005548 Unclassified 852
73 Ga0070664_100288347 3300005564 Bacteria 1481
74 Ga0070664_100406910 3300005564 Unclassified 1245
75 Ga0068856_100120050 3300005614 Bacteria 2630
76 Ga0068852_100651080 3300005616 Unclassified 1061
77 Ga0068861_100371379 3300005719 Unclassified 1261
78 Ga0068863_100579181 3300005841 Bacteria 1110
79 Ga0068860_100007710 3300005843 Bacteria 10765
80 Ga0081455_10003636 3300005937 Bacteria 17668
81 Ga0081455_10003865 3300005937 Bacteria 17074
82 Ga0070715_10077609 3300006163 Unclassified 1499
83 Ga0070715_10130142 3300006163 Unclassified 1210
84 Ga0070716_100477779 3300006173 Bacteria 914
85 Ga0070716_100711977 3300006173 Unclassified 768
86 Ga0070712_100044549 3300006175 Unclassified 3060
87 Ga0070712_100066474 3300006175 Bacteria 2563
88 Ga0070712_100252683 3300006175 Bacteria 1409
89 Ga0070712_100300311 3300006175 Bacteria 1299
90 Ga0097621_100170520 3300006237 Bacteria 1876
91 Ga0097621_100227036 3300006237 Bacteria 1629
92 Ga0068871_100016108 3300006358 Bacteria 5617
93 Ga0099794_10403058 3300007265 Bacteria 714
94 Ga0114129_10024965 3300009147 Bacteria 8473
95 Ga0114129_10059979 3300009147 Bacteria 5319
96 Ga0105243_10126910 3300009148 Bacteria 2160
97 Ga0105237_10626994 3300009545 Unclassified 1082
98 Ga0105249_10001815 3300009553 Bacteria 18572
99 Ga0105249_10025190 3300009553 Bacteria 5353
100 Ga0105239_10032360 3300010375 Bacteria 5748
101 Ga0157374_10072961 3300013296 Bacteria 3239
102 Ga0157374_10143468 3300013296 Bacteria 2319
103 Ga0157374_10502677 3300013296 Unclassified 1217
104 Ga0157374_10906672 3300013296 Unclassified 899
105 Ga0157378_10244656 3300013297 Unclassified 1715
106 Ga0163162_10005758 3300013306 Bacteria 11988
107 Ga0157372_10035193 3300013307 Bacteria 5511
108 Ga0157375_10012395 3300013308 Bacteria 7561
109 Ga0157375_10394271 3300013308 Bacteria 1551
110 Ga0163163_10392687 3300014325 Unclassified 1445
111 Ga0157379_10030561 3300014968 Bacteria 4796
112 Ga0182006_1070457 3300015261 Bacteria 1298
113 Ga0182005_1017418 3300015265 Unclassified 1989
114 Ga0163161_10036594 3300017792 Bacteria 3515
115 Ga0213873_10013710 3300021358 Archaea 1783
116 Ga0213872_10014767 3300021361 Bacteria 3639
117 Ga0213874_10018060 3300021377 Bacteria 1901
118 Ga0207697_10000492 3300025315 Bacteria 22218
119 Ga0207697_10000853 3300025315 Bacteria 17252
120 Ga0207697_10002964 3300025315 Bacteria 8569
121 Ga0207692_10136408 3300025898 Bacteria 1391
122 Ga0207680_10367044 3300025903 Unclassified 1013
123 Ga0207685_10036816 3300025905 Bacteria 1797
124 Ga0207699_10103902 3300025906 Bacteria 1808
125 Ga0207645_10003903 3300025907 Bacteria 11144
126 Ga0207645_10012867 3300025907 Bacteria 5663
127 Ga0207684_10006363 3300025910 Bacteria 10764
128 Ga0207684_10069077 3300025910 Bacteria 3003
129 Ga0207684_10086806 3300025910 Bacteria 2665
130 Ga0207684_10168521 3300025910 Unclassified 1888
131 Ga0207684_10274641 3300025910 Bacteria 1454
132 Ga0207684_10869257 3300025910 Unclassified 759
133 Ga0207707_10468357 3300025912 Bacteria 1077
134 Ga0207693_10013742 3300025915 Bacteria 6522
135 Ga0207693_10026528 3300025915 Bacteria 4585
136 Ga0207663_10016017 3300025916 Bacteria 4148
137 Ga0207663_10421813 3300025916 Bacteria 1024
138 Ga0207662_10003795 3300025918 Bacteria 7838
139 Ga0207657_10093699 3300025919 Bacteria 2501
140 Ga0207646_10023181 3300025922 Bacteria 5704
141 Ga0207646_10037739 3300025922 Unclassified 4354
142 Ga0207646_10045550 3300025922 Bacteria 3938
143 Ga0207646_10134600 3300025922 Bacteria 2225
144 Ga0207646_10188891 3300025922 Bacteria 1861
