F335318
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 223 | 183 | 214 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_101837340|Ga0070678_1018373401 |
| Length | 105 |
| Sequence | MSAKIRKGDQVVVLTGKDKGRKGSVTKVFPKEQRVLVAGINMVQRHTRPSQGDPQGGIKHKEAPLHLSNVAVVDSKGKPTRVGFKVDGDKKVRIAKTTGEVIANG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 2 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 3 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 4 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 5 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 6 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 7 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 8 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 9 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 48 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 120 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 123 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 128 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 129 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 130 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 131 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 132 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 133 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 138 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 139 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 140 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 154 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 155 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 156 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 157 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 176 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 177 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 178 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 179 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 180 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 181 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 182 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 183 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87 |
| Metatranscriptomes | 8.97 |
| Isolates | 4.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.35 |
| Nodule | 0.45 |
| Rhizoplane | 6.73 |
| Rhizosphere | 68.16 |
| Stem | 0 |
| Stem Tuber | 0.45 |
| Unclassified | 9.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1027655 | 3300003771 | Bacteria | 1744 |
| 2 | Ga0055537_1001243 | 3300003773 | Bacteria | 10661 |
| 3 | Ga0055524_1030115 | 3300003775 | Bacteria | 1588 |
| 4 | Ga0055524_1039143 | 3300003775 | Bacteria | 1229 |
| 5 | Ga0055536_1013860 | 3300003781 | Bacteria | 2872 |
| 6 | Ga0055528_1008934 | 3300003790 | Bacteria | 4234 |
| 7 | Ga0055528_1029848 | 3300003790 | Bacteria | 1462 |
| 8 | Ga0055530_10012052 | 3300003791 | Bacteria | 3045 |
| 9 | Ga0055540_1079480 | 3300003792 | Bacteria | 630 |
| 10 | Ga0055531_10011237 | 3300003794 | Bacteria | 4347 |
| 11 | Ga0065704_10129280 | 3300005289 | Bacteria | 1650 |
| 12 | Ga0065707_10954760 | 3300005295 | Bacteria | 551 |
| 13 | Ga0070670_100231738 | 3300005331 | Bacteria | 1607 |
| 14 | Ga0070670_101071089 | 3300005331 | Bacteria | 734 |
| 15 | Ga0070666_10998012 | 3300005335 | Bacteria | 621 |
| 16 | Ga0070680_100006095 | 3300005336 | Bacteria | 9137 |
| 17 | Ga0070682_100903925 | 3300005337 | Bacteria | 726 |
| 18 | Ga0070661_100858025 | 3300005344 | Bacteria | 748 |
| 19 | Ga0070668_100023377 | 3300005347 | Bacteria | 4674 |
| 20 | Ga0070669_100294942 | 3300005353 | Bacteria | 1303 |
| 21 | Ga0070669_101291914 | 3300005353 | Bacteria | 632 |
| 22 | Ga0070671_100163137 | 3300005355 | Bacteria | 1884 |
| 23 | Ga0070659_100050090 | 3300005366 | Bacteria | 3285 |
| 24 | Ga0070659_100131707 | 3300005366 | Bacteria | 2031 |
| 25 | Ga0070667_100821273 | 3300005367 | Bacteria | 863 |
| 26 | Ga0070678_101837340 | 3300005456 | Bacteria | 572 |
| 27 | Ga0070681_10042882 | 3300005458 | Bacteria | 4533 |
| 28 | Ga0070681_11522658 | 3300005458 | Bacteria | 594 |
