F335318

General Info

Members Datasets Scaffolds Average Seq Length
223 183 214 103

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_101837340|Ga0070678_1018373401
Length 105
Sequence MSAKIRKGDQVVVLTGKDKGRKGSVTKVFPKEQRVLVAGINMVQRHTRPSQGDPQGGIKHKEAPLHLSNVAVVDSKGKPTRVGFKVDGDKKVRIAKTTGEVIANG

Samples

Sample ID Description Type Environment
1 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
2 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
3 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
4 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
5 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
6 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
7 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
8 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
9 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
131 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
132 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
135 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
138 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
177 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
178 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
179 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87
Metatranscriptomes 8.97
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.35
Nodule 0.45
Rhizoplane 6.73
Rhizosphere 68.16
Stem 0
Stem Tuber 0.45
Unclassified 9.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1027655 3300003771 Bacteria 1744
2 Ga0055537_1001243 3300003773 Bacteria 10661
3 Ga0055524_1030115 3300003775 Bacteria 1588
4 Ga0055524_1039143 3300003775 Bacteria 1229
5 Ga0055536_1013860 3300003781 Bacteria 2872
6 Ga0055528_1008934 3300003790 Bacteria 4234
7 Ga0055528_1029848 3300003790 Bacteria 1462
8 Ga0055530_10012052 3300003791 Bacteria 3045
9 Ga0055540_1079480 3300003792 Bacteria 630
10 Ga0055531_10011237 3300003794 Bacteria 4347
11 Ga0065704_10129280 3300005289 Bacteria 1650
12 Ga0065707_10954760 3300005295 Bacteria 551
13 Ga0070670_100231738 3300005331 Bacteria 1607
14 Ga0070670_101071089 3300005331 Bacteria 734
15 Ga0070666_10998012 3300005335 Bacteria 621
16 Ga0070680_100006095 3300005336 Bacteria 9137
17 Ga0070682_100903925 3300005337 Bacteria 726
18 Ga0070661_100858025 3300005344 Bacteria 748
19 Ga0070668_100023377 3300005347 Bacteria 4674
20 Ga0070669_100294942 3300005353 Bacteria 1303
21 Ga0070669_101291914 3300005353 Bacteria 632
22 Ga0070671_100163137 3300005355 Bacteria 1884
23 Ga0070659_100050090 3300005366 Bacteria 3285
24 Ga0070659_100131707 3300005366 Bacteria 2031
25 Ga0070667_100821273 3300005367 Bacteria 863
26 Ga0070678_101837340 3300005456 Bacteria 572
27 Ga0070681_10042882 3300005458 Bacteria 4533
28 Ga0070681_11522658 3300005458 Bacteria 594
29 Ga0070685_11375965 3300005466 Bacteria 541
30 Ga0070679_100042115 3300005530 Bacteria 4547
31 Ga0070679_100631932 3300005530 Bacteria 1014
32 Ga0068853_100184845 3300005539 Bacteria 1891
33 Ga0070665_100000121 3300005548 Bacteria 147683
34 Ga0070665_100071556 3300005548 Bacteria 3474
35 Ga0070665_100703227 3300005548 Bacteria 1024
36 Ga0068855_100074983 3300005563 Bacteria 3928
37 Ga0068857_100988596 3300005577 Bacteria 809
38 Ga0068852_101228864 3300005616 Bacteria 770
39 Ga0068859_100129145 3300005617 Bacteria 2598
40 Ga0068861_100008806 3300005719 Bacteria 6950
41 Ga0068863_100688336 3300005841 Bacteria 1016
42 Ga0068858_101853750 3300005842 Bacteria 596
43 Ga0068860_100707209 3300005843 Bacteria 1017
44 Ga0068860_101339483 3300005843 Bacteria 737
45 Ga0068862_100077983 3300005844 Bacteria 2870
46 Ga0068862_101604536 3300005844 Bacteria 658
47 Ga0075363_100653138 3300006048 Bacteria 633
48 Ga0075362_10541719 3300006177 Bacteria 598
49 Ga0075369_10417530 3300006186 Bacteria 633
50 Ga0075370_10070472 3300006353 Bacteria 1999
51 Ga0075370_10770990 3300006353 Bacteria 586
52 Ga0097620_100129146 3300006931 Bacteria 2598
53 Ga0105250_10627603 3300009092 Bacteria 500
54 Ga0105245_10400611 3300009098 Bacteria 1371
55 Ga0105245_10505959 3300009098 Bacteria 1225
56 Ga0105247_10356271 3300009101 Bacteria 1030
57 Ga0105243_11715076 3300009148 Bacteria 657
58 Ga0105248_10611151 3300009177 Bacteria 1230
59 Ga0105249_11007717 3300009553 Bacteria 902
60 Ga0105249_11823706 3300009553 Bacteria 681
61 Ga0105239_10346341 3300010375 Bacteria 1677
62 Ga0105246_10413206 3300011119 Bacteria 1124
63 Ga0157370_10162858 3300013104 Bacteria 2075
64 Ga0157374_11917590 3300013296 Bacteria 618
65 Ga0163162_10969375 3300013306 Bacteria 961
66 Ga0163163_11525636 3300014325 Bacteria 729
67 Ga0163163_11604010 3300014325 Bacteria 712
68 Ga0157379_12279149 3300014968 Bacteria 539
69 Ga0157376_10517004 3300014969 Bacteria 1176
70 Ga0157376_11481378 3300014969 Bacteria 711
71 Ga0163161_10708691 3300017792 Bacteria 839
72 Ga0213876_10203589 3300021384 Bacteria 1052
73 Ga0209565_1000925 3300025263 Bacteria 15538
74 Ga0209673_1002524 3300025273 Bacteria 12545
75 Ga0209675_1002569 3300025291 Bacteria 9211
76 Ga0209564_1029308 3300025295 Bacteria 1735
77 Ga0209758_1017317 3300025297 Bacteria 3598
78 Ga0209050_1011548 3300025298 Bacteria 4167
79 Ga0209256_1003893 3300025299 Bacteria 9891
80 Ga0209051_1000877 3300025303 Bacteria 30359
81 Ga0207642_10337355 3300025899 Bacteria 885
82 Ga0207710_10608490 3300025900 Bacteria 571
83 Ga0207705_10011901 3300025909 Bacteria 6285
84 Ga0207707_10091202 3300025912 Bacteria 2663
85 Ga0207707_11200566 3300025912 Bacteria 614
86 Ga0207660_10000537 3300025917 Bacteria 25426
87 Ga0207657_10062953 3300025919 Bacteria 3174
88 Ga0207649_11407915 3300025920 Bacteria 552
89 Ga0207652_10002134 3300025921 Bacteria 16964
90 Ga0207694_10127710 3300025924 Bacteria 2035
91 Ga0207694_10726901 3300025924 Bacteria 838
92 Ga0207650_10513510 3300025925 Bacteria 1002
93 Ga0207650_11745367 3300025925 Bacteria 527
94 Ga0207644_10072994 3300025931 Bacteria 2515
95 Ga0207690_10008937 3300025932 Bacteria 5947
96 Ga0207706_10289810 3300025933 Bacteria 1427
97 Ga0207667_10015066 3300025949 Bacteria 8794
98 Ga0207712_10107447 3300025961 Bacteria 2086
99 Ga0207712_11682184 3300025961 Bacteria 569
100 Ga0207668_10007456 3300025972 Bacteria 6507
101 Ga0207668_10124847 3300025972 Bacteria 1955
102 Ga0207658_11497774 3300025986 Bacteria 617
103 Ga0207703_12382143 3300026035 Bacteria 505
104 Ga0207639_12127303 3300026041 Bacteria 522
105 Ga0207639_12181211 3300026041 Bacteria 515
106 Ga0207674_10267714 3300026116 Bacteria 1656
107 Ga0207675_100065945 3300026118 Bacteria 3383
108 Ga0207683_10240739 3300026121 Bacteria 1650
109 Ga0207698_11875954 3300026142 Bacteria 614
110 Ga0209969_1023032 3300027360 Bacteria 933
111 Ga0210000_1027872 3300027462 Bacteria 878
112 Ga0209999_1001367 3300027543 Bacteria 4179
113 Ga0209983_1004172 3300027665 Bacteria 3047
114 Ga0268266_10000106 3300028379 Bacteria 175109
115 Ga0268266_10355576 3300028379 Bacteria 1377
116 Ga0268266_11332354 3300028379 Bacteria 693
117 Ga0268265_10579223 3300028380 Bacteria 1069
118 Ga0268265_12075552 3300028380 Bacteria 575
119 Ga0268264_10265613 3300028381 Bacteria 1601
120 Ga0268264_10270383 3300028381 Bacteria 1588
121 Ga0265327_10005226 3300031251 Bacteria 10946
122 Ga0265316_11302941 3300031344 Bacteria 502
123 Ga0307408_101012702 3300031548 Bacteria 766
124 Ga0265314_10534402 3300031711 Bacteria 612
125 Ga0307516_10001565 3300031730 Bacteria 31484
126 Ga0307405_11309842 3300031731 Bacteria 630
127 Ga0307413_10002271 3300031824 Bacteria 7767
128 Ga0307410_11872623 3300031852 Bacteria 534
129 Ga0307412_12113251 3300031911 Bacteria 523
130 Ga0307409_102202628 3300031995 Bacteria 581
131 Ga0307414_10117659 3300032004 Bacteria 2036
132 Ga0307411_10706213 3300032005 Bacteria 879
133 Ga0307415_101409803 3300032126 Bacteria 664
134 Ga0316593_10001412 3300032168 Bacteria 5277
135 Ga0316593_10004451 3300032168 Bacteria 3599
136 Ga0316593_10308170 3300032168 Bacteria 600
137 Ga0316596_1180234 3300033541 Bacteria 585
138 Ga0373926_0161622 3300035083 Bacteria 855
139 Ga0373932_0373893 3300035112 Bacteria 546
140 Ga0373946_0106332 3300035171 Bacteria 1264
141 Ga0316574_0425760 3300035398 Bacteria 834
142 Ga0373931_0664459 3300035691 Bacteria 686
143 Ga0373927_0000479 3300035695 Bacteria 30749
144 Ga0373925_0000023 3300037068 Bacteria 158881
145 Ga0395905_0198482 3300037471 Bacteria 1881
146 Ga0400483_016797 3300039062 Bacteria 3004
147 Ga0400483_079140 3300039062 Bacteria 6427
148 Ga0400483_091640 3300039062 Bacteria 1098
149 Ga0400483_109729 3300039062 Bacteria 1920
150 Ga0400483_159265 3300039062 Bacteria 3451
151 Ga0400483_267591 3300039062 Bacteria 1859
152 Ga0436365_0914855 3300039437 Bacteria 1035
153 Ga0436363_0378877 3300039450 Bacteria 597
154 Ga0436363_0608441 3300039450 Bacteria 826
155 Ga0439439_0043653 3300041406 Bacteria 1167
156 Ga0451789_0598964 3300041443 Bacteria 536
157 Ga0451792_21803 3300041445 Bacteria 692
158 Ga0451791_1945811 3300041451 Bacteria 574
159 Ga0451793_0267040 3300041452 Bacteria 603
160 Ga0451795_0742986 3300041456 Bacteria 646
161 Ga0451807_0856399 3300041486 Bacteria 930
162 Ga0451807_1362667 3300041486 Bacteria 1002
163 Ga0451833_0692534 3300041491 Bacteria 629
164 Ga0451833_0831453 3300041491 Bacteria 679
165 Ga0451851_0881431 3300041507 Bacteria 829
166 Ga0439431_0031081 3300041997 Bacteria 1326
167 Ga0439455_0082145 3300042012 Bacteria 877
168 Ga0451576_1635363 3300045051 Bacteria 668
169 Ga0495638_0638508 3300046460 Bacteria 519
170 Ga0495582_0447483 3300046473 Bacteria 746
171 Ga0495596_0129622 3300046500 Bacteria 979
172 Ga0495642_0574303 3300046528 Bacteria 501
173 Ga0495668_0001818 3300046616 Bacteria 19364
174 Ga0495669_0000044 3300046684 Bacteria 85633
175 Ga0495672_0023703 3300047320 Bacteria 3967
176 Ga0496101_0318608 3300048904 Bacteria 1220
177 Ga0496101_0372106 3300048904 Bacteria 1124
178 Ga0496104_1336231 3300048907 Bacteria 620
179 Ga0496106_0505943 3300048909 Bacteria 970
180 Ga0496109_0864143 3300048912 Bacteria 842
181 Ga0496110_0058384 3300048913 Bacteria 3399
182 Ga0496111_0499245 3300048914 Bacteria 896
183 Ga0496115_0061666 3300048918 Bacteria 3023
184 Ga0496124_0294632 3300048927 Bacteria 1175
185 Ga0496125_0035566 3300048928 Bacteria 4365
186 Ga0496126_0196342 3300048929 Bacteria 1706
187 Ga0501309_061698 3300049129 Bacteria 604
188 Ga0501343_008616 3300049132 Bacteria 817
189 Ga0501305_034269 3300049161 Bacteria 804
190 Ga0501305_120697 3300049161 Bacteria 503
191 Ga0501307_072833 3300049162 Bacteria 550
192 Ga0501311_004366 3300049527 Bacteria 1502
193 Ga0501316_012659 3300049532 Bacteria 989
194 Ga0501316_021041 3300049532 Bacteria 822
195 Ga0501317_046299 3300049533 Bacteria 679
196 Ga0501318_043230 3300049534 Bacteria 651
197 Ga0501323_015869 3300049539 Bacteria 955
198 Ga0501323_029479 3300049539 Bacteria 764
199 Ga0501325_047046 3300049541 Bacteria 540
200 Ga0501335_035710 3300049551 Bacteria 574
201 Ga0501034_0066063 3300049571 Bacteria 3630
202 Ga0501067_0302873 3300049583 Bacteria 890
203 Ga0501073_0092961 3300049589 Bacteria 2096
204 nmdc:mga07m45_71181_c1 3300050496 Bacteria 1979
205 nmdc:mga08y16_211324_c1 3300050511 Bacteria 2009
206 nmdc:mga0sz30_17058_c1 3300050516 Bacteria 2892
207 Ga0500641_0010509 3300053096 Bacteria 3346
208 Ga0500557_189777 3300053105 Bacteria 665
209 Ga0500562_014504 3300053108 Bacteria 2017
210 Ga0500628_233759 3300053129 Bacteria 538
211 Ga0500568_0015538 3300053139 Bacteria 3406
212 Ga0500616_0000171 3300053153 Bacteria 108118
213 Ga0500622_0183077 3300053156 Bacteria 966
214 Ga0587079_018207 3300059647 Bacteria 1228

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0608441 Ga0436363_0608441_91_405 92
2 3300053129 Ga0500628_233759 Ga0500628_233759_12_293 93
3 iso_pu_bacteria 2713897090 2715499430 97
4 iso_pu_bacteria 2834578030 2834579298 97
5 iso_pu_bacteria 2855020534 2855020890 97
6 3300005335 Ga0070666_10998012 Ga0070666_109980122 99
7 3300005355 Ga0070671_100163137 Ga0070671_1001631372 99
8 3300005367 Ga0070667_100821273 Ga0070667_1008212732 99
9 3300005548 Ga0070665_100703227 Ga0070665_1007032272 99
10 3300005842 Ga0068858_101853750 Ga0068858_1018537502 99
11 3300005843 Ga0068860_101339483 Ga0068860_1013394832 99
12 3300009098 Ga0105245_10400611 Ga0105245_104006112 99
13 3300009148 Ga0105243_11715076 Ga0105243_117150762 99
14 3300013306 Ga0163162_10969375 Ga0163162_109693752 99
15 3300014968 Ga0157379_12279149 Ga0157379_122791492 99
16 3300014969 Ga0157376_11481378 Ga0157376_114813781 99
17 3300025931 Ga0207644_10072994 Ga0207644_100729946 99
18 3300025986 Ga0207658_11497774 Ga0207658_114977741 99
19 3300026035 Ga0207703_12382143 Ga0207703_123821431 99
20 3300026121 Ga0207683_10240739 Ga0207683_102407394 99
21 3300028379 Ga0268266_11332354 Ga0268266_113323542 99
22 3300028381 Ga0268264_10270383 Ga0268264_102703832 99
23 3300041451 Ga0451791_1945811 Ga0451791_1945811_180_482 99
24 3300048904 Ga0496101_0318608 Ga0496101_0318608_862_1164 99
25 3300048907 Ga0496104_1336231 Ga0496104_1336231_238_540 99
26 3300048912 Ga0496109_0864143 Ga0496109_0864143_521_823 99
27 3300048913 Ga0496110_0058384 Ga0496110_0058384_1460_1762 99
28 3300053139 Ga0500568_0015538 Ga0500568_0015538_1324_1626 99
29 3300053153 Ga0500616_0000171 Ga0500616_0000171_38668_38970 99
30 iso_pu_bacteria 2840878972 2840883985 99
31 3300005353 Ga0070669_101291914 Ga0070669_1012919141 100
32 3300005466 Ga0070685_11375965 Ga0070685_113759651 100
33 3300005617 Ga0068859_100129145 Ga0068859_1001291456 100
34 3300005719 Ga0068861_100008806 Ga0068861_10000880610 100
35 3300005844 Ga0068862_101604536 Ga0068862_1016045362 100
36 3300006048 Ga0075363_100653138 Ga0075363_1006531382 100
37 3300006177 Ga0075362_10541719 Ga0075362_105417192 100
38 3300006931 Ga0097620_100129146 Ga0097620_1001291462 100
39 3300009092 Ga0105250_10627603 Ga0105250_106276031 100
40 3300009101 Ga0105247_10356271 Ga0105247_103562712 100
41 3300009177 Ga0105248_10611151 Ga0105248_106111512 100
42 3300009553 Ga0105249_11823706 Ga0105249_118237062 100
43 3300011119 Ga0105246_10413206 Ga0105246_104132062 100
44 3300013296 Ga0157374_11917590 Ga0157374_119175902 100
45 3300014325 Ga0163163_11525636 Ga0163163_115256362 100
46 3300014325 Ga0163163_11604010 Ga0163163_116040102 100
47 3300017792 Ga0163161_10708691 Ga0163161_107086912 100
48 3300025900 Ga0207710_10608490 Ga0207710_106084902 100
49 3300025933 Ga0207706_10289810 Ga0207706_102898105 100
50 3300025961 Ga0207712_10107447 Ga0207712_101074476 100
51 3300025972 Ga0207668_10124847 Ga0207668_101248472 100
52 3300026118 Ga0207675_100065945 Ga0207675_1000659455 100
53 3300028380 Ga0268265_10579223 Ga0268265_105792232 100
54 3300041443 Ga0451789_0598964 Ga0451789_0598964_55_360 100
55 3300041452 Ga0451793_0267040 Ga0451793_0267040_177_482 100
56 3300041486 Ga0451807_1362667 Ga0451807_1362667_613_918 100
57 3300041491 Ga0451833_0692534 Ga0451833_0692534_196_501 100
58 3300041507 Ga0451851_0881431 Ga0451851_0881431_24_329 100
59 3300045051 Ga0451576_1635363 Ga0451576_1635363_313_618 100
60 3300048904 Ga0496101_0372106 Ga0496101_0372106_551_856 100
61 3300049589 Ga0501073_0092961 Ga0501073_0092961_1297_1602 100
62 3300050511 nmdc:mga08y16_211324_c1 nmdc:mga08y16_211324_c1_1323_1628 100
63 iso_pu_bacteria 2643221614 2644088888 100
64 iso_pu_bacteria 2643221661 2644342250 100
65 iso_pu_bacteria 2643221666 2644369633 100
66 iso_pu_bacteria 2857504554 2857509527 100
67 iso_pu_bacteria 2884960567 2884961085 100
68 3300032168 Ga0316593_10308170 Ga0316593_103081702 101
69 3300041445 Ga0451792_21803 Ga0451792_21803_282_587 101
70 3300041491 Ga0451833_0831453 Ga0451833_0831453_250_564 101
71 3300049129 Ga0501309_061698 Ga0501309_061698_250_558 101
72 3300049162 Ga0501307_072833 Ga0501307_072833_97_405 101
73 3300049527 Ga0501311_004366 Ga0501311_004366_160_468 101
74 3300049532 Ga0501316_012659 Ga0501316_012659_96_404 101
75 3300049533 Ga0501317_046299 Ga0501317_046299_197_505 101
76 3300049539 Ga0501323_029479 Ga0501323_029479_39_347 101
77 3300005337 Ga0070682_100903925 Ga0070682_1009039252 103
78 3300032168 Ga0316593_10001412 Ga0316593_100014122 103
79 3300032168 Ga0316593_10004451 Ga0316593_100044517 103
80 3300033541 Ga0316596_1180234 Ga0316596_11802342 103
81 3300035398 Ga0316574_0425760 Ga0316574_0425760_202_513 103
82 3300039062 Ga0400483_016797 Ga0400483_016797_1504_1815 103
83 3300039062 Ga0400483_079140 Ga0400483_079140_954_1265 103
84 3300039062 Ga0400483_091640 Ga0400483_091640_363_674 103
85 3300039062 Ga0400483_109729 Ga0400483_109729_329_640 103
86 3300039062 Ga0400483_159265 Ga0400483_159265_2693_3004 103
87 3300039062 Ga0400483_267591 Ga0400483_267591_477_788 103
88 3300041997 Ga0439431_0031081 Ga0439431_0031081_172_483 103
89 3300049571 Ga0501034_0066063 Ga0501034_0066063_821_1135 103
90 3300003771 Ga0055526_1027655 Ga0055526_10276552 104
91 3300003773 Ga0055537_1001243 Ga0055537_10012439 104
92 3300003775 Ga0055524_1030115 Ga0055524_10301153 104
93 3300003775 Ga0055524_1039143 Ga0055524_10391432 104
94 3300003781 Ga0055536_1013860 Ga0055536_10138606 104
95 3300003790 Ga0055528_1008934 Ga0055528_10089349 104
96 3300003790 Ga0055528_1029848 Ga0055528_10298483 104
97 3300003791 Ga0055530_10012052 Ga0055530_100120526 104
98 3300003792 Ga0055540_1079480 Ga0055540_10794802 104
99 3300003794 Ga0055531_10011237 Ga0055531_100112379 104
100 3300005289 Ga0065704_10129280 Ga0065704_101292805 104
101 3300005295 Ga0065707_10954760 Ga0065707_109547602 104
102 3300005331 Ga0070670_100231738 Ga0070670_1002317381 104
103 3300005331 Ga0070670_101071089 Ga0070670_1010710891 104
104 3300005336 Ga0070680_100006095 Ga0070680_1000060955 104
105 3300005344 Ga0070661_100858025 Ga0070661_1008580252 104
106 3300005347 Ga0070668_100023377 Ga0070668_1000233776 104
107 3300005353 Ga0070669_100294942 Ga0070669_1002949421 104
108 3300005366 Ga0070659_100050090 Ga0070659_1000500907 104
109 3300005366 Ga0070659_100131707 Ga0070659_1001317072 104
110 3300005456 Ga0070678_101837340 Ga0070678_1018373401 104
111 3300005458 Ga0070681_10042882 Ga0070681_100428829 104
112 3300005458 Ga0070681_11522658 Ga0070681_115226582 104
113 3300005530 Ga0070679_100042115 Ga0070679_1000421156 104
114 3300005530 Ga0070679_100631932 Ga0070679_1006319322 104
115 3300005539 Ga0068853_100184845 Ga0068853_1001848453 104
116 3300005548 Ga0070665_100000121 Ga0070665_100000121158 104
117 3300005548 Ga0070665_100071556 Ga0070665_1000715568 104
118 3300005563 Ga0068855_100074983 Ga0068855_1000749836 104
119 3300005577 Ga0068857_100988596 Ga0068857_1009885962 104
120 3300005616 Ga0068852_101228864 Ga0068852_1012288642 104
121 3300005841 Ga0068863_100688336 Ga0068863_1006883362 104
122 3300005843 Ga0068860_100707209 Ga0068860_1007072092 104
123 3300005844 Ga0068862_100077983 Ga0068862_1000779835 104
124 3300006186 Ga0075369_10417530 Ga0075369_104175301 104
125 3300006353 Ga0075370_10070472 Ga0075370_100704725 104
126 3300006353 Ga0075370_10770990 Ga0075370_107709901 104
127 3300009098 Ga0105245_10505959 Ga0105245_105059591 104
128 3300009553 Ga0105249_11007717 Ga0105249_110077171 104
129 3300010375 Ga0105239_10346341 Ga0105239_103463412 104
130 3300013104 Ga0157370_10162858 Ga0157370_101628585 104
131 3300014969 Ga0157376_10517004 Ga0157376_105170043 104
132 3300021384 Ga0213876_10203589 Ga0213876_102035893 104
133 3300025263 Ga0209565_1000925 Ga0209565_100092511 104
134 3300025273 Ga0209673_1002524 Ga0209673_100252418 104
135 3300025291 Ga0209675_1002569 Ga0209675_100256915 104
136 3300025295 Ga0209564_1029308 Ga0209564_10293084 104
137 3300025297 Ga0209758_1017317 Ga0209758_10173172 104
138 3300025298 Ga0209050_1011548 Ga0209050_10115483 104
139 3300025299 Ga0209256_1003893 Ga0209256_100389314 104
140 3300025303 Ga0209051_1000877 Ga0209051_100087714 104
141 3300025899 Ga0207642_10337355 Ga0207642_103373551 104
142 3300025909 Ga0207705_10011901 Ga0207705_100119019 104
143 3300025912 Ga0207707_10091202 Ga0207707_100912023 104
144 3300025912 Ga0207707_11200566 Ga0207707_112005662 104
145 3300025917 Ga0207660_10000537 Ga0207660_1000053716 104
146 3300025919 Ga0207657_10062953 Ga0207657_100629536 104
147 3300025920 Ga0207649_11407915 Ga0207649_114079152 104
148 3300025921 Ga0207652_10002134 Ga0207652_1000213415 104
149 3300025924 Ga0207694_10127710 Ga0207694_101277102 104
150 3300025924 Ga0207694_10726901 Ga0207694_107269012 104
151 3300025925 Ga0207650_10513510 Ga0207650_105135102 104
152 3300025925 Ga0207650_11745367 Ga0207650_117453672 104
153 3300025932 Ga0207690_10008937 Ga0207690_100089379 104
154 3300025949 Ga0207667_10015066 Ga0207667_100150666 104
155 3300025961 Ga0207712_11682184 Ga0207712_116821842 104
156 3300025972 Ga0207668_10007456 Ga0207668_100074567 104
157 3300026041 Ga0207639_12127303 Ga0207639_121273031 104
158 3300026041 Ga0207639_12181211 Ga0207639_121812111 104
159 3300026116 Ga0207674_10267714 Ga0207674_102677143 104
160 3300026142 Ga0207698_11875954 Ga0207698_118759542 104
161 3300027360 Ga0209969_1023032 Ga0209969_10230322 104
162 3300027462 Ga0210000_1027872 Ga0210000_10278722 104
163 3300027543 Ga0209999_1001367 Ga0209999_10013674 104
164 3300027665 Ga0209983_1004172 Ga0209983_10041726 104
165 3300028379 Ga0268266_10000106 Ga0268266_100001066 104
166 3300028379 Ga0268266_10355576 Ga0268266_103555762 104
167 3300028380 Ga0268265_12075552 Ga0268265_120755521 104
168 3300028381 Ga0268264_10265613 Ga0268264_102656132 104
169 3300031251 Ga0265327_10005226 Ga0265327_1000522610 104
170 3300031344 Ga0265316_11302941 Ga0265316_113029412 104
171 3300031548 Ga0307408_101012702 Ga0307408_1010127022 104
172 3300031711 Ga0265314_10534402 Ga0265314_105344021 104
173 3300031730 Ga0307516_10001565 Ga0307516_1000156532 104
174 3300031731 Ga0307405_11309842 Ga0307405_113098422 104
175 3300031824 Ga0307413_10002271 Ga0307413_1000227114 104
176 3300031852 Ga0307410_11872623 Ga0307410_118726232 104
177 3300031911 Ga0307412_12113251 Ga0307412_121132512 104
178 3300031995 Ga0307409_102202628 Ga0307409_1022026282 104
179 3300032004 Ga0307414_10117659 Ga0307414_101176593 104
180 3300032005 Ga0307411_10706213 Ga0307411_107062132 104
181 3300032126 Ga0307415_101409803 Ga0307415_1014098032 104
182 3300035083 Ga0373926_0161622 Ga0373926_0161622_499_813 104
183 3300035112 Ga0373932_0373893 Ga0373932_0373893_199_513 104
184 3300035171 Ga0373946_0106332 Ga0373946_0106332_935_1249 104
185 3300035691 Ga0373931_0664459 Ga0373931_0664459_57_371 104
186 3300035695 Ga0373927_0000479 Ga0373927_0000479_24597_24911 104
187 3300037068 Ga0373925_0000023 Ga0373925_0000023_10692_11006 104
188 3300037471 Ga0395905_0198482 Ga0395905_0198482_712_1026 104
189 3300039437 Ga0436365_0914855 Ga0436365_0914855_262_576 104
190 3300039450 Ga0436363_0378877 Ga0436363_0378877_48_362 104
191 3300041406 Ga0439439_0043653 Ga0439439_0043653_195_509 104
192 3300041456 Ga0451795_0742986 Ga0451795_0742986_66_380 104
193 3300041486 Ga0451807_0856399 Ga0451807_0856399_485_802 104
194 3300042012 Ga0439455_0082145 Ga0439455_0082145_362_676 104
195 3300046460 Ga0495638_0638508 Ga0495638_0638508_166_480 104
196 3300046473 Ga0495582_0447483 Ga0495582_0447483_404_718 104
197 3300046500 Ga0495596_0129622 Ga0495596_0129622_157_471 104
198 3300046528 Ga0495642_0574303 Ga0495642_0574303_70_384 104
199 3300046616 Ga0495668_0001818 Ga0495668_0001818_17772_18086 104
200 3300046684 Ga0495669_0000044 Ga0495669_0000044_78442_78756 104
201 3300047320 Ga0495672_0023703 Ga0495672_0023703_2413_2727 104
202 3300048909 Ga0496106_0505943 Ga0496106_0505943_115_429 104
203 3300048914 Ga0496111_0499245 Ga0496111_0499245_325_639 104
204 3300048918 Ga0496115_0061666 Ga0496115_0061666_2505_2819 104
205 3300048927 Ga0496124_0294632 Ga0496124_0294632_399_713 104
206 3300048928 Ga0496125_0035566 Ga0496125_0035566_2511_2825 104
207 3300048929 Ga0496126_0196342 Ga0496126_0196342_980_1294 104
208 3300049132 Ga0501343_008616 Ga0501343_008616_190_504 104
209 3300049161 Ga0501305_034269 Ga0501305_034269_19_336 104
210 3300049161 Ga0501305_120697 Ga0501305_120697_61_375 104
211 3300049532 Ga0501316_021041 Ga0501316_021041_289_603 104
212 3300049534 Ga0501318_043230 Ga0501318_043230_264_578 104
213 3300049539 Ga0501323_015869 Ga0501323_015869_581_895 104
214 3300049541 Ga0501325_047046 Ga0501325_047046_19_333 104
215 3300049551 Ga0501335_035710 Ga0501335_035710_181_498 104
216 3300049583 Ga0501067_0302873 Ga0501067_0302873_263_577 104
217 3300050496 nmdc:mga07m45_71181_c1 nmdc:mga07m45_71181_c1_954_1268 104
218 3300050516 nmdc:mga0sz30_17058_c1 nmdc:mga0sz30_17058_c1_666_980 104
219 3300053096 Ga0500641_0010509 Ga0500641_0010509_2589_2903 104
220 3300053105 Ga0500557_189777 Ga0500557_189777_52_366 104
221 3300053108 Ga0500562_014504 Ga0500562_014504_1142_1456 104
222 3300053156 Ga0500622_0183077 Ga0500622_0183077_485_799 104
223 3300059647 Ga0587079_018207 Ga0587079_018207_827_1141 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

7

37

0.98

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

40

102

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ztj-assembly1.cif.gz_CF e. coli 70s-rnap expressome complex in nusg-coupled state (38 nt intervening mrna) 0.8944 6 37
8e6x-assembly1.cif.gz_F escherichia coli rho-dependent transcription pre-termination complex containing 18 nt long rna spacer, lambda-tr1 rut rna, mg-adp-bef3, and nusg; tec part 0.8806 8 37
7qep-assembly1.cif.gz_N6 cryo-em structure of the ribosome from encephalitozoon cuniculi 0.8799 5 74
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.8653 5 73
4zn1-assembly1.cif.gz_A crystal structure of mjspt4:spt5 complex conformation a 0.8578 5 73
ID Description Score Start End Superfamily
af_C6KSV4_613_667_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8653 5 72 2.30.30.30
4zn1A02 Mainly Beta;Roll;SH3 type barrels.; 0.8578 5 73 2.30.30.30
1jj2S00 Mainly Beta;Roll;SH3 type barrels.; 0.8557 5 74 2.30.30.30
af_Q10BA7_272_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8291 5 73 2.30.30.30
af_Q90X38_451_500_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8232 9 72 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A532CNN1-F1-model_v4 Large ribosomal subunit protein uL24 0.9874 5 74 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-F3MUW1-F1-model_v4 deleted 0.985 5 81
AF-A0A2Z6T5Z7-F1-model_v4 Large ribosomal subunit protein uL24 0.9822 5 73 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A829D6E2-F1-model_v4 deleted 0.9789 5 75
AF-A0A7C7DL97-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9783 3 75 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
80.35 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map