145 Ga0207646_10221420 3300025922 Bacteria 1710
146 Ga0207646_10393343 3300025922 Bacteria 1252
147 Ga0207681_10014846 3300025923 Bacteria 4850
148 Ga0207681_10056991 3300025923 Unclassified 2668
149 Ga0207659_10033466 3300025926 Bacteria 3537
150 Ga0207700_10173096 3300025928 Unclassified 1802
151 Ga0207700_10274719 3300025928 Bacteria 1447
152 Ga0207644_10064359 3300025931 Bacteria 2664
153 Ga0207644_10097328 3300025931 Unclassified 2204
154 Ga0207690_10077984 3300025932 Bacteria 2304
155 Ga0207690_10122074 3300025932 Bacteria 1894
156 Ga0207706_10011823 3300025933 Bacteria 7949
157 Ga0207706_10030098 3300025933 Bacteria 4845
158 Ga0207709_10290145 3300025935 Bacteria 1212
159 Ga0207704_10220118 3300025938 Unclassified 1404
160 Ga0207665_10028516 3300025939 Unclassified 3687
161 Ga0207665_10410450 3300025939 Unclassified 1033
162 Ga0207691_10007809 3300025940 Bacteria 10301
163 Ga0207689_10384652 3300025942 Unclassified 1168
164 Ga0207661_10032070 3300025944 Bacteria 4067
165 Ga0207667_10448020 3300025949 Bacteria 1312
166 Ga0207651_10336925 3300025960 Unclassified 1266
167 Ga0207712_10029860 3300025961 Bacteria 3661
168 Ga0207712_10031053 3300025961 Bacteria 3595
169 Ga0207668_10121228 3300025972 Bacteria 1980
170 Ga0207668_10136801 3300025972 Bacteria 1878
171 Ga0207658_10032506 3300025986 Bacteria 3713
172 Ga0207658_10583969 3300025986 Unclassified 1002
173 Ga0207677_10254443 3300026023 Bacteria 1428
174 Ga0207703_10011363 3300026035 Bacteria 6927
175 Ga0207639_10000001 3300026041 Bacteria 1431562
176 Ga0207678_10724076 3300026067 Unclassified 876
177 Ga0207708_10016626 3300026075 Bacteria 5535
178 Ga0207683_10026267 3300026121 Bacteria 5026
179 Ga0268266_10490182 3300028379 Unclassified 1172
180 Ga0268265_10063717 3300028380 Bacteria 2837
181 Ga0268264_10063447 3300028381 Bacteria 3105
182 Ga0307513_10086493 3300031456 Bacteria 3213
183 Ga0307414_10244095 3300032004 Unclassified 1489
184 Ga0373955_0386376 3300035172 Unclassified 850
185 Ga0373933_0119608 3300035724 Unclassified 1649
186 Ga0373937_0154140 3300036401 Bacteria 2153
187 Ga0395900_1242321 3300037418 Bacteria 660
188 Ga0395898_0059724 3300037466 Bacteria 3708
189 Ga0395905_0091203 3300037471 Bacteria 2857
190 Ga0395905_0687112 3300037471 Unclassified 926
191 Ga0395901_0002456 3300038443 Bacteria 18794
192 Ga0395901_0387812 3300038443 Bacteria 1437
193 Ga0436365_1061596 3300039437 Bacteria 26524
194 Ga0436365_1753433 3300039437 Bacteria 24400
195 Ga0436363_1385938 3300039450 Bacteria 2415
196 Ga0436362_0229211 3300039453 Bacteria 1270
197 Ga0439455_0012143 3300042012 Bacteria 1929
198 Ga0439464_0024354 3300042439 Bacteria 1674
199 Ga0451576_0285800 3300045051 Bacteria 1724
200 Ga0495603_0236473 3300046455 Bacteria 1053
201 Ga0495652_0157041 3300046529 Bacteria 1770
202 Ga0495581_0137440 3300047315 Bacteria 1425
203 Ga0495676_0567401 3300047321 Unclassified 741
204 Ga0495680_0262271 3300047322 Bacteria 1222
205 Ga0496101_0048393 3300048904 Bacteria 3056
206 Ga0496102_0061918 3300048905 Bacteria 3426
207 Ga0496103_0486011 3300048906 Unclassified 791
208 Ga0496105_0374388 3300048908 Bacteria 1134
209 Ga0496106_0046865 3300048909 Bacteria 3251
210 Ga0496107_0159794 3300048910 Bacteria 1670
211 Ga0496108_0024326 3300048911 Bacteria 4985
212 Ga0496108_0197795 3300048911 Bacteria 1744
213 Ga0496109_0025522 3300048912 Bacteria 5267
214 Ga0496109_0207931 3300048912 Bacteria 1840
215 Ga0496110_0010931 3300048913 Bacteria 7403
216 Ga0496110_0405228 3300048913 Bacteria 1243
217 Ga0496111_0403046 3300048914 Bacteria 1011
218 Ga0496112_0315131 3300048915 Bacteria 1509
219 Ga0496115_0096881 3300048918 Bacteria 2416
220 Ga0496115_0971713 3300048918 Unclassified 651
221 Ga0501243_009701 3300049675 Bacteria 1497
222 nmdc:mga08x19_950070_c1 3300050514 Bacteria 611
223 nmdc:mga0a205_204098_c1 3300050515 Bacteria 1866
224 Ga0070706_100009797
225 MBSR1b_contig_2684275
226 JGI25405J52794_10002646
227 JGI25405J52794_10029618
228 Ga0065715_10101574
229 Ga0065715_10343456
230 Ga0070658_10087592
231 Ga0070690_100045730
232 Ga0070690_100600695
233 Ga0070666_10089511
234 Ga0070660_100006893
235 Ga0070675_100003400
236 Ga0070675_100440308
237 Ga0070673_100265278
238 Ga0070673_101108264
239 Ga0070688_100131908
240 Ga0070688_100175726
241 Ga0070688_100693772
242 Ga0070659_100003503
243 Ga0070659_100050478
244 Ga0070667_100355481
245 Ga0070667_100810257
246 Ga0070709_10236727
247 Ga0070714_100085742
248 Ga0070713_100324274
249 Ga0070713_100707845
250 Ga0070711_100006507
251 Ga0070711_100124478
252 Ga0070711_100250098
253 Ga0070711_100548742
254 Ga0070705_100030329
255 Ga0070705_100049049
256 Ga0070705_100223572
257 Ga0070708_100123468
258 Ga0070708_100146984
259 Ga0070708_100240539
260 Ga0070708_100501403
261 Ga0070663_100819552
262 Ga0070678_100312847
263 Ga0070678_100442455
264 Ga0070662_100008378
265 Ga0070662_100046580
266 Ga0068867_100185140
267 Ga0070706_100015955
268 Ga0070706_100156955
269 Ga0070706_100885312
270 Ga0070707_100008052
271 Ga0070707_100032877
272 Ga0070707_100081215
273 Ga0070707_100110926
274 Ga0070707_100117547
275 Ga0070707_100167601
276 Ga0070707_100386850
277 Ga0070698_100006310
278 Ga0070698_100019345
279 Ga0070698_100170840
280 Ga0070699_100289642
281 Ga0070684_100001795
282 Ga0070684_100736361
283 Ga0070697_100009331
284 Ga0070697_100010662
285 Ga0070697_100058662
286 Ga0070697_100599100
287 Ga0070697_100687865
288 Ga0070697_100795979
289 Ga0070672_100413017
290 Ga0070686_100079065
291 Ga0070695_100058278
292 Ga0070696_100059993
293 Ga0070665_100212402
294 Ga0070665_100629777
295 Ga0070665_100993270
296 Ga0070664_100288347
297 Ga0070664_100406910
298 Ga0068856_100120050
299 Ga0068852_100651080
300 Ga0068861_100371379
301 Ga0068863_100579181
302 Ga0068860_100007710
303 Ga0081455_10003636
304 Ga0081455_10003865
305 Ga0070715_10077609
306 Ga0070715_10130142
307 Ga0070716_100477779
308 Ga0070716_100711977
309 Ga0070712_100044549
310 Ga0070712_100066474
311 Ga0070712_100252683
312 Ga0070712_100300311
313 Ga0097621_100170520
314 Ga0097621_100227036
315 Ga0068871_100016108
316 Ga0099794_10403058
317 Ga0114129_10024965
318 Ga0114129_10059979
319 Ga0105243_10126910
320 Ga0105237_10626994
321 Ga0105249_10001815
322 Ga0105249_10025190
323 Ga0105239_10032360
324 Ga0157374_10072961
325 Ga0157374_10143468
326 Ga0157374_10502677
327 Ga0157374_10906672
328 Ga0157378_10244656
329 Ga0163162_10005758
330 Ga0157372_10035193
331 Ga0157375_10012395
332 Ga0157375_10394271
333 Ga0163163_10392687
334 Ga0157379_10030561
335 Ga0182006_1070457
336 Ga0182005_1017418
337 Ga0163161_10036594
338 Ga0213873_10013710
339 Ga0213872_10014767
340 Ga0213874_10018060
341 Ga0207697_10000492
342 Ga0207697_10000853
343 Ga0207697_10002964
344 Ga0207692_10136408
345 Ga0207680_10367044
346 Ga0207685_10036816
347 Ga0207699_10103902
348 Ga0207645_10003903
349 Ga0207645_10012867
350 Ga0207684_10006363
351 Ga0207684_10069077
352 Ga0207684_10086806
353 Ga0207684_10168521
354 Ga0207684_10274641
355 Ga0207684_10869257
356 Ga0207707_10468357
357 Ga0207693_10013742
358 Ga0207693_10026528
359 Ga0207663_10016017
