F335026

General Info

Members Datasets Scaffolds Average Seq Length
222 133 444 464

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0010652|Ga0501082_0010652_1866_3455
Length 529
Sequence MSPPRVVAVAPGSPAARAGLAEGDEVVSVNGEVPRDLLEWRTLVDDALLGIELRRGGLETTVSVDKRAGEPLGVEVHSALFDRVRTCDNHCEFCFIYQLPPGLRRSLYLKDDDYRLSFLYGNFTTLTRFTEADLERVLAEGLSPLYVSIHATDPRLRAEMLRNRRGATSLRWLRALLDHGVEVHGQVVVCPGVNDGAALDATLAGVLDRYPELASVCVVPLGVSRFNAEARMRPHTAAEAAAVVDAVADWQDVFLGVLGHRLVFAADEYYLLAGRPFPPAADYGEFPMYEDGIGMARAFEAELLGTAPARRDDDPDRGGFFRDADGATSAPGTRTNPTPGAHQWRAGTAAGGCTVVGLAAGXGGDHTRADGSGSSGADYEPYRAVRATGHQLVQLAPSRRAPVAILTAPYGAQVLEPLVAALDLGPQVRIVTVGNRYFGGNVGVSGLMVGDDLARVLADQPEGHRYLLPDVCLTQGRFLDGTAPGDLPRPVEVVPTDGRALRAALGVPAAAGAERGAGVVAATGPGGRA

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
57 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
58 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
64 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
68 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.71
Nodule 0
Rhizoplane 1.35
Rhizosphere 81.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0010652 3300060353 Bacteria 7915
2 JGI25407J50210_10000110 3300003373 Bacteria 11569
3 Ga0070661_100045901 3300005344 Bacteria 3195
4 Ga0070671_100005222 3300005355 Bacteria 10349
5 Ga0070714_100070474 3300005435 Bacteria 3022
6 Ga0068867_100022933 3300005459 Bacteria 4466
7 Ga0070706_100023648 3300005467 Bacteria 5657
8 Ga0068854_100117160 3300005578 Bacteria 2017
9 Ga0068863_100135091 3300005841 Bacteria 2356
10 Ga0068858_100060009 3300005842 Bacteria 3516
11 Ga0068860_100009030 3300005843 Bacteria 9923
12 Ga0068860_100288243 3300005843 Bacteria 1606
13 Ga0068862_100050917 3300005844 Bacteria 3541
14 Ga0081455_10002923 3300005937 Bacteria 20048
15 Ga0081455_10006732 3300005937 Bacteria 12271
16 Ga0081538_10000294 3300005981 Bacteria 57425
17 Ga0081538_10002497 3300005981 Bacteria 17915
18 Ga0075365_10004048 3300006038 Bacteria 7694
19 Ga0075365_10005046 3300006038 Bacteria 7082
20 Ga0075365_10021913 3300006038 Bacteria 3994
21 Ga0075365_10054415 3300006038 Bacteria 2654
22 Ga0075363_100023341 3300006048 Bacteria 3134
23 Ga0075364_10006005 3300006051 Bacteria 7098
24 Ga0075364_10021183 3300006051 Bacteria 4095
25 Ga0075364_10063203 3300006051 Bacteria 2430
26 Ga0075362_10024696 3300006177 Bacteria 2551
27 Ga0075367_10150326 3300006178 Bacteria 1445
28 Ga0075428_100000163 3300006844 Bacteria 61053
29 Ga0075428_100002087 3300006844 Bacteria 21558
30 Ga0075428_100007404 3300006844 Bacteria 12170
31 Ga0075428_100047753 3300006844 Bacteria 4700
32 Ga0075430_100000102 3300006846 Bacteria 51121
33 Ga0075430_100004396 3300006846 Bacteria 11900
34 Ga0075430_100165440 3300006846 Bacteria 1840