| 29 | Ga0070685_11375965 | 3300005466 | Bacteria | 541 |
| 30 | Ga0070679_100042115 | 3300005530 | Bacteria | 4547 |
| 31 | Ga0070679_100631932 | 3300005530 | Bacteria | 1014 |
| 32 | Ga0068853_100184845 | 3300005539 | Bacteria | 1891 |
| 33 | Ga0070665_100000121 | 3300005548 | Bacteria | 147683 |
| 34 | Ga0070665_100071556 | 3300005548 | Bacteria | 3474 |
| 35 | Ga0070665_100703227 | 3300005548 | Bacteria | 1024 |
| 36 | Ga0068855_100074983 | 3300005563 | Bacteria | 3928 |
| 37 | Ga0068857_100988596 | 3300005577 | Bacteria | 809 |
| 38 | Ga0068852_101228864 | 3300005616 | Bacteria | 770 |
| 39 | Ga0068859_100129145 | 3300005617 | Bacteria | 2598 |
| 40 | Ga0068861_100008806 | 3300005719 | Bacteria | 6950 |
| 41 | Ga0068863_100688336 | 3300005841 | Bacteria | 1016 |
| 42 | Ga0068858_101853750 | 3300005842 | Bacteria | 596 |
| 43 | Ga0068860_100707209 | 3300005843 | Bacteria | 1017 |
| 44 | Ga0068860_101339483 | 3300005843 | Bacteria | 737 |
| 45 | Ga0068862_100077983 | 3300005844 | Bacteria | 2870 |
| 46 | Ga0068862_101604536 | 3300005844 | Bacteria | 658 |
| 47 | Ga0075363_100653138 | 3300006048 | Bacteria | 633 |
| 48 | Ga0075362_10541719 | 3300006177 | Bacteria | 598 |
| 49 | Ga0075369_10417530 | 3300006186 | Bacteria | 633 |
| 50 | Ga0075370_10070472 | 3300006353 | Bacteria | 1999 |
| 51 | Ga0075370_10770990 | 3300006353 | Bacteria | 586 |
| 52 | Ga0097620_100129146 | 3300006931 | Bacteria | 2598 |
| 53 | Ga0105250_10627603 | 3300009092 | Bacteria | 500 |
| 54 | Ga0105245_10400611 | 3300009098 | Bacteria | 1371 |
| 55 | Ga0105245_10505959 | 3300009098 | Bacteria | 1225 |
| 56 | Ga0105247_10356271 | 3300009101 | Bacteria | 1030 |
| 57 | Ga0105243_11715076 | 3300009148 | Bacteria | 657 |
| 58 | Ga0105248_10611151 | 3300009177 | Bacteria | 1230 |
| 59 | Ga0105249_11007717 | 3300009553 | Bacteria | 902 |
| 60 | Ga0105249_11823706 | 3300009553 | Bacteria | 681 |
| 61 | Ga0105239_10346341 | 3300010375 | Bacteria | 1677 |
| 62 | Ga0105246_10413206 | 3300011119 | Bacteria | 1124 |
| 63 | Ga0157370_10162858 | 3300013104 | Bacteria | 2075 |
| 64 | Ga0157374_11917590 | 3300013296 | Bacteria | 618 |
| 65 | Ga0163162_10969375 | 3300013306 | Bacteria | 961 |
| 66 | Ga0163163_11525636 | 3300014325 | Bacteria | 729 |
| 67 | Ga0163163_11604010 | 3300014325 | Bacteria | 712 |
| 68 | Ga0157379_12279149 | 3300014968 | Bacteria | 539 |
| 69 | Ga0157376_10517004 | 3300014969 | Bacteria | 1176 |
| 70 | Ga0157376_11481378 | 3300014969 | Bacteria | 711 |
| 71 | Ga0163161_10708691 | 3300017792 | Bacteria | 839 |
| 72 | Ga0213876_10203589 | 3300021384 | Bacteria | 1052 |
| 73 | Ga0209565_1000925 | 3300025263 | Bacteria | 15538 |
| 74 | Ga0209673_1002524 | 3300025273 | Bacteria | 12545 |
| 75 | Ga0209675_1002569 | 3300025291 | Bacteria | 9211 |
| 76 | Ga0209564_1029308 | 3300025295 | Bacteria | 1735 |
| 77 | Ga0209758_1017317 | 3300025297 | Bacteria | 3598 |
| 78 | Ga0209050_1011548 | 3300025298 | Bacteria | 4167 |
| 79 | Ga0209256_1003893 | 3300025299 | Bacteria | 9891 |
| 80 | Ga0209051_1000877 | 3300025303 | Bacteria | 30359 |
| 81 | Ga0207642_10337355 | 3300025899 | Bacteria | 885 |
| 82 | Ga0207710_10608490 | 3300025900 | Bacteria | 571 |
| 83 | Ga0207705_10011901 | 3300025909 | Bacteria | 6285 |
| 84 | Ga0207707_10091202 | 3300025912 | Bacteria | 2663 |
| 85 | Ga0207707_11200566 | 3300025912 | Bacteria | 614 |
| 86 | Ga0207660_10000537 | 3300025917 | Bacteria | 25426 |
| 87 | Ga0207657_10062953 | 3300025919 | Bacteria | 3174 |
| 88 | Ga0207649_11407915 | 3300025920 | Bacteria | 552 |
| 89 | Ga0207652_10002134 | 3300025921 | Bacteria | 16964 |
| 90 | Ga0207694_10127710 | 3300025924 | Bacteria | 2035 |
| 91 | Ga0207694_10726901 | 3300025924 | Bacteria | 838 |
| 92 | Ga0207650_10513510 | 3300025925 | Bacteria | 1002 |
| 93 | Ga0207650_11745367 | 3300025925 | Bacteria | 527 |
| 94 | Ga0207644_10072994 | 3300025931 | Bacteria | 2515 |
| 95 | Ga0207690_10008937 | 3300025932 | Bacteria | 5947 |
| 96 | Ga0207706_10289810 | 3300025933 | Bacteria | 1427 |
| 97 | Ga0207667_10015066 | 3300025949 | Bacteria | 8794 |