360 Ga0207663_10421813
361 Ga0207662_10003795
362 Ga0207657_10093699
363 Ga0207646_10023181
364 Ga0207646_10037739
365 Ga0207646_10045550
366 Ga0207646_10134600
367 Ga0207646_10188891
368 Ga0207646_10221420
369 Ga0207646_10393343
370 Ga0207681_10014846
371 Ga0207681_10056991
372 Ga0207659_10033466
373 Ga0207700_10173096
374 Ga0207700_10274719
375 Ga0207644_10064359
376 Ga0207644_10097328
377 Ga0207690_10077984
378 Ga0207690_10122074
379 Ga0207706_10011823
380 Ga0207706_10030098
381 Ga0207709_10290145
382 Ga0207704_10220118
383 Ga0207665_10028516
384 Ga0207665_10410450
385 Ga0207691_10007809
386 Ga0207689_10384652
387 Ga0207661_10032070
388 Ga0207667_10448020
389 Ga0207651_10336925
390 Ga0207712_10029860
391 Ga0207712_10031053
392 Ga0207668_10121228
393 Ga0207668_10136801
394 Ga0207658_10032506
395 Ga0207658_10583969
396 Ga0207677_10254443
397 Ga0207703_10011363
398 Ga0207639_10000001
399 Ga0207678_10724076
400 Ga0207708_10016626
401 Ga0207683_10026267
402 Ga0268266_10490182
403 Ga0268265_10063717
404 Ga0268264_10063447
405 Ga0307513_10086493
406 Ga0307414_10244095
407 Ga0373955_0386376
408 Ga0373933_0119608
409 Ga0373937_0154140
410 Ga0395900_1242321
411 Ga0395898_0059724
412 Ga0395905_0091203
413 Ga0395905_0687112
414 Ga0395901_0002456
415 Ga0395901_0387812
416 Ga0436365_1061596
417 Ga0436365_1753433
418 Ga0436363_1385938
419 Ga0436362_0229211
420 Ga0439455_0012143
421 Ga0439464_0024354
422 Ga0451576_0285800
423 Ga0495603_0236473
424 Ga0495652_0157041
425 Ga0495581_0137440
426 Ga0495676_0567401
427 Ga0495680_0262271
428 Ga0496101_0048393
429 Ga0496102_0061918
430 Ga0496103_0486011
431 Ga0496105_0374388
432 Ga0496106_0046865
433 Ga0496107_0159794
434 Ga0496108_0024326
435 Ga0496108_0197795
436 Ga0496109_0025522
437 Ga0496109_0207931
438 Ga0496110_0010931
439 Ga0496110_0405228
440 Ga0496111_0403046
441 Ga0496112_0315131
442 Ga0496115_0096881
443 Ga0496115_0971713
444 Ga0501243_009701
445 nmdc:mga08x19_950070_c1
446 nmdc:mga0a205_204098_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

70

233

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l6s-assembly2.cif.gz_B the structure of the udgx mutant h109e crosslinked to single-stranded dna 0.8302 10 196
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.8288 6 194
6iod-assembly2.cif.gz_B the structure of udgx in complex with single-stranded dna 0.8259 15 196
8iij-assembly1.cif.gz_A h109g mutant of uracil dna glycosylase x 0.8227 15 197
6ajo-assembly1.cif.gz_A complex form of uracil dna glycosylase x and uracil-dna. 0.8225 10 196
ID Description Score Start End Superfamily
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8137 10 197 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8086 10 206 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7855 10 206 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7658 10 197 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7036 26 195 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A2V6BXY9-F1-model_v4 Uracil-DNA glycosylase 1.003 26 205 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A2V6EQR4-F1-model_v4 Uracil-DNA glycosylase 0.9995 2 209 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7W1U7U1-F1-model_v4 Uracil-DNA glycosylase family protein 0.9943 3 200 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A2V6A043-F1-model_v4 Uracil-DNA glycosylase 0.9921 26 191 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A3D1ILU7-F1-model_v4 Uracil-DNA glycosylase 0.9917 9 168 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Map