35 Ga0075431_100000434 3300006847 Bacteria 34207
36 Ga0075431_100003866 3300006847 Bacteria 14565
37 Ga0075431_100013679 3300006847 Bacteria 8202
38 Ga0075429_100001071 3300006880 Bacteria 21938
39 Ga0075429_100010395 3300006880 Bacteria 8054
40 Ga0075429_100040072 3300006880 Bacteria 4077
41 Ga0111539_10129647 3300009094 Bacteria 2953
42 Ga0105245_10000475 3300009098 Bacteria 36692
43 Ga0105245_10071187 3300009098 Bacteria 3158
44 Ga0114129_10001952 3300009147 Bacteria 28228
45 Ga0114129_10256109 3300009147 Bacteria 2347
46 Ga0105243_10079186 3300009148 Bacteria 2678
47 Ga0105248_10076403 3300009177 Bacteria 3764
48 Ga0157369_10073145 3300013105 Bacteria 3678
49 Ga0157378_10088626 3300013297 Bacteria 2808
50 Ga0182008_10054042 3300014497 Bacteria 1988
51 Ga0213873_10003813 3300021358 Bacteria 2757
52 Ga0213876_10008114 3300021384 Bacteria 5691
53 Ga0207684_10016243 3300025910 Bacteria 6394
54 Ga0207662_10015518 3300025918 Bacteria 4285
55 Ga0207649_10047142 3300025920 Bacteria 2651
56 Ga0207681_10151787 3300025923 Bacteria 1737
57 Ga0207687_10003876 3300025927 Bacteria 10046
58 Ga0207712_10035104 3300025961 Bacteria 3403
59 Ga0207641_10133631 3300026088 Bacteria 2231
60 Ga0207648_10010612 3300026089 Bacteria 8710
61 Ga0207675_100075414 3300026118 Bacteria 3157
62 Ga0209813_10011083 3300027866 Bacteria 2349
63 Ga0207428_10010602 3300027907 Bacteria 8224
64 Ga0268265_10073277 3300028380 Bacteria 2674
65 Ga0268264_10001949 3300028381 Bacteria 18545
66 Ga0268264_10023843 3300028381 Bacteria 4991
67 Ga0265338_10100891 3300028800 Bacteria 2352
68 Ga0265327_10003377 3300031251 Bacteria 15360
69 Ga0316576_10013250 3300031727 Bacteria 5472
70 Ga0316576_10042646 3300031727 Bacteria 3270
71 Ga0316576_10043664 3300031727 Bacteria 3235
72 Ga0316576_10087187 3300031727 Bacteria 2322
73 Ga0316576_10099134 3300031727 Bacteria 2176
74 Ga0316578_10011675 3300031728 Bacteria 4607
75 Ga0316577_10007773 3300031733 Bacteria 5726
76 Ga0316577_10010469 3300031733 Bacteria 5009
77 Ga0307409_100022560 3300031995 Bacteria 4343
78 Ga0307409_100038019 3300031995 Bacteria 3555
79 Ga0307416_100017934 3300032002 Bacteria 4971
80 Ga0307411_10067987 3300032005 Bacteria 2400
81 Ga0307415_100126907 3300032126 Bacteria 1924
82 Ga0373930_0000717 3300034816 Bacteria 4674
83 Ga0373932_0000616 3300035112 Bacteria 10790
84 Ga0373957_0035191 3300035120 Bacteria 1859
85 Ga0316574_0004944 3300035398 Bacteria 7059
86 Ga0316574_0006579 3300035398 Bacteria 6292
87 Ga0316574_0094474 3300035398 Bacteria 1910
88 Ga0373931_0000026 3300035691 Bacteria 124521
89 Ga0373931_0000057 3300035691 Bacteria 56670
90 Ga0373933_0057534 3300035724 Bacteria 2337
91 Ga0373937_0002782 3300036401 Bacteria 14607
92 Ga0316582_0132034 3300036647 Bacteria 1678
93 Ga0316582_0136336 3300036647 Bacteria 1652
94 Ga0316584_0005679 3300036712 Bacteria 8397
95 Ga0316584_0045574 3300036712 Bacteria 3274
96 Ga0316584_0052619 3300036712 Bacteria 3045
97 Ga0373925_0029949 3300037068 Bacteria 3993
98 Ga0436364_0872009 3300037853 Bacteria 1774
99 Ga0436364_1369919 3300037853 Bacteria 4011
100 Ga0400485_03477 3300038735 Bacteria 7547
101 Ga0400485_15684 3300038735 Bacteria 13626
102 Ga0400483_078063 3300039062 Bacteria 6957
103 Ga0400483_129561 3300039062 Bacteria 8299
104 Ga0400483_140722 3300039062 Bacteria 14983
105 Ga0400483_212389 3300039062 Bacteria 14410
106 Ga0400483_259898 3300039062 Bacteria 9933
107 Ga0400483_292027 3300039062 Bacteria 6728
108 Ga0436365_1177081 3300039437 Bacteria 7776
109 Ga0439463_002265 3300042016 Bacteria 4931
110 Ga0451577_0000151 3300042876 Bacteria 153747
111 Ga0451577_0001086 3300042876 Bacteria 38933
112 Ga0453683_0000250 3300044673 Bacteria 71009
113 Ga0466966_0017011 3300044684 Bacteria 4807
114 Ga0453684_0000424 3300044712 Bacteria 172336
115 Ga0453684_0017366 3300044712 Bacteria 11151
116 Ga0453684_0088107 3300044712 Bacteria 3844
117 Ga0453684_0103148 3300044712 Bacteria 3486
118 Ga0466959_0044431 3300045049 Bacteria 3274
119 Ga0451576_0289122 3300045051 Bacteria 1714
120 Ga0495653_0139256 3300046463 Bacteria 1709
121 Ga0495630_0051853 3300046517 Bacteria 3071
122 Ga0495630_0066722 3300046517 Bacteria 2705
123 Ga0495630_0211599 3300046517 Bacteria 1480
124 Ga0495587_0006639 3300046536 Bacteria 7535
125 Ga0495667_0005393 3300046559 Bacteria 8648
126 Ga0495634_0025721 3300046642 Bacteria 4111
127 Ga0495623_0020543 3300046679 Bacteria 4268
128 Ga0495613_0009769 3300046689 Bacteria 7131
129 Ga0495600_0028141 3300046809 Bacteria 3635
130 Ga0495672_0003183 3300047320 Bacteria 14267
131 Ga0495680_0009101 3300047322 Bacteria 8961
132 Ga0496101_0007964 3300048904 Bacteria 6904
133 Ga0496110_0015037 3300048913 Bacteria 6436
134 Ga0496111_0068307 3300048914 Bacteria 2583
135 Ga0501032_0003660 3300049569 Bacteria 11686
136 Ga0501033_0000777 3300049570 Bacteria 29365
137 Ga0501034_0026675 3300049571 Bacteria 5879
138 Ga0501036_0002536 3300049572 Bacteria 14352
139 Ga0501036_0092141 3300049572 Bacteria 2560
140 Ga0501037_0020517 3300049573 Bacteria 4880
141 Ga0501037_0123265 3300049573 Bacteria 1862
142 Ga0501039_0026571 3300049575 Bacteria 4449
143 Ga0501040_0001810 3300049576 Bacteria 13737
144 Ga0501041_0001295 3300049577 Bacteria 13771
145 Ga0501042_0001339 3300049578 Bacteria 14393
146 Ga0501042_0090586 3300049578 Bacteria 2195
147 Ga0501046_0011483 3300049580 Bacteria 7571
148 Ga0501048_0003743 3300049582 Bacteria 11602
149 Ga0501067_0054718 3300049583 Bacteria 2211
150 Ga0501068_0001534 3300049584 Bacteria 12277
151 Ga0501069_0000081 3300049585 Bacteria 47178
152 Ga0501069_0029611 3300049585 Bacteria 3004
153 Ga0501070_0000010 3300049586 Bacteria 192096
154 Ga0501070_0001142 3300049586 Bacteria 23828
155 Ga0501070_0034360 3300049586 Bacteria 4240
156 Ga0501071_0040794 3300049587 Bacteria 3323
157 Ga0501072_0007138 3300049588 Bacteria 8477
158 Ga0501072_0026662 3300049588 Bacteria 4505
159 Ga0501072_0027686 3300049588 Bacteria 4421
160 Ga0501072_0033398 3300049588 Bacteria 4032
161 Ga0501072_0069982 3300049588 Bacteria 2771
162 Ga0501072_0142774 3300049588 Bacteria 1909
163 Ga0501073_0000464 3300049589 Bacteria 28106
164 Ga0501073_0001759 3300049589 Bacteria 16091
165 Ga0501074_0005158 3300049590 Bacteria 9390
166 Ga0501074_0016728 3300049590 Bacteria 5323
167 Ga0501075_0003281 3300049591 Bacteria 10831
168 Ga0501075_0019711 3300049591 Bacteria 4896
169 Ga0501075_0029453 3300049591 Bacteria 4061
170 Ga0501076_0002375 3300049592 Bacteria 12889
171 Ga0501077_0000696 3300049593 Bacteria 20354
172 Ga0501077_0074872 3300049593 Bacteria 2144
173 Ga0501079_0001107 3300049741 Bacteria 18745
174 Ga0501079_0016934 3300049741 Bacteria 5568
175 Ga0501080_0001561 3300049742 Bacteria 19367
176 Ga0501080_0008934 3300049742 Bacteria 9111
177 Ga0501080_0011791 3300049742 Bacteria 8009
178 Ga0501083_0003202 3300049744 Bacteria 11402
179 Ga0501083_0011279 3300049744 Bacteria 6268
180 Ga0501035_0177570 3300049822 Bacteria 1836
181 Ga0501044_0004831 3300049823 Bacteria 15073
182 Ga0501045_0001890 3300049824 Bacteria 14186
183 Ga0501045_0069445 3300049824 Bacteria 2590
184 nmdc:mga03n38_22483_c1 3300050490 Bacteria 2553
185 nmdc:mga00v17_1559_c1 3300050491 Bacteria 11970
186 nmdc:mga00v17_19241_c2 3300050491 Bacteria 2794
187 nmdc:mga0yw44_19586_c1 3300050492 Bacteria 3734
188 nmdc:mga0yw44_1988_c1 3300050492 Bacteria 8486
189 nmdc:mga0yw44_3053_c1 3300050492 Bacteria 7328
190 nmdc:mga0yw44_3092_c1 3300050492 Bacteria 7290
191 nmdc:mga0yw44_376_c1 3300050492 Bacteria 8226
192 nmdc:mga07m45_40078_c1 3300050496 Bacteria 2620
193 nmdc:mga05p37_1063_c1 3300050507 Bacteria 31403
194 nmdc:mga05p37_370469_c1 3300050507 Bacteria 1681
195 nmdc:mga09592_13561_c1 3300050508 Bacteria 6657
196 nmdc:mga09592_18345_c1 3300050508 Bacteria 5739
197 nmdc:mga09592_4320_c1 3300050508 Bacteria 11480
198 nmdc:mga0qj67_134069_c1 3300050509 Bacteria 2006
199 nmdc:mga0qj67_229169_c1 3300050509 Bacteria 1508
200 nmdc:mga0qj67_3598_c1 3300050509 Bacteria 11186
201 nmdc:mga0qj67_4949_c1 3300050509 Bacteria 9682
202 nmdc:mga06r32_216559_c1 3300050510 Bacteria 1903
203 nmdc:mga06r32_37776_c1 3300050510 Bacteria 4569
204 nmdc:mga06r32_49283_c1 3300050510 Bacteria 4028
205 nmdc:mