F335308

General Info

Members Datasets Scaffolds Average Seq Length
223 140 446 137

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100000811|Ga0070708_10000081116
Length 147
Sequence VTARAGRERLRAGKLAVGQTFETVVVTDLKRTQIVQYAGASGDYNPLHTDEIYATKIAGYPSVFAHGMLTMGLTGQAIAGLAGTESLVRFGVRFTAQVWPGDTLTVRTSVERITETEGGPVAEFAVSTVNAEGREVLSGYAHAQVAD

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
77 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.24
Metatranscriptomes 10.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0
Rhizoplane 0.45
Rhizosphere 92.83
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100000811 3300005445 Bacteria 23595
2 Ga0058863_11373007 3300004799 Bacteria 583
3 Ga0058862_12686328 3300004803 Bacteria 922
4 Ga0070658_10000173 3300005327 Bacteria 56301
5 Ga0070658_10015359 3300005327 Bacteria 6128
6 Ga0070683_100211586 3300005329 Bacteria 1842
7 Ga0068868_100544247 3300005338 Bacteria 1022
8 Ga0068868_101678765 3300005338 Bacteria 598
9 Ga0070660_100432968 3300005339 Bacteria 1090
10 Ga0070689_101584368 3300005340 Bacteria 594
11 Ga0070687_100657032 3300005343 Unclassified 727
12 Ga0070668_100091761 3300005347 Bacteria 2395
13 Ga0070674_100377501 3300005356 Bacteria 1152
14 Ga0070673_101986873 3300005364 Bacteria 552
15 Ga0070688_100109368 3300005365 Bacteria 1836
16 Ga0070659_100591262 3300005366 Bacteria 953
17 Ga0070667_100484904 3300005367 Bacteria 1132
18 Ga0070714_100279571 3300005435 Bacteria 1550
19 Ga0070714_100655531 3300005435 Unclassified 1011
20 Ga0070713_100090971 3300005436 Bacteria 2624
21 Ga0070708_100002342 3300005445 Bacteria 14665
22 Ga0070708_100004490 3300005445 Bacteria 10975
23 Ga0070708_100041543 3300005445 Bacteria 4032
24 Ga0070708_100886205 3300005445 Unclassified 838
25 Ga0070681_10963044 3300005458 Bacteria 773
26 Ga0068867_100628161 3300005459 Bacteria 940
27 Ga0068867_101974425 3300005459 Bacteria 551
28 Ga0070685_10494068 3300005466 Unclassified 865
29 Ga0070706_100001584 3300005467 Bacteria 23710
30 Ga0070706_100004589 3300005467 Bacteria 13256
31 Ga0070706_100006260 3300005467 Bacteria 11258
32 Ga0070706_100156124 3300005467 Bacteria 2130
33 Ga0070706_100941789 3300005467 Bacteria 797
34 Ga0070707_100001089 3300005468 Bacteria 26861
35 Ga0070707_100010076 3300005468 Bacteria 8799
36 Ga0070707_100013204 3300005468 Bacteria 7721
37 Ga0070698_100026817 3300005471 Bacteria 5992
38 Ga0070698_100043156 3300005471 Bacteria 4625
39 Ga0070698_100126945 3300005471 Bacteria 2508
40 Ga0070699_100000149 3300005518 Bacteria 66121
41 Ga0070699_100000673 3300005518 Bacteria 31957
42 Ga0070699_100884414 3300005518 Bacteria 818
43 Ga0070679_100023284 3300005530 Bacteria 6060
44 Ga0070679_100210019 3300005530 Bacteria 1911
45 Ga0070697_100000167 3300005536 Bacteria 53390
46 Ga0070697_100000856 3300005536 Bacteria 22876
47 Ga0070697_100454465 3300005536 Bacteria 1116
48 Ga0070686_100143770 3300005544 Bacteria 1663
49 Ga0070704_100216109 3300005549 Bacteria 1556
50 Ga0070704_101508595 3300005549 Bacteria 618
51 Ga0068855_100782155 3300005563 Bacteria 1015
52 Ga0070702_100074791 3300005615 Bacteria 2011
53 Ga0068859_100900995 3300005617 Bacteria 969
54 Ga0068861_100427156 3300005719 Unclassified 1182
55 Ga0068870_11102357 3300005840 Bacteria 571
56 Ga0068858_100032657 3300005842 Bacteria 4833
57 Ga0068860_100543756 3300005843 Unclassified 1163
