F335077

General Info

Members Datasets Scaffolds Average Seq Length
222 168 444 385

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2946045630|2946050210
Length 447
Sequence AGAEAESGSGTGAEPGKGSETGTETTATGATTGTVAGAGAMTGARVTEAVTTTVNVDVDVDVRGTVAPGFEPVADAFVRNFEQRGERGAAVAVYRHGRKVVDLWAGTRDVDGVEPWAVDTVQIVRSAGKGIAAAVPLLLHQRGQVDLDAPVSTYWPEFKTNGKERVLVRDLLAHRAGVPALDTPLTPAEAADGVSGPAAVAAQRPQWEPGTDHGYHAQTYSWLIGELVRRATGRTIGRWIAEEIARPLGLDFWFGLPADEAHRIGRIGPVEPPVTGTASGALRVRAKRSVVEAYRDPDSLTRRAFGAIDPFPDENDPAYRAAELPASGGIATARGLARCYAAMIGPVDGHRRLFAPATLTLARTEESAGPDRVLVVNTRFGLGYMLHGPAAPLLGPGSFGHPGRGGSLGFADPESGIALGYVTNGLQKGVTADPRAQALVRAVRSAL

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
7 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
8 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
9 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
10 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
11 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
12 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
16 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
17 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
23 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
24 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
27 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
28 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
29 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
30 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
31 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
32 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
33 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
34 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
35 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
36 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
37 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
38 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
39 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
40 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
41 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
42 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
43 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
44 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
45 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
46 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
47 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
58 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
59 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
60 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
61 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
62 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
63 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
66 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
67 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
68 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
75 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
89 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
90 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
116 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
117 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
118 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
119 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
123 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
124 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
125 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
126 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
127 2643221548 Streptomyces sp. Root55 Isolate Unclassified
128 2643221578 Streptomyces sp. Root63 Isolate Unclassified
129 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
130 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
131 2643221615 Nocardioides sp. Root224 Isolate Unclassified
132 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
133 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
134 2643221670 Streptomyces sp. Root431 Isolate Unclassified
135 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
136 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
137 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
138 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
139 2643221714 Streptomyces sp. Root264 Isolate Unclassified
140 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
141 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
142 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
143 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
144 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
145 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
146 2867475112 Streptomyces sp. TM32 Isolate Unclassified
147 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
148 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
149 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
150 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
151 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
152 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
153 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
154 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
155 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
156 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
157 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
158 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
159 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
160 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
161 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
162 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
163 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
164 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
165 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
166 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
167 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
168 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.58
Metatranscriptomes 2.25
Isolates 21.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0
Rhizoplane 1.8
Rhizosphere 76.58
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10020138 3300003316 Bacteria 2438
2 rootL2_10037970 3300003322 Bacteria 10429
3 rootH1_10001367 3300003323 Bacteria 3180
4 rootH1_10099789 3300003323 Bacteria 1485
5 Ga0006562J51391_1072225 3300003578 Bacteria 9060
6 Ga0006562J51391_1072226 3300003578 Bacteria 10520
7 Ga0006562J51391_1218549 3300003578 Bacteria 3726
8 Ga0006562J51391_1218550 3300003578 Bacteria 3580
9 Ga0070708_100012177 3300005445 Bacteria 7012
10 Ga0070697_100164080 3300005536 Bacteria 1878
11 Ga0075363_100020515 3300006048 Bacteria 3316
12 Ga0111539_10068938 3300009094 Bacteria 4176
13 Ga0105245_10124592 3300009098 Bacteria 2410
14 Ga0105243_10024590 3300009148 Bacteria 4595
15 Ga0105248_10151765 3300009177 Bacteria 2614
16 Ga0105237_10118955 3300009545 Bacteria 2636
17 Ga0105239_10078432 3300010375 Bacteria 3635
18 Ga0105246_10000444 3300011119 Bacteria 22194
19 Ga0157376_10312911 3300014969 Bacteria 1490
20 Ga0213876_10004019 3300021384 Bacteria 8274
21 Ga0224712_10031931 3300022467 Unclassified 1915
22 Ga0207426_1000399 3300025302 Bacteria 73628
23 Ga0207426_1001348 3300025302 Bacteria 20858
24 Ga0207426_1002109 3300025302 Bacteria 13660
25 Ga0207713_1052180 3300025735 Bacteria 1621
26 Ga0207687_10175970 3300025927 Bacteria 1654
27 Ga0207711_10133949 3300025941 Bacteria 2224
28 Ga0207711_10201136 3300025941 Bacteria 1818
29 Ga0209970_1003138 3300027614 Unclassified 2790
30 Ga0209974_10010065 3300027876 Bacteria 3197
31 Ga0307511_10061378 3300030521 Bacteria 2865
32 Ga0307513_10007083 3300031456 Bacteria 14579
33 Ga0307509_10016949 3300031507 Bacteria 8402
34 Ga0307410_10075295 3300031852 Bacteria 2353
35 Ga0307407_10041486 3300031903 Bacteria 2574
36 Ga0307409_100026705 3300031995 Bacteria 4077
37 Ga0307416_100121402 3300032002 Bacteria 2330
38 Ga0307416_100282975 3300032002 Bacteria 1636
39 Ga0307507_10063764 3300033179 Bacteria 3407
40 Ga0395898_0158306 3300037466 Bacteria 2166
41 Ga0436365_0753577 3300039437 Bacteria 16246
42 Ga0451793_0912327 3300041452 Bacteria 3326
43 Ga0451853_2943456 3300041512 Bacteria 1417
44 Ga0439433_0012652 3300041999 Bacteria 1851
45 Ga0439432_031460 3300042006 Bacteria 1716
46 Ga0439449_0042916 3300042007 Bacteria 1680
47 Ga0439457_001962 3300042014 Bacteria 6052
48 Ga0450900_003173 3300042136 Bacteria 1807
49 Ga0439458_0017648 3300042157 Bacteria 1632
50 Ga0466972_0002289 3300044658 Bacteria 9410
51 Ga0466972_0009071 3300044658 Bacteria 4996
52 Ga0466965_0034108 3300044683 Bacteria 2489
53 Ga0466966_0014018 3300044684 Bacteria 5306
54 Ga0466961_0001336 3300044693 Bacteria 15199
55 Ga0466961_0003838 3300044693 Bacteria 9403
56 Ga0466961_0090487 3300044693 Bacteria 1932
57 Ga0466963_0057856 3300044694 Bacteria 2583
58 Ga0466964_0008479 3300044706 Bacteria 3864
59 Ga0466971_0003441 3300044719 Bacteria 6765
60 Ga0466971_0021500 3300044719 Bacteria 2871
61 Ga0466968_0007041 3300044735 Bacteria 4263
62 Ga0466968_0066770 3300044735 Bacteria 1558
63 Ga0466970_0002176 3300044765 Bacteria 9466
64 Ga0466970_0009457 3300044765 Bacteria 4928
65 Ga0466970_0032460 3300044765 Bacteria 2758
66 Ga0466957_0005119 3300044842 Bacteria 7324
67 Ga0466959_0032446 3300045049 Bacteria 3865
68 Ga0466967_0099727 3300045976 Bacteria 2653
69 Ga0495592_0004815 3300046454 Bacteria 9924
70 Ga0495603_0001370 3300046455 Bacteria 14157
71 Ga0495603_0002153 3300046455 Bacteria 11585
72 Ga0495603_0004517 3300046455 Bacteria 8303
73 Ga0495629_0003785 3300046459 Bacteria 11394
74 Ga0495629_0007890 3300046459 Bacteria 7831
75 Ga0495629_0012106 3300046459 Bacteria 6254
76 Ga0495629_0042304 3300046459 Bacteria 3202
77 Ga0495651_0022675 3300046462 Bacteria 4879
78 Ga0495651_0023935 3300046462 Bacteria 4750
79 Ga0495605_0036453 3300046474 Bacteria 2480
80 Ga0495662_0003541 3300046476 Bacteria 7890
81 Ga0495664_0015253 3300046477 Bacteria 4365
82 Ga0495585_0017754 3300046492 Bacteria 4108
83 Ga0495594_0000491 3300046499 Bacteria 20171
84 Ga0495594_0044786 3300046499 Bacteria 2428
85 Ga0495618_0022479 3300046514 Bacteria 3895
86 Ga0495628_0053095 3300046516 Bacteria 3200
87 Ga0495628_0208010 3300046516 Bacteria 1472
88 Ga0495630_0057419 3300046517 Bacteria 2917
89 Ga0495631_0038652 3300046518 Bacteria 2121
90 Ga0495643_0090278 3300046522 Bacteria 1581
91 Ga0495644_0049094 3300046523 Bacteria 1585
92 Ga0495652_0048453 3300046529 Bacteria 3641
93 Ga0495652_0216610 3300046529 Bacteria 1441
94 Ga0495640_0003126 3300046533 Bacteria 13351
95 Ga0495640_0040288 3300046533 Bacteria 3272
96 Ga0495587_0014437 3300046536 Bacteria 4954
97 Ga0495622_0009074 3300046557 Bacteria 4605
98 Ga0495634_0004159 3300046642 Bacteria 11433
99 Ga0495634_0006733 3300046642 Bacteria 8706
100 Ga0495611_0043493 3300046648 Bacteria 2008
101 Ga0495625_0031961 3300046660 Bacteria 3910
102 Ga0495588_0047506 3300046674 Bacteria 2204
103 Ga0495657_0030761 3300046675 Bacteria 3756
104 Ga0495613_0000624 3300046689 Bacteria 28151
105 Ga0495613_0002838 3300046689 Bacteria 12995
106 Ga0495613_0055002 3300046689 Bacteria 2925
107 Ga0495624_0032956 3300046690 Bacteria 3357
108 Ga0495670_0112946 3300046691 Bacteria 1407
109 Ga0495589_0057843 3300046794 Bacteria 1906
110 Ga0495600_0016798 3300046809 Bacteria 4652
111 Ga0495581_0027962 3300047315 Bacteria 3270
112 Ga0495604_0005238 3300047317 Bacteria 10271
113 Ga0495604_0008324 3300047317 Bacteria 8202
114 Ga0495604_0008925 3300047317 Bacteria 7924
115 Ga0495636_0033528 3300047318 Bacteria 2110
116 Ga0495636_0056626 3300047318 Bacteria 1651
117 Ga0495636_0063973 3300047318 Bacteria 1560
118 Ga0495674_0166402 3300047319 Bacteria 1842
119 Ga0495676_0051734 3300047321 Bacteria 3283
120 Ga0495676_0054997 3300047321 Bacteria 3159
121 Ga0495676_0091335 3300047321 Bacteria 2276
122 Ga0495676_0154790 3300047321 Bacteria 1627
123 Ga0495683_0017664 3300047323 Bacteria 3695
124 Ga0495675_0016641 3300047444 Bacteria 4650
125 Ga0495675_0168971 3300047444 Bacteria 1344
126 Ga0495685_002387 3300047447 Bacteria 5877
127 Ga0495685_003637 3300047447 Bacteria 4929
128 Ga0495684_0035950 3300047471 Bacteria 3798
129 Ga0495593_0002842 3300047673 Bacteria 10430
130 Ga0495614_0000061 3300048089 Bacteria 34474
131 Ga0495614_0001224 3300048089 Bacteria 11044
132 Ga0496102_0120232 3300048905 Bacteria 2453
133 Ga0496109_0021831 3300048912 Bacteria 5666
134 Ga0496109_0040296 3300048912 Bacteria 4231
135 Ga0496126_0002303 3300048929 Bacteria 26254
136 Ga0501031_0004140 3300049568 Bacteria 9368
137 Ga0501031_0099955 3300049568 Bacteria 1893
138 Ga0501032_0071035 3300049569 Bacteria 2321
139 Ga0501033_0001491 3300049570 Bacteria 20728
140 Ga0501033_0020298 3300049570 Bacteria 5019
141 Ga0501034_0011945 3300049571 Bacteria 8975
142 Ga0501034_0070078 3300049571 Bacteria 3518
143 Ga0501034_0119019 3300049571 Bacteria 2628
144 Ga0501034_0124161 3300049571 Bacteria 2567
145 Ga0501036_0006127 3300049572 Bacteria 9759
146 Ga0501036_0128058 3300049572 Bacteria 2144
147 Ga0501037_0019818 3300049573 Bacteria 4963
148 Ga0501037_0188235 3300049573 Bacteria 1462
149 Ga0501039_0117261 3300049575 Bacteria 2085
150 Ga0501041_0018298 3300049577 Bacteria 4174
151 Ga0501042_0050967 3300049578 Bacteria 2953
152 Ga0501046_0081979 3300049580 Bacteria 2491
153 Ga0501047_0000093 3300049581 Bacteria 110613
154 Ga0501047_0034518 3300049581 Bacteria 4884
155 Ga0501047_0034845 3300049581 Bacteria 4860
156 Ga0501047_0212909 3300049581 Bacteria 1790
157 Ga0501070_0001472 3300049586 Bacteria 21104
158 Ga0501070_0079035 3300049586 Bacteria 2722
159 Ga0501071_0186038 3300049587 Bacteria 1557
160 Ga0501075_0039968 3300049591 Bacteria 3512
161 Ga0501079_0151897 3300049741 Bacteria 1805
162 Ga0501080_0016427 3300049742 Bacteria 6835
163 Ga0501035_0025564 3300049822 Bacteria 5411
164 Ga0501035_0281964 3300049822 Bacteria 1404
165 Ga0501044_0041460 3300049823 Bacteria 4792
166 Ga0501044_0057854 3300049823 Bacteria 3977
167 Ga0501044_0094159 3300049823 Bacteria 3020
168 Ga0501044_0115292 3300049823 Bacteria 2692
169 Ga0500640_088374 3300053095 Bacteria 1302
170 Ga0500553_053447 3300053101 Bacteria 1928
171 Ga0500593_000596 3300053117 Bacteria 13870
172 Ga0500573_0007156 3300053140 Bacteria 6072
173 Ga0500624_010181 3300053157 Bacteria 1350
174 Ga0501082_0164812 3300060353 Bacteria 1926
175 Ga0466962_0003384 3300061719 Bacteria 7591
176 2946050210 2946045630 Bacteria 8527308
177 2554258057 2554235005 Bacteria 6457341
178 2585300128 2582581312 Bacteria 7308206
179 2585318765 2582581314 Bacteria 11452267
180 2616903987 2616644941 Bacteria 8510691
181 2643765687 2643221548 Bacteria 8053412
182 2643898520 2643221578 Bacteria 9213798
183 2643948257 2643221587 Bacteria 7586415
184 2644013640 2643221601 Bacteria 7493239
185 2644093414 2643221615 Bacteria 5487866
186 2644178730 2643221631 Bacteria 8168043
187 2644323024 2643221657 Bacteria 5490246
188 2644388781 2643221670 Bacteria 6497041
189 2644406436 2643221673 Bacteria 9196637
190 2644429730 2643221677 Bacteria 7584031
191 2644436984 2643221678 Bacteria 9540101
192 2644459799 2643221682 Bacteria 6743283
193 2644628731 2643221714 Bacteria 9015452
194 2785343525 2784746763 Bacteria 9783172
195 2785369280 2784746768 Bacteria 10036182
196 2808841882 2808606359 Bacteria 9866990
197 2811848802 2808606982 Bacteria 7791042
198 2819697931 2818991463 Bacteria 7948711
199 2862179564 2862178590 Bacteria 8583590
200 2867478222 2867475112 Bacteria 6909112
201 2873155921 2873151551 Bacteria 8625867
202 2875394399 2875391855 Bacteria 7600475
203 2912720261 2912715099 Bacteria 9460473
204 2912724484 2912723979 Bacteria 8557534
205 2912760546 2912757875 Bacteria 7940295
206 2918504366 2918501144 Bacteria 8668083
207 2919469674 2919468124 Bacteria 9133025
208 2946075755 2946072368 Bacteria 8999607
209 2966602718 2966598605 Bacteria 7676064
210 2990062042 2990059506 Bacteria 9321252
211 2997455962 2997451912 Bacteria 8492419
212 3006393397 3006393351 Bacteria 6615579
213 3006428540 3006425503 Bacteria 6491253
214 3006490958 3006486233 Bacteria 8157040
215 8008578998 8008574985 Bacteria 7815457
216 8025485138 8025478263 Bacteria 8209203
217 8025536585 8025530807 Bacteria 8495698
218 8048410224 8048406513 Bacteria 8936924
219 8054164096 8054160619 Bacteria 7783213
220 8056450162 8056447290 Bacteria 7680491
221 8056671920 8056667051 Bacteria 6953971
222 8056833728 8056829672 Bacteria 9045328
223 rootH1_10020138
224 rootL2_10037970
225 rootH1_10001367
226 rootH1_10099789
227 Ga0006562J51391_1072225
228 Ga0006562J51391_1072226
229 Ga0006562J51391_1218549
230 Ga0006562J51391_1218550
231 Ga0070708_100012177
232 Ga0070697_100164080
233 Ga0075363_100020515
234 Ga0111539_10068938
235 Ga0105245_10124592
236 Ga0105243_10024590
237 Ga0105248_10151765
238 Ga0105237_10118955
239 Ga0105239_10078432
240 Ga0105246_10000444
241 Ga0157376_10312911
242 Ga0213876_10004019
243 Ga0224712_10031931
244 Ga0207426_1000399
245 Ga0207426_1001348
246 Ga0207426_1002109
247 Ga0207713_1052180
248 Ga0207687_10175970
249 Ga0207711_10133949
250 Ga0207711_10201136
251 Ga0209970_1003138
252 Ga0209974_10010065
253 Ga0307511_10061378
254 Ga0307513_10007083
255 Ga0307509_10016949
256 Ga0307410_10075295
257 Ga0307407_10041486
258 Ga0307409_100026705
259 Ga0307416_100121402
260 Ga0307416_100282975
261 Ga0307507_10063764
262 Ga0395898_0158306
263 Ga0436365_0753577
264 Ga0451793_0912327
265 Ga0451853_2943456
266 Ga0439433_0012652
267 Ga0439432_031460
268 Ga0439449_0042916
269 Ga0439457_001962
270 Ga0450900_003173
271 Ga0439458_0017648
272 Ga0466972_0002289
273 Ga0466972_0009071
274 Ga0466965_0034108
275 Ga0466966_0014018
276 Ga0466961_0001336
277 Ga0466961_0003838
278 Ga0466961_0090487
279 Ga0466963_0057856
280 Ga0466964_0008479
281 Ga0466971_0003441
282 Ga0466971_0021500
283 Ga0466968_0007041
284 Ga0466968_0066770
285 Ga0466970_0002176
286 Ga0466970_0009457
287 Ga0466970_0032460
288 Ga0466957_0005119
289 Ga0466959_0032446
290 Ga0466967_0099727
291 Ga0495592_0004815
292 Ga0495603_0001370
293 Ga0495603_0002153
294 Ga0495603_0004517
295 Ga0495629_0003785
296 Ga0495629_0007890
297 Ga0495629_0012106
298 Ga0495629_0042304
299 Ga0495651_0022675
300 Ga0495651_0023935
301 Ga0495605_0036453
302 Ga0495662_0003541
303 Ga0495664_0015253
304 Ga0495585_0017754
305 Ga0495594_0000491
306 Ga0495594_0044786
307 Ga0495618_0022479
308 Ga0495628_0053095
309 Ga0495628_0208010
310 Ga0495630_0057419
311 Ga0495631_0038652
312 Ga0495643_0090278
313 Ga0495644_0049094
314 Ga0495652_0048453
315 Ga0495652_0216610
316 Ga0495640_0003126
317 Ga0495640_0040288
318 Ga0495587_0014437
319 Ga0495622_0009074
320 Ga0495634_0004159
321 Ga0495634_0006733
322 Ga0495611_0043493
323 Ga0495625_0031961
324 Ga0495588_0047506
325 Ga0495657_0030761
326 Ga0495613_0000624
327 Ga0495613_0002838
328 Ga0495613_0055002
329 Ga0495624_0032956
330 Ga0495670_0112946
331 Ga0495589_0057843
332 Ga0495600_0016798
333 Ga0495581_0027962
334 Ga0495604_0005238
335 Ga0495604_0008324
336 Ga0495604_0008925
337 Ga0495636_0033528
338 Ga0495636_0056626
339 Ga0495636_0063973
340 Ga0495674_0166402
341 Ga0495676_0051734
342 Ga0495676_0054997
343 Ga0495676_0091335
344 Ga0495676_0154790
345 Ga0495683_0017664
346 Ga0495675_0016641
347 Ga0495675_0168971
348 Ga0495685_002387
349 Ga0495685_003637
350 Ga0495684_0035950
351 Ga0495593_0002842
352 Ga0495614_0000061
353 Ga0495614_0001224
354 Ga0496102_0120232
355 Ga0496109_0021831
356 Ga0496109_0040296
357 Ga0496126_0002303
358 Ga0501031_0004140
359 Ga0501031_0099955
360 Ga0501032_0071035
361 Ga0501033_0001491
362 Ga0501033_0020298
363 Ga0501034_0011945
364 Ga0501034_0070078
365 Ga0501034_0119019
366 Ga0501034_0124161
367 Ga0501036_0006127
368 Ga0501036_0128058
369 Ga0501037_0019818
370 Ga0501037_0188235
371 Ga0501039_0117261
372 Ga0501041_0018298
373 Ga0501042_0050967
374 Ga0501046_0081979
375 Ga0501047_0000093
376 Ga0501047_0034518
377 Ga0501047_0034845
378 Ga0501047_0212909
379 Ga0501070_0001472
380 Ga0501070_0079035
381 Ga0501071_0186038
382 Ga0501075_0039968
383 Ga0501079_0151897
384 Ga0501080_0016427
385 Ga0501035_0025564
386 Ga0501035_0281964
387 Ga0501044_0041460
388 Ga0501044_0057854
389 Ga0501044_0094159
390 Ga0501044_0115292
391 Ga0500640_088374
392 Ga0500553_053447
393 Ga0500593_000596
394 Ga0500573_0007156
395 Ga0500624_010181
396 Ga0501082_0164812
397 Ga0466962_0003384
398 2946050210
399 2554258057
400 2585300128
401 2585318765
402 2616903987
403 2643765687
404 2643898520
405 2643948257
406 2644013640
407 2644093414
408 2644178730
409 2644323024
410 2644388781
411 2644406436
412 2644429730
413 2644436984
414 2644459799
415 2644628731
416 2785343525
417 2785369280
418 2808841882
419 2811848802
420 2819697931
421 2862179564
422 2867478222
423 2873155921
424 2875394399
425 2912720261
426 2912724484
427 2912760546
428 2918504366
429 2919469674
430 2946075755
431 2966602718
432 2990062042
433 2997455962
434 3006393397
435 3006428540
436 3006490958
437 8008578998
438 8025485138
439 8025536585
440 8048410224
441 8054164096
442 8056450162
443 8056671920
444 8056833728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

73

443

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y3z-assembly2.cif.gz_A structure of a novel carboxylesterase feh from acinetobacter sp. dl-2 0.8729 2 361
3zyt-assembly1.cif.gz_A structure determination of esta from arthrobacter nitroguajacolicus rue61a 0.8683 1 363
3zyt-assembly1.cif.gz_A structure determination of esta from arthrobacter nitroguajacolicus rue61a 0.866 1 363
7y3z-assembly2.cif.gz_A structure of a novel carboxylesterase feh from acinetobacter sp. dl-2 0.8637 2 361
5gkv-assembly1.cif.gz_A crystal structure of a novel penicillin-binding protein (pbp) homolog from caulobacter crescentus 0.8455 2 360
ID Description Score Start End Superfamily
3zytA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8683 1 363 3.40.710.10
af_Q18384_35_423_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8662 2 363 3.40.710.10
3zytA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.866 1 363 3.40.710.10
af_Q18384_35_423_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8617 2 363 3.40.710.10
af_Q9XU43_37_429_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8524 1 363 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A6I5CGA5-F1-model_v4 Serine hydrolase 0.9957 278 362 GO:0016787
AF-A0A6G3XVS4-F1-model_v4 Beta-lactamase family protein 0.9883 254 360
AF-A0A6G3XVS4-F1-model_v4 Beta-lactamase family protein 0.9703 254 360
AF-G2GC46-F1-model_v4 Serine hydrolase 0.9688 254 363 GO:0016787
AF-A0A4Z0HAU5-F1-model_v4 Class A beta-lactamase-related serine hydrolase 0.9631 200 363 GO:0016787

Map