| 98 | Ga0207712_10107447 | 3300025961 | Bacteria | 2086 |
| 99 | Ga0207712_11682184 | 3300025961 | Bacteria | 569 |
| 100 | Ga0207668_10007456 | 3300025972 | Bacteria | 6507 |
| 101 | Ga0207668_10124847 | 3300025972 | Bacteria | 1955 |
| 102 | Ga0207658_11497774 | 3300025986 | Bacteria | 617 |
| 103 | Ga0207703_12382143 | 3300026035 | Bacteria | 505 |
| 104 | Ga0207639_12127303 | 3300026041 | Bacteria | 522 |
| 105 | Ga0207639_12181211 | 3300026041 | Bacteria | 515 |
| 106 | Ga0207674_10267714 | 3300026116 | Bacteria | 1656 |
| 107 | Ga0207675_100065945 | 3300026118 | Bacteria | 3383 |
| 108 | Ga0207683_10240739 | 3300026121 | Bacteria | 1650 |
| 109 | Ga0207698_11875954 | 3300026142 | Bacteria | 614 |
| 110 | Ga0209969_1023032 | 3300027360 | Bacteria | 933 |
| 111 | Ga0210000_1027872 | 3300027462 | Bacteria | 878 |
| 112 | Ga0209999_1001367 | 3300027543 | Bacteria | 4179 |
| 113 | Ga0209983_1004172 | 3300027665 | Bacteria | 3047 |
| 114 | Ga0268266_10000106 | 3300028379 | Bacteria | 175109 |
| 115 | Ga0268266_10355576 | 3300028379 | Bacteria | 1377 |
| 116 | Ga0268266_11332354 | 3300028379 | Bacteria | 693 |
| 117 | Ga0268265_10579223 | 3300028380 | Bacteria | 1069 |
| 118 | Ga0268265_12075552 | 3300028380 | Bacteria | 575 |
| 119 | Ga0268264_10265613 | 3300028381 | Bacteria | 1601 |
| 120 | Ga0268264_10270383 | 3300028381 | Bacteria | 1588 |
| 121 | Ga0265327_10005226 | 3300031251 | Bacteria | 10946 |
| 122 | Ga0265316_11302941 | 3300031344 | Bacteria | 502 |
| 123 | Ga0307408_101012702 | 3300031548 | Bacteria | 766 |
| 124 | Ga0265314_10534402 | 3300031711 | Bacteria | 612 |
| 125 | Ga0307516_10001565 | 3300031730 | Bacteria | 31484 |
| 126 | Ga0307405_11309842 | 3300031731 | Bacteria | 630 |
| 127 | Ga0307413_10002271 | 3300031824 | Bacteria | 7767 |
| 128 | Ga0307410_11872623 | 3300031852 | Bacteria | 534 |
| 129 | Ga0307412_12113251 | 3300031911 | Bacteria | 523 |
| 130 | Ga0307409_102202628 | 3300031995 | Bacteria | 581 |
| 131 | Ga0307414_10117659 | 3300032004 | Bacteria | 2036 |
| 132 | Ga0307411_10706213 | 3300032005 | Bacteria | 879 |
| 133 | Ga0307415_101409803 | 3300032126 | Bacteria | 664 |
| 134 | Ga0316593_10001412 | 3300032168 | Bacteria | 5277 |
| 135 | Ga0316593_10004451 | 3300032168 | Bacteria | 3599 |
| 136 | Ga0316593_10308170 | 3300032168 | Bacteria | 600 |
| 137 | Ga0316596_1180234 | 3300033541 | Bacteria | 585 |
| 138 | Ga0373926_0161622 | 3300035083 | Bacteria | 855 |
| 139 | Ga0373932_0373893 | 3300035112 | Bacteria | 546 |
| 140 | Ga0373946_0106332 | 3300035171 | Bacteria | 1264 |
| 141 | Ga0316574_0425760 | 3300035398 | Bacteria | 834 |
| 142 | Ga0373931_0664459 | 3300035691 | Bacteria | 686 |
| 143 | Ga0373927_0000479 | 3300035695 | Bacteria | 30749 |
| 144 | Ga0373925_0000023 | 3300037068 | Bacteria | 158881 |
| 145 | Ga0395905_0198482 | 3300037471 | Bacteria | 1881 |
| 146 | Ga0400483_016797 | 3300039062 | Bacteria | 3004 |
| 147 | Ga0400483_079140 | 3300039062 | Bacteria | 6427 |
| 148 | Ga0400483_091640 | 3300039062 | Bacteria | 1098 |
| 149 | Ga0400483_109729 | 3300039062 | Bacteria | 1920 |
| 150 | Ga0400483_159265 | 3300039062 | Bacteria | 3451 |
| 151 | Ga0400483_267591 | 3300039062 | Bacteria | 1859 |
| 152 | Ga0436365_0914855 | 3300039437 | Bacteria | 1035 |
| 153 | Ga0436363_0378877 | 3300039450 | Bacteria | 597 |
| 154 | Ga0436363_0608441 | 3300039450 | Bacteria | 826 |
| 155 | Ga0439439_0043653 | 3300041406 | Bacteria | 1167 |
| 156 | Ga0451789_0598964 | 3300041443 | Bacteria | 536 |
| 157 | Ga0451792_21803 | 3300041445 | Bacteria | 692 |
| 158 | Ga0451791_1945811 | 3300041451 | Bacteria | 574 |
| 159 | Ga0451793_0267040 | 3300041452 | Bacteria | 603 |
| 160 | Ga0451795_0742986 | 3300041456 | Bacteria | 646 |
| 161 | Ga0451807_0856399 | 3300041486 | Bacteria | 930 |
| 162 | Ga0451807_1362667 | 3300041486 | Bacteria | 1002 |
| 163 | Ga0451833_0692534 | 3300041491 | Bacteria | 629 |
| 164 | Ga0451833_0831453 | 3300041491 | Bacteria | 679 |
| 165 | Ga0451851_0881431 | 3300041507 | Bacteria | 829 |
| 166 | Ga0439431_0031081 | 3300041997 | Bacteria | 1326 |
| 167 | Ga0439455_0082145 | 3300042012 | Bacteria | 877 |
| 168 | Ga0451576_1635363 | 3300045051 | Bacteria | 668 |
| 169 | Ga0495638_0638508 | 3300046460 | Bacteria | 519 |
| 170 | Ga0495582_0447483 | 3300046473 | Bacteria | 746 |
| 171 | Ga0495596_0129622 | 3300046500 | Bacteria | 979 |
| 172 | Ga0495642_0574303 | 3300046528 | Bacteria | 501 |
| 173 | Ga0495668_0001818 | 3300046616 | Bacteria | 19364 |
| 174 | Ga0495669_0000044 | 3300046684 | Bacteria | 85633 |
| 175 | Ga0495672_0023703 | 3300047320 | Bacteria | 3967 |
| 176 | Ga0496101_0318608 | 3300048904 | Bacteria | 1220 |
| 177 | Ga0496101_0372106 | 3300048904 | Bacteria | 1124 |
| 178 | Ga0496104_1336231 | 3300048907 | Bacteria | 620 |
| 179 | Ga0496106_0505943 | 3300048909 | Bacteria | 970 |
| 180 | Ga0496109_0864143 | 3300048912 | Bacteria | 842 |
| 181 | Ga0496110_0058384 | 3300048913 | Bacteria | 3399 |
| 182 | Ga0496111_0499245 | 3300048914 | Bacteria | 896 |
| 183 | Ga0496115_0061666 | 3300048918 | Bacteria | 3023 |
| 184 | Ga0496124_0294632 | 3300048927 | Bacteria | 1175 |
| 185 | Ga0496125_0035566 | 3300048928 | Bacteria | 4365 |
| 186 | Ga0496126_0196342 | 3300048929 | Bacteria | 1706 |
| 187 | Ga0501309_061698 | 3300049129 | Bacteria | 604 |
| 188 | Ga0501343_008616 | 3300049132 | Bacteria | 817 |
| 189 | Ga0501305_034269 | 3300049161 | Bacteria | 804 |
| 190 | Ga0501305_120697 | 3300049161 | Bacteria | 503 |
| 191 | Ga0501307_072833 | 3300049162 | Bacteria | 550 |
| 192 | Ga0501311_004366 | 3300049527 | Bacteria | 1502 |
| 193 | Ga0501316_012659 | 3300049532 | Bacteria | 989 |
| 194 | Ga0501316_021041 | 3300049532 | Bacteria | 822 |
| 195 | Ga0501317_046299 | 3300049533 | Bacteria | 679 |
| 196 | Ga0501318_043230 | 3300049534 | Bacteria | 651 |
| 197 | Ga0501323_015869 | 3300049539 | Bacteria | 955 |
| 198 | Ga0501323_029479 | 3300049539 | Bacteria | 764 |
| 199 | Ga0501325_047046 | 3300049541 | Bacteria | 540 |
| 200 | Ga0501335_035710 | 3300049551 | Bacteria | 574 |
| 201 | Ga0501034_0066063 | 3300049571 | Bacteria | 3630 |
| 202 | Ga0501067_0302873 | 3300049583 | Bacteria | 890 |
| 203 | Ga0501073_0092961 | 3300049589 | Bacteria | 2096 |
| 204 | nmdc:mga07m45_71181_c1 | 3300050496 | Bacteria | 1979 |
| 205 | nmdc:mga08y16_211324_c1 | 3300050511 | Bacteria | 2009 |
| 206 | nmdc:mga0sz30_17058_c1 | 3300050516 | Bacteria | 2892 |
| 207 | Ga0500641_0010509 | 3300053096 | Bacteria | 3346 |
| 208 | Ga0500557_189777 | 3300053105 | Bacteria | 665 |
| 209 | Ga0500562_014504 | 3300053108 | Bacteria | 2017 |
| 210 | Ga0500628_233759 | 3300053129 | Bacteria | 538 |
| 211 | Ga0500568_0015538 | 3300053139 | Bacteria | 3406 |
| 212 | Ga0500616_0000171 | 3300053153 | Bacteria | 108118 |
| 213 | Ga0500622_0183077 | 3300053156 | Bacteria | 966 |
| 214 | Ga0587079_018207 | 3300059647 | Bacteria | 1228 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_0608441 | Ga0436363_0608441_91_405 | 92 |
| 2 | 3300053129 | Ga0500628_233759 | Ga0500628_233759_12_293 | 93 |
| 3 | iso_pu_bacteria | 2713897090 | 2715499430 | 97 |
| 4 | iso_pu_bacteria | 2834578030 | 2834579298 | 97 |
| 5 | iso_pu_bacteria | 2855020534 | 2855020890 | 97 |
| 6 | 3300005335 | Ga0070666_10998012 | Ga0070666_109980122 | 99 |
| 7 | 3300005355 | Ga0070671_100163137 | Ga0070671_1001631372 | 99 |
| 8 | 3300005367 | Ga0070667_100821273 | Ga0070667_1008212732 | 99 |
| 9 | 3300005548 | Ga0070665_100703227 | Ga0070665_1007032272 | 99 |
| 10 | 3300005842 | Ga0068858_101853750 | Ga0068858_1018537502 | 99 |
| 11 | 3300005843 | Ga0068860_101339483 | Ga0068860_1013394832 | 99 |
| 12 | 3300009098 | Ga0105245_10400611 | Ga0105245_104006112 | 99 |
| 13 | 3300009148 | Ga0105243_11715076 | Ga0105243_117150762 | 99 |
| 14 | 3300013306 | Ga0163162_10969375 | Ga0163162_109693752 | 99 |
| 15 | 3300014968 | Ga0157379_12279149 | Ga0157379_122791492 | 99 |
| 16 | 3300014969 | Ga0157376_11481378 | Ga0157376_114813781 | 99 |
| 17 | 3300025931 | Ga0207644_10072994 | Ga0207644_100729946 | 99 |
| 18 | 3300025986 | Ga0207658_11497774 | Ga0207658_114977741 | 99 |
| 19 | 3300026035 | Ga0207703_12382143 | Ga0207703_123821431 | 99 |
| 20 | 3300026121 | Ga0207683_10240739 | Ga0207683_102407394 | 99 |
| 21 | 3300028379 | Ga0268266_11332354 | Ga0268266_113323542 | 99 |
| 22 | 3300028381 | Ga0268264_10270383 | Ga0268264_102703832 | 99 |
| 23 | 3300041451 | Ga0451791_1945811 | Ga0451791_1945811_180_482 | 99 |
| 24 | 3300048904 | Ga0496101_0318608 | Ga0496101_0318608_862_1164 | 99 |
| 25 | 3300048907 | Ga0496104_1336231 | Ga0496104_1336231_238_540 | 99 |
| 26 | 3300048912 | Ga0496109_0864143 | Ga0496109_0864143_521_823 | 99 |
| 27 | 3300048913 | Ga0496110_0058384 | Ga0496110_0058384_1460_1762 | 99 |
| 28 | 3300053139 | Ga0500568_0015538 | Ga0500568_0015538_1324_1626 | 99 |
| 29 | 3300053153 | Ga0500616_0000171 | Ga0500616_0000171_38668_38970 | 99 |
| 30 | iso_pu_bacteria | 2840878972 | 2840883985 | 99 |
| 31 | 3300005353 | Ga0070669_101291914 | Ga0070669_1012919141 | 100 |
| 32 | 3300005466 | Ga0070685_11375965 | Ga0070685_113759651 | 100 |
| 33 | 3300005617 | Ga0068859_100129145 | Ga0068859_1001291456 | 100 |
| 34 | 3300005719 | Ga0068861_100008806 | Ga0068861_10000880610 | 100 |
| 35 | 3300005844 | Ga0068862_101604536 | Ga0068862_1016045362 | 100 |
| 36 | 3300006048 | Ga0075363_100653138 | Ga0075363_1006531382 | 100 |
| 37 | 3300006177 | Ga0075362_10541719 | Ga0075362_105417192 | 100 |
| 38 | 3300006931 | Ga0097620_100129146 | Ga0097620_1001291462 | 100 |
| 39 | 3300009092 | Ga0105250_10627603 | Ga0105250_106276031 | 100 |
| 40 | 3300009101 | Ga0105247_10356271 | Ga0105247_103562712 | 100 |
| 41 | 3300009177 | Ga0105248_10611151 | Ga0105248_106111512 | 100 |
| 42 | 3300009553 | Ga0105249_11823706 | Ga0105249_118237062 | 100 |
| 43 | 3300011119 | Ga0105246_10413206 | Ga0105246_104132062 | 100 |
| 44 | 3300013296 | Ga0157374_11917590 | Ga0157374_119175902 | 100 |
| 45 | 3300014325 | Ga0163163_11525636 | Ga0163163_115256362 | 100 |
| 46 | 3300014325 | Ga0163163_11604010 | Ga0163163_116040102 | 100 |
| 47 | 3300017792 | Ga0163161_10708691 | Ga0163161_107086912 | 100 |
| 48 | 3300025900 | Ga0207710_10608490 | Ga0207710_106084902 | 100 |
| 49 | 3300025933 | Ga0207706_10289810 | Ga0207706_102898105 | 100 |
| 50 | 3300025961 | Ga0207712_10107447 | Ga0207712_101074476 | 100 |
| 51 | 3300025972 | Ga0207668_10124847 | Ga0207668_101248472 | 100 |
| 52 | 3300026118 | Ga0207675_100065945 | Ga0207675_1000659455 | 100 |
| 53 | 3300028380 | Ga0268265_10579223 | Ga0268265_105792232 | 100 |
| 54 | 3300041443 | Ga0451789_0598964 | Ga0451789_0598964_55_360 | 100 |
| 55 | 3300041452 | Ga0451793_0267040 | Ga0451793_0267040_177_482 | 100 |
| 56 | 3300041486 | Ga0451807_1362667 | Ga0451807_1362667_613_918 | 100 |
| 57 | 3300041491 | Ga0451833_0692534 | Ga0451833_0692534_196_501 | 100 |
| 58 | 3300041507 | Ga0451851_0881431 | Ga0451851_0881431_24_329 | 100 |
| 59 | 3300045051 | Ga0451576_1635363 | Ga0451576_1635363_313_618 | 100 |
| 60 | 3300048904 | Ga0496101_0372106 | Ga0496101_0372106_551_856 | 100 |
| 61 | 3300049589 | Ga0501073_0092961 | Ga0501073_0092961_1297_1602 | 100 |
| 62 | 3300050511 | nmdc:mga08y16_211324_c1 | nmdc:mga08y16_211324_c1_1323_1628 | 100 |
| 63 | iso_pu_bacteria | 2643221614 | 2644088888 | 100 |
| 64 | iso_pu_bacteria | 2643221661 | 2644342250 | 100 |
| 65 | iso_pu_bacteria | 2643221666 | 2644369633 | 100 |
| 66 | iso_pu_bacteria | 2857504554 | 2857509527 | 100 |
| 67 | iso_pu_bacteria | 2884960567 | 2884961085 | 100 |
| 68 | 3300032168 | Ga0316593_10308170 | Ga0316593_103081702 | 101 |
| 69 | 3300041445 | Ga0451792_21803 | Ga0451792_21803_282_587 | 101 |
| 70 | 3300041491 | Ga0451833_0831453 | Ga0451833_0831453_250_564 | 101 |
| 71 | 3300049129 | Ga0501309_061698 | Ga0501309_061698_250_558 | 101 |
| 72 | 3300049162 | Ga0501307_072833 | Ga0501307_072833_97_405 | 101 |
| 73 | 3300049527 | Ga0501311_004366 | Ga0501311_004366_160_468 | 101 |
| 74 | 3300049532 | Ga0501316_012659 | Ga0501316_012659_96_404 | 101 |
| 75 | 3300049533 | Ga0501317_046299 | Ga0501317_046299_197_505 | 101 |
| 76 | 3300049539 | Ga0501323_029479 | Ga0501323_029479_39_347 | 101 |
| 77 | 3300005337 | Ga0070682_100903925 | Ga0070682_1009039252 | 103 |