58 Ga0068862_100123266 3300005844 Bacteria 2286
59 Ga0068862_100314639 3300005844 Bacteria 1443
60 Ga0068862_101019702 3300005844 Bacteria 819
61 Ga0081455_10005115 3300005937 Bacteria 14462
62 Ga0081455_10254768 3300005937 Bacteria 1281
63 Ga0081538_10001751 3300005981 Bacteria 22032
64 Ga0081539_10000724 3300005985 Bacteria 66085
65 Ga0081539_10090989 3300005985 Unclassified 1577
66 Ga0070717_10007751 3300006028 Bacteria 7987
67 Ga0070717_10030737 3300006028 Bacteria 4315
68 Ga0070717_10034495 3300006028 Bacteria 4091
69 Ga0075365_10505933 3300006038 Bacteria 854
70 Ga0075364_10777437 3300006051 Bacteria 653
71 Ga0075432_10452391 3300006058 Unclassified 564
72 Ga0075432_10537369 3300006058 Bacteria 526
73 Ga0070712_101374586 3300006175 Unclassified 616
74 Ga0075427_10031182 3300006194 Unclassified 876
75 Ga0068871_100724905 3300006358 Bacteria 912
76 Ga0075428_100142804 3300006844 Unclassified 2602
77 Ga0075428_100490527 3300006844 Bacteria 1315
78 Ga0075428_101092098 3300006844 Bacteria 843
79 Ga0075430_100146747 3300006846 Bacteria 1965
80 Ga0075430_100397459 3300006846 Unclassified 1137
81 Ga0075431_100475565 3300006847 Bacteria 1243
82 Ga0075431_100684854 3300006847 Unclassified 1004
83 Ga0075431_100988464 3300006847 Bacteria 809
84 Ga0075433_11489890 3300006852 Unclassified 584
85 Ga0075429_100112494 3300006880 Unclassified 2379
86 Ga0075429_101766757 3300006880 Unclassified 537
87 Ga0097620_100901127 3300006931 Bacteria 969
88 Ga0105240_10988565 3300009093 Bacteria 901
89 Ga0111539_10120914 3300009094 Unclassified 3068
90 Ga0111539_10734099 3300009094 Bacteria 1150
91 Ga0105245_10471424 3300009098 Bacteria 1267
92 Ga0105245_11633754 3300009098 Bacteria 696
93 Ga0114129_10086740 3300009147 Bacteria 4341
94 Ga0114129_10259812 3300009147 Bacteria 2328
95 Ga0114129_11224795 3300009147 Bacteria 934
96 Ga0105242_13216783 3300009176 Bacteria 507
97 Ga0105248_11373487 3300009177 Bacteria 799
98 Ga0105249_10108498 3300009553 Bacteria 2621
99 Ga0105239_11856805 3300010375 Bacteria 698
100 Ga0105246_10889085 3300011119 Bacteria 798
101 Ga0157370_10522819 3300013104 Bacteria 1089
102 Ga0157369_10053039 3300013105 Bacteria 4384
103 Ga0157374_11554798 3300013296 Bacteria 685
104 Ga0163162_10104435 3300013306 Bacteria 2928
105 Ga0163162_11013926 3300013306 Bacteria 939
106 Ga0157372_10599317 3300013307 Bacteria 1284
107 Ga0157372_10956118 3300013307 Bacteria 993
108 Ga0157375_10790785 3300013308 Bacteria 1098
109 Ga0157375_10870116 3300013308 Bacteria 1047
110 Ga0157375_11746971 3300013308 Bacteria 737
111 Ga0163163_10754782 3300014325 Bacteria 1036
112 Ga0157380_10092037 3300014326 Bacteria 2505
113 Ga0157380_10406808 3300014326 Bacteria 1293
114 Ga0157380_12933499 3300014326 Bacteria 543
115 Ga0157379_10203280 3300014968 Bacteria 1792
116 Ga0157376_10476513 3300014969 Bacteria 1222
117 Ga0157376_11620453 3300014969 Bacteria 682
118 Ga0163161_10326371 3300017792 Bacteria 1214
119 Ga0163161_11406389 3300017792 Bacteria 609
120 Ga0197907_10081677 3300020069 Bacteria 9184
121 Ga0197907_10110697 3300020069 Bacteria 1294
122 Ga0197907_10653064 3300020069 Bacteria 668
123 Ga0206356_11752650 3300020070 Bacteria 595
124 Ga0206356_11754511 3300020070 Bacteria 736
125 Ga0206349_1319532 3300020075 Bacteria 5663
126 Ga0206349_1460652 3300020075 Bacteria 522
127 Ga0206355_1398601 3300020076 Bacteria 2136
128 Ga0206351_10130621 3300020077 Bacteria 743
129 Ga0206352_10624062 3300020078 Bacteria 1315
130 Ga0206352_10992324 3300020078 Bacteria 553
131 Ga0206350_10552383 3300020080 Bacteria 766
132 Ga0206354_11116001 3300020081 Bacteria 4601
133 Ga0206354_11706654 3300020081 Bacteria 634
134 Ga0206353_10028015 3300020082 Unclassified 848
135 Ga0206353_10241518 3300020082 Bacteria 1461
136 Ga0206353_10500064 3300020082 Bacteria 588
137 Ga0213875_10000174 3300021388 Bacteria 67979
138 Ga0213875_10000791 3300021388 Bacteria 23625
139 Ga0213875_10058941 3300021388 Bacteria 1797
140 Ga0224712_10004474 3300022467 Bacteria 3777
141 Ga0224712_10023774 3300022467 Bacteria 2132
142 Ga0224712_10193414 3300022467 Bacteria 922
143 Ga0207705_10000209 3300025909 Bacteria 59476
144 Ga0207705_10636690 3300025909 Bacteria 829
145 Ga0207684_10001617 3300025910 Bacteria 23917
146 Ga0207684_10001662 3300025910 Bacteria 23646
147 Ga0207684_10006874 3300025910 Bacteria 10295
148 Ga0207684_10303019 3300025910 Bacteria 1378
149 Ga0207695_10466099 3300025913 Bacteria 1146
150 Ga0207660_10075674 3300025917 Bacteria 2460
151 Ga0207657_10479167 3300025919 Bacteria 975
152 Ga0207652_10078046 3300025921 Bacteria 2891
153 Ga0207652_10160697 3300025921 Bacteria 2014
154 Ga0207646_10000168 3300025922 Bacteria 88816
155 Ga0207646_10003579 3300025922 Bacteria 17436
156 Ga0207681_11085513 3300025923 Bacteria 672
157 Ga0207700_10121409 3300025928 Bacteria 2119
158 Ga0207700_10860059 3300025928 Bacteria 811
159 Ga0207686_10117277 3300025934 Bacteria 1806
160 Ga0207704_10448254 3300025938 Bacteria 1029
161 Ga0207704_10753583 3300025938 Bacteria 810
162 Ga0207691_10420110 3300025940 Bacteria 1139
163 Ga0207711_10779671 3300025941 Bacteria 891
164 Ga0207667_10158702 3300025949 Bacteria 2327
165 Ga0207651_10617037 3300025960 Bacteria 950
166 Ga0207712_10778839 3300025961 Bacteria 840
167 Ga0207677_10309931 3300026023 Bacteria 1307
168 Ga0207677_10592459 3300026023 Bacteria 972
169 Ga0207708_10283997 3300026075 Bacteria 1342
170 Ga0207648_10559005 3300026089 Bacteria 1052
171 Ga0207675_100164595 3300026118 Unclassified 2117
172 Ga0207675_100816289 3300026118 Bacteria 947
173 Ga0207428_10110511 3300027907 Unclassified 2116
174 Ga0207428_10310675 3300027907 Unclassified 1165
175 Ga0207428_10642573 3300027907 Unclassified 762
176 Ga0268265_10282974 3300028380 Bacteria 1485
177 Ga0268265_10457089 3300028380 Bacteria 1194
178 Ga0307416_101877341 3300032002 Bacteria 703
179 Ga0307411_11751423 3300032005 Bacteria 576
180 Ga0307415_100645630 3300032126 Bacteria 948
181 Ga0395905_0397565 3300037471 Bacteria 1273
182 Ga0436364_0676163 3300037853 Bacteria 64006
183 Ga0436364_0781217 3300037853 Bacteria 28481
184 Ga0436364_1413652 3300037853 Bacteria 11065
185 Ga0395901_1111832 3300038443 Bacteria 760
186 Ga0436365_0262328 3300039437 Bacteria 994
187 Ga0436365_1729435 3300039437 Bacteria 1386
188 Ga0436363_0577090 3300039450 Bacteria 2104
189 Ga0436363_0589707 3300039450 Bacteria 744
190 Ga0436362_0180915 3300039453 Unclassified 800
191 Ga0439448_0196924 3300042005 Bacteria 706
192 Ga0439440_0114547 3300042993 Bacteria 745
193 Ga0453683_0025140 3300044673 Bacteria 3785
194 Ga0495580_0689926 3300046472 Bacteria 669
195 Ga0495618_0431045 3300046514 Unclassified 803
196 Ga0495628_0089922 3300046516 Bacteria 2377
197 Ga0495600_0730562 3300046809 Bacteria 594
198 Ga0496115_0417639 3300048918 Bacteria 1087
199 Ga0501040_1095454 3300049576 Bacteria 578
200 Ga0501040_1194144 3300049576 Bacteria 552
201 Ga0501041_0195955 3300049577 Bacteria 1266
202 Ga0501076_0110944 3300049592 Bacteria 2217
203 Ga0501076_0530799 3300049592 Bacteria 970
204 Ga0501249_150443 3300049679 Bacteria 585
205 Ga0501080_1877370 3300049742 Bacteria 502
206 Ga0501045_0928144 3300049824 Bacteria 639
207 nmdc:mga0yw44_485591_c1 3300050492 Bacteria 838
208 nmdc:mga06z11_247659_c1 3300050494 Bacteria 1048
209 nmdc:mga04h51_540863_c1 3300050495 Bacteria 501
210 nmdc:mga05p37_1486265_c1 3300050507 Bacteria 676
211 nmdc:mga05p37_22918_c1 3300050507 Bacteria 7574
212 nmdc:mga05p37_432037_c1 3300050507 Unclassified 1530
213 nmdc:mga05p37_686401_c1 3300050507 Bacteria 1140
214 nmdc:mga09592_29289_c1 3300050508 Bacteria 4579
215 nmdc:mga09592_769290_c1 3300050508 Bacteria 816
216 nmdc:mga0qj67_555975_c1 3300050509 Bacteria 920
217 nmdc:mga0qj67_62805_c1 3300050509 Bacteria 2952
218 nmdc:mga06r32_181447_c1 3300050510 Unclassified 2091
219 nmdc:mga0a205_273385_c1 3300050515 Unclassified 1566
220 Ga0495595_0098899 3300053084 Bacteria 1406
221 Ga0495619_0128341 3300053085 Unclassified 1742
222 Ga0587073_0287204 3300059492 Bacteria 530
223 Ga0587082_075680 3300059504 Bacteria 692
224 Ga0070708_100000811
225 Ga0058863_11373007
226 Ga0058862_12686328
227 Ga0070658_10000173
228 Ga0070658_10015359
229 Ga0070683_100211586
230 Ga0068868_100544247
231 Ga0068868_101678765
232 Ga0070660_100432968
233 Ga0070689_101584368
234 Ga0070687_100657032
235 Ga0070668_100091761
236 Ga0070674_100377501
237 Ga0070673_101986873
238 Ga0070688_100109368
239 Ga0070659_100591262
240 Ga0070667_100484904
241 Ga0070714_100279571
242 Ga0070714_100655531
243 Ga0070713_100090971
244 Ga0070708_100002342
245 Ga0070708_100004490
246 Ga0070708_100041543
247 Ga0070708_100886205
248 Ga0070681_10963044
249 Ga0068867_100628161
250 Ga0068867_101974425
251 Ga0070685_10494068
252 Ga0070706_100001584
253 Ga0070706_100004589
254 Ga0070706_100006260
255 Ga0070706_100156124
256 Ga0070706_100941789
257 Ga0070707_100001089
258 Ga0070707_100010076
259 Ga0070707_100013204
260 Ga0070698_100026817
261 Ga0070698_100043156
262 Ga0070698_100126945
263 Ga0070699_100000149
264 Ga0070699_100000673
265 Ga0070699_100884414
266 Ga0070679_100023284
267 Ga0070679_100210019
268 Ga0070697_100000167
269 Ga0070697_100000856
270 Ga0070697_100454465
271 Ga0070686_100143770
272 Ga0070704_100216109
273 Ga0070704_101508595
274 Ga0068855_100782155
275 Ga0070702_100074791
276 Ga0068859_100900995
277 Ga0068861_100427156
278 Ga0068870_11102357
279 Ga0068858_100032657
280 Ga0068860_100543756
281 Ga0068862_100123266
282 Ga0068862_100314639
283 Ga0068862_101019702
284 Ga0081455_10005115
285 Ga0081455_10254768
286 Ga0081538_10001751
287 Ga0081539_10000724
288 Ga0081539_10090989
289 Ga0070717_10007751
290 Ga0070717_10030737
291 Ga0070717_10034495
292 Ga0075365_10505933
293 Ga0075364_10777437
294 Ga0075432_10452391
295 Ga0075432_10537369
296 Ga0070712_101374586
297 Ga0075427_10031182
298 Ga0068871_100724905
299 Ga0075428_100142804
300 Ga0075428_100490527
301 Ga0075428_101092098
302 Ga0075430_100146747
303 Ga0075430_100397459
304 Ga0075431_100475565
305 Ga0075431_100684854
306 Ga0075431_100988464
307 Ga0075433_11489890
308 Ga0075429_100112494
309 Ga0075429_101766757
310 Ga0097620_100901127
311 Ga0105240_10988565
312 Ga0111539_10120914
313 Ga0111539_10734099
314 Ga0105245_10471424
315 Ga0105245_11633754
316 Ga0114129_10086740
317 Ga0114129_10259812
318 Ga0114129_11224795
319 Ga0105242_13216783
320 Ga0105248_11373487
321 Ga0105249_10108498
322 Ga0105239_11856805
323 Ga0105246_10889085
324 Ga0157370_10522819
325 Ga0157369_10053039
326 Ga0157374_11554798
327 Ga0163162_10104435
328 Ga0163162_11013926
329 Ga0157372_10599317
330 Ga0157372_10956118
331 Ga0157375_10790785
332 Ga0157375_10870116
333 Ga0157375_11746971
334 Ga0163163_10754782
335 Ga0157380_10092037
336 Ga0157380_10406808
337 Ga0157380_12933499
338 Ga0157379_10203280
339 Ga0157376_10476513
340 Ga0157376_11620453
341 Ga0163161_10326371
342 Ga0163161_11406389
343 Ga0197907_10081677
344 Ga0197907_10110697
345 Ga0197907_10653064
346 Ga0206356_11752650
347 Ga0206356_11754511
348 Ga0206349_1319532
349 Ga0206349_1460652
350 Ga0206355_1398601
351 Ga0206351_10130621
352 Ga0206352_10624062
353 Ga0206352_10992324
354 Ga0206350_10552383
355 Ga0206354_11116001
356 Ga0206354_11706654
357 Ga0206353_10028015
358 Ga0206353_10241518
359 Ga0206353_10500064
360 Ga0213875_10000174
361 Ga0213875_10000791
362 Ga0213875_10058941
363 Ga0224712_10004474
364 Ga0224712_10023774
365 Ga0224712_10193414
366 Ga0207705_10000209
367 Ga0207705_10636690
368 Ga0207684_10001617
369 Ga0207684_10001662
370 Ga0207684_10006874
371 Ga0207684_10303019
372 Ga0207695_10466099
373 Ga0207660_10075674
374 Ga0207657_10479167
375 Ga0207652_10078046
376 Ga0207652_10160697
377 Ga0207646_10000168
378 Ga0207646_10003579
379 Ga0207681_11085513
380 Ga0207700_10121409
381 Ga0207700_10860059
382 Ga0207686_10117277
383 Ga0207704_10448254
384 Ga0207704_10753583
385 Ga0207691_10420110
386 Ga0207711_10779671
387 Ga0207667_10158702
388 Ga0207651_10617037
389 Ga0207712_10778839
390 Ga0207677_10309931
391 Ga0207677_10592459
392 Ga0207708_10283997
393 Ga0207648_10559005
394 Ga0207675_100164595
395 Ga0207675_100816289
396 Ga0207428_10110511
397 Ga0207428_10310675
398 Ga0207428_10642573
399 Ga0268265_10282974
400 Ga0268265_10457089
401 Ga0307416_101877341
402 Ga0307411_11751423
403 Ga0307415_100645630
404 Ga0395905_0397565
405 Ga0436364_0676163
406 Ga0436364_0781217
407 Ga0436364_1413652
408 Ga0395901_1111832
409 Ga0436365_0262328
410 Ga0436365_1729435
411 Ga0436363_0577090
412 Ga0436363_0589707
413 Ga0436362_0180915
414 Ga0439448_0196924
415 Ga0439440_0114547
416 Ga0453683_0025140
417 Ga0495580_0689926
418 Ga0495618_0431045
419 Ga0495628_0089922
420 Ga0495600_0730562
421 Ga0496115_0417639
422 Ga0501040_1095454
423 Ga0501040_1194144
424 Ga0501041_0195955
425 Ga0501076_0110944
426 Ga0501076_0530799
427 Ga0501249_150443
428 Ga0501080_1877370
429 Ga0501045_0928144
430 nmdc:mga0yw44_485591_c1
431 nmdc:mga06z11_247659_c1
432 nmdc:mga04h51_540863_c1
433 nmdc:mga05p37_1486265_c1
434 nmdc:mga05p37_22918_c1
435 nmdc:mga05p37_432037_c1
436 nmdc:mga05p37_686401_c1
437 nmdc:mga09592_29289_c1
438 nmdc:mga09592_769290_c1
439 nmdc:mga0qj67_555975_c1
440 nmdc:mga0qj67_62805_c1
441 nmdc:mga06r32_181447_c1
442 nmdc:mga0a205_273385_c1
443 Ga0495595_0098899
444 Ga0495619_0128341
445 Ga0587073_0287204
446 Ga0587082_075680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

13

131

0.9

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

15

138

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f1t-assembly1.cif.gz_C crystal structure of the q9i3c8_pseae protein from pseudomonas aeruginosa. northeast structural genomics consortium target par319a. 0.8844 80 138
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8558 6 141
3lw3-assembly1.cif.gz_A crystal structure of hp0420-homologue from helicobacter felis 0.8535 81 139
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8506 2 139
3lwg-assembly1.cif.gz_A crystal structure of hp0420-homologue c46a from helicobacter felis 0.8458 81 139
ID Description Score Start End Superfamily
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8855 81 140 3.10.129.10
af_Q5A0N4_66_202_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8734 81 136 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8693 80 141 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8558 6 141 3.10.129.10
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8534 2 139 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A381TUT8-F1-model_v4 MaoC-like domain-containing protein 0.9421 3 141
AF-A0A0S7YLT6-F1-model_v4 Acyl dehydratase 0.9337 4 140 GO:0006633
GO:0019171
AF-A0A2E8KUA5-F1-model_v4 Acyl dehydratase (MaoC-like dehydratase) 0.9335 3 141
AF-A0A1E3PM05-F1-model_v4 Thioesterase domain-containing protein 0.9301 81 138 GO:0016020
AF-A0A381TUT8-F1-model_v4 MaoC-like domain-containing protein 0.929 3 141

Map