| 78 | 3300032168 | Ga0316593_10001412 | Ga0316593_100014122 | 103 |
| 79 | 3300032168 | Ga0316593_10004451 | Ga0316593_100044517 | 103 |
| 80 | 3300033541 | Ga0316596_1180234 | Ga0316596_11802342 | 103 |
| 81 | 3300035398 | Ga0316574_0425760 | Ga0316574_0425760_202_513 | 103 |
| 82 | 3300039062 | Ga0400483_016797 | Ga0400483_016797_1504_1815 | 103 |
| 83 | 3300039062 | Ga0400483_079140 | Ga0400483_079140_954_1265 | 103 |
| 84 | 3300039062 | Ga0400483_091640 | Ga0400483_091640_363_674 | 103 |
| 85 | 3300039062 | Ga0400483_109729 | Ga0400483_109729_329_640 | 103 |
| 86 | 3300039062 | Ga0400483_159265 | Ga0400483_159265_2693_3004 | 103 |
| 87 | 3300039062 | Ga0400483_267591 | Ga0400483_267591_477_788 | 103 |
| 88 | 3300041997 | Ga0439431_0031081 | Ga0439431_0031081_172_483 | 103 |
| 89 | 3300049571 | Ga0501034_0066063 | Ga0501034_0066063_821_1135 | 103 |
| 90 | 3300003771 | Ga0055526_1027655 | Ga0055526_10276552 | 104 |
| 91 | 3300003773 | Ga0055537_1001243 | Ga0055537_10012439 | 104 |
| 92 | 3300003775 | Ga0055524_1030115 | Ga0055524_10301153 | 104 |
| 93 | 3300003775 | Ga0055524_1039143 | Ga0055524_10391432 | 104 |
| 94 | 3300003781 | Ga0055536_1013860 | Ga0055536_10138606 | 104 |
| 95 | 3300003790 | Ga0055528_1008934 | Ga0055528_10089349 | 104 |
| 96 | 3300003790 | Ga0055528_1029848 | Ga0055528_10298483 | 104 |
| 97 | 3300003791 | Ga0055530_10012052 | Ga0055530_100120526 | 104 |
| 98 | 3300003792 | Ga0055540_1079480 | Ga0055540_10794802 | 104 |
| 99 | 3300003794 | Ga0055531_10011237 | Ga0055531_100112379 | 104 |
| 100 | 3300005289 | Ga0065704_10129280 | Ga0065704_101292805 | 104 |
| 101 | 3300005295 | Ga0065707_10954760 | Ga0065707_109547602 | 104 |
| 102 | 3300005331 | Ga0070670_100231738 | Ga0070670_1002317381 | 104 |
| 103 | 3300005331 | Ga0070670_101071089 | Ga0070670_1010710891 | 104 |
| 104 | 3300005336 | Ga0070680_100006095 | Ga0070680_1000060955 | 104 |
| 105 | 3300005344 | Ga0070661_100858025 | Ga0070661_1008580252 | 104 |
| 106 | 3300005347 | Ga0070668_100023377 | Ga0070668_1000233776 | 104 |
| 107 | 3300005353 | Ga0070669_100294942 | Ga0070669_1002949421 | 104 |
| 108 | 3300005366 | Ga0070659_100050090 | Ga0070659_1000500907 | 104 |
| 109 | 3300005366 | Ga0070659_100131707 | Ga0070659_1001317072 | 104 |
| 110 | 3300005456 | Ga0070678_101837340 | Ga0070678_1018373401 | 104 |
| 111 | 3300005458 | Ga0070681_10042882 | Ga0070681_100428829 | 104 |
| 112 | 3300005458 | Ga0070681_11522658 | Ga0070681_115226582 | 104 |
| 113 | 3300005530 | Ga0070679_100042115 | Ga0070679_1000421156 | 104 |
| 114 | 3300005530 | Ga0070679_100631932 | Ga0070679_1006319322 | 104 |
| 115 | 3300005539 | Ga0068853_100184845 | Ga0068853_1001848453 | 104 |
| 116 | 3300005548 | Ga0070665_100000121 | Ga0070665_100000121158 | 104 |
| 117 | 3300005548 | Ga0070665_100071556 | Ga0070665_1000715568 | 104 |
| 118 | 3300005563 | Ga0068855_100074983 | Ga0068855_1000749836 | 104 |
| 119 | 3300005577 | Ga0068857_100988596 | Ga0068857_1009885962 | 104 |
| 120 | 3300005616 | Ga0068852_101228864 | Ga0068852_1012288642 | 104 |
| 121 | 3300005841 | Ga0068863_100688336 | Ga0068863_1006883362 | 104 |
| 122 | 3300005843 | Ga0068860_100707209 | Ga0068860_1007072092 | 104 |
| 123 | 3300005844 | Ga0068862_100077983 | Ga0068862_1000779835 | 104 |
| 124 | 3300006186 | Ga0075369_10417530 | Ga0075369_104175301 | 104 |
| 125 | 3300006353 | Ga0075370_10070472 | Ga0075370_100704725 | 104 |
| 126 | 3300006353 | Ga0075370_10770990 | Ga0075370_107709901 | 104 |
| 127 | 3300009098 | Ga0105245_10505959 | Ga0105245_105059591 | 104 |
| 128 | 3300009553 | Ga0105249_11007717 | Ga0105249_110077171 | 104 |
| 129 | 3300010375 | Ga0105239_10346341 | Ga0105239_103463412 | 104 |
| 130 | 3300013104 | Ga0157370_10162858 | Ga0157370_101628585 | 104 |
| 131 | 3300014969 | Ga0157376_10517004 | Ga0157376_105170043 | 104 |
| 132 | 3300021384 | Ga0213876_10203589 | Ga0213876_102035893 | 104 |
| 133 | 3300025263 | Ga0209565_1000925 | Ga0209565_100092511 | 104 |
| 134 | 3300025273 | Ga0209673_1002524 | Ga0209673_100252418 | 104 |
| 135 | 3300025291 | Ga0209675_1002569 | Ga0209675_100256915 | 104 |
| 136 | 3300025295 | Ga0209564_1029308 | Ga0209564_10293084 | 104 |
| 137 | 3300025297 | Ga0209758_1017317 | Ga0209758_10173172 | 104 |
| 138 | 3300025298 | Ga0209050_1011548 | Ga0209050_10115483 | 104 |
| 139 | 3300025299 | Ga0209256_1003893 | Ga0209256_100389314 | 104 |
| 140 | 3300025303 | Ga0209051_1000877 | Ga0209051_100087714 | 104 |
| 141 | 3300025899 | Ga0207642_10337355 | Ga0207642_103373551 | 104 |
| 142 | 3300025909 | Ga0207705_10011901 | Ga0207705_100119019 | 104 |
| 143 | 3300025912 | Ga0207707_10091202 | Ga0207707_100912023 | 104 |
| 144 | 3300025912 | Ga0207707_11200566 | Ga0207707_112005662 | 104 |
| 145 | 3300025917 | Ga0207660_10000537 | Ga0207660_1000053716 | 104 |
| 146 | 3300025919 | Ga0207657_10062953 | Ga0207657_100629536 | 104 |
| 147 | 3300025920 | Ga0207649_11407915 | Ga0207649_114079152 | 104 |
| 148 | 3300025921 | Ga0207652_10002134 | Ga0207652_1000213415 | 104 |
| 149 | 3300025924 | Ga0207694_10127710 | Ga0207694_101277102 | 104 |
| 150 | 3300025924 | Ga0207694_10726901 | Ga0207694_107269012 | 104 |
| 151 | 3300025925 | Ga0207650_10513510 | Ga0207650_105135102 | 104 |
| 152 | 3300025925 | Ga0207650_11745367 | Ga0207650_117453672 | 104 |
| 153 | 3300025932 | Ga0207690_10008937 | Ga0207690_100089379 | 104 |
| 154 | 3300025949 | Ga0207667_10015066 | Ga0207667_100150666 | 104 |
| 155 | 3300025961 | Ga0207712_11682184 | Ga0207712_116821842 | 104 |
| 156 | 3300025972 | Ga0207668_10007456 | Ga0207668_100074567 | 104 |
| 157 | 3300026041 | Ga0207639_12127303 | Ga0207639_121273031 | 104 |
| 158 | 3300026041 | Ga0207639_12181211 | Ga0207639_121812111 | 104 |
| 159 | 3300026116 | Ga0207674_10267714 | Ga0207674_102677143 | 104 |
| 160 | 3300026142 | Ga0207698_11875954 | Ga0207698_118759542 | 104 |
| 161 | 3300027360 | Ga0209969_1023032 | Ga0209969_10230322 | 104 |
| 162 | 3300027462 | Ga0210000_1027872 | Ga0210000_10278722 | 104 |
| 163 | 3300027543 | Ga0209999_1001367 | Ga0209999_10013674 | 104 |
| 164 | 3300027665 | Ga0209983_1004172 | Ga0209983_10041726 | 104 |
| 165 | 3300028379 | Ga0268266_10000106 | Ga0268266_100001066 | 104 |
| 166 | 3300028379 | Ga0268266_10355576 | Ga0268266_103555762 | 104 |
| 167 | 3300028380 | Ga0268265_12075552 | Ga0268265_120755521 | 104 |
| 168 | 3300028381 | Ga0268264_10265613 | Ga0268264_102656132 | 104 |
| 169 | 3300031251 | Ga0265327_10005226 | Ga0265327_1000522610 | 104 |
| 170 | 3300031344 | Ga0265316_11302941 | Ga0265316_113029412 | 104 |
| 171 | 3300031548 | Ga0307408_101012702 | Ga0307408_1010127022 | 104 |
| 172 | 3300031711 | Ga0265314_10534402 | Ga0265314_105344021 | 104 |
| 173 | 3300031730 | Ga0307516_10001565 | Ga0307516_1000156532 | 104 |
| 174 | 3300031731 | Ga0307405_11309842 | Ga0307405_113098422 | 104 |
| 175 | 3300031824 | Ga0307413_10002271 | Ga0307413_1000227114 | 104 |
| 176 | 3300031852 | Ga0307410_11872623 | Ga0307410_118726232 | 104 |
| 177 | 3300031911 | Ga0307412_12113251 | Ga0307412_121132512 | 104 |
| 178 | 3300031995 | Ga0307409_102202628 | Ga0307409_1022026282 | 104 |
| 179 | 3300032004 | Ga0307414_10117659 | Ga0307414_101176593 | 104 |
| 180 | 3300032005 | Ga0307411_10706213 | Ga0307411_107062132 | 104 |
| 181 | 3300032126 | Ga0307415_101409803 | Ga0307415_1014098032 | 104 |
| 182 | 3300035083 | Ga0373926_0161622 | Ga0373926_0161622_499_813 | 104 |
| 183 | 3300035112 | Ga0373932_0373893 | Ga0373932_0373893_199_513 | 104 |
| 184 | 3300035171 | Ga0373946_0106332 | Ga0373946_0106332_935_1249 | 104 |
| 185 | 3300035691 | Ga0373931_0664459 | Ga0373931_0664459_57_371 | 104 |
| 186 | 3300035695 | Ga0373927_0000479 | Ga0373927_0000479_24597_24911 | 104 |
| 187 | 3300037068 | Ga0373925_0000023 | Ga0373925_0000023_10692_11006 | 104 |
| 188 | 3300037471 | Ga0395905_0198482 | Ga0395905_0198482_712_1026 | 104 |
| 189 | 3300039437 | Ga0436365_0914855 | Ga0436365_0914855_262_576 | 104 |
| 190 | 3300039450 | Ga0436363_0378877 | Ga0436363_0378877_48_362 | 104 |
| 191 | 3300041406 | Ga0439439_0043653 | Ga0439439_0043653_195_509 | 104 |
| 192 | 3300041456 | Ga0451795_0742986 | Ga0451795_0742986_66_380 | 104 |
| 193 | 3300041486 | Ga0451807_0856399 | Ga0451807_0856399_485_802 | 104 |
| 194 | 3300042012 | Ga0439455_0082145 | Ga0439455_0082145_362_676 | 104 |
| 195 | 3300046460 | Ga0495638_0638508 | Ga0495638_0638508_166_480 | 104 |
| 196 | 3300046473 | Ga0495582_0447483 | Ga0495582_0447483_404_718 | 104 |
| 197 | 3300046500 | Ga0495596_0129622 | Ga0495596_0129622_157_471 | 104 |
| 198 | 3300046528 | Ga0495642_0574303 | Ga0495642_0574303_70_384 | 104 |
| 199 | 3300046616 | Ga0495668_0001818 | Ga0495668_0001818_17772_18086 | 104 |
| 200 | 3300046684 | Ga0495669_0000044 | Ga0495669_0000044_78442_78756 | 104 |
| 201 | 3300047320 | Ga0495672_0023703 | Ga0495672_0023703_2413_2727 | 104 |
| 202 | 3300048909 | Ga0496106_0505943 | Ga0496106_0505943_115_429 | 104 |
| 203 | 3300048914 | Ga0496111_0499245 | Ga0496111_0499245_325_639 | 104 |
| 204 | 3300048918 | Ga0496115_0061666 | Ga0496115_0061666_2505_2819 | 104 |
| 205 | 3300048927 | Ga0496124_0294632 | Ga0496124_0294632_399_713 | 104 |
| 206 | 3300048928 | Ga0496125_0035566 | Ga0496125_0035566_2511_2825 | 104 |
| 207 | 3300048929 | Ga0496126_0196342 | Ga0496126_0196342_980_1294 | 104 |
| 208 | 3300049132 | Ga0501343_008616 | Ga0501343_008616_190_504 | 104 |
| 209 | 3300049161 | Ga0501305_034269 | Ga0501305_034269_19_336 | 104 |
| 210 | 3300049161 | Ga0501305_120697 | Ga0501305_120697_61_375 | 104 |
| 211 | 3300049532 | Ga0501316_021041 | Ga0501316_021041_289_603 | 104 |
| 212 | 3300049534 | Ga0501318_043230 | Ga0501318_043230_264_578 | 104 |
| 213 | 3300049539 | Ga0501323_015869 | Ga0501323_015869_581_895 | 104 |
| 214 | 3300049541 | Ga0501325_047046 | Ga0501325_047046_19_333 | 104 |
| 215 | 3300049551 | Ga0501335_035710 | Ga0501335_035710_181_498 | 104 |
| 216 | 3300049583 | Ga0501067_0302873 | Ga0501067_0302873_263_577 | 104 |
| 217 | 3300050496 | nmdc:mga07m45_71181_c1 | nmdc:mga07m45_71181_c1_954_1268 | 104 |
| 218 | 3300050516 | nmdc:mga0sz30_17058_c1 | nmdc:mga0sz30_17058_c1_666_980 | 104 |
| 219 | 3300053096 | Ga0500641_0010509 | Ga0500641_0010509_2589_2903 | 104 |
| 220 | 3300053105 | Ga0500557_189777 | Ga0500557_189777_52_366 | 104 |
| 221 | 3300053108 | Ga0500562_014504 | Ga0500562_014504_1142_1456 | 104 |
| 222 | 3300053156 | Ga0500622_0183077 | Ga0500622_0183077_485_799 | 104 |
| 223 | 3300059647 | Ga0587079_018207 | Ga0587079_018207_827_1141 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ztj-assembly1.cif.gz_CF | e. coli 70s-rnap expressome complex in nusg-coupled state (38 nt intervening mrna) | 0.8944 | 6 | 37 |
| 8e6x-assembly1.cif.gz_F | escherichia coli rho-dependent transcription pre-termination complex containing 18 nt long rna spacer, lambda-tr1 rut rna, mg-adp-bef3, and nusg; tec part | 0.8806 | 8 | 37 |
| 7qep-assembly1.cif.gz_N6 | cryo-em structure of the ribosome from encephalitozoon cuniculi | 0.8799 | 5 | 74 |
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.8653 | 5 | 73 |
| 4zn1-assembly1.cif.gz_A | crystal structure of mjspt4:spt5 complex conformation a | 0.8578 | 5 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KSV4_613_667_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8653 | 5 | 72 | 2.30.30.30 |
| 4zn1A02 | Mainly Beta;Roll;SH3 type barrels.; | 0.8578 | 5 | 73 | 2.30.30.30 |
| 1jj2S00 | Mainly Beta;Roll;SH3 type barrels.; | 0.8557 | 5 | 74 | 2.30.30.30 |
| af_Q10BA7_272_328_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8291 | 5 | 73 | 2.30.30.30 |
| af_Q90X38_451_500_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8232 | 9 | 72 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A532CNN1-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9874 | 5 | 74 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-F3MUW1-F1-model_v4 | deleted | 0.985 | 5 | 81 |
|
| AF-A0A2Z6T5Z7-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9822 | 5 | 73 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A829D6E2-F1-model_v4 | deleted | 0.9789 | 5 | 75 |
|
| AF-A0A7C7DL97-F1-model_v4 | Large ribosomal subunit protein uL24 (50S ribosomal protein L24) | 0.9783 | 3 | 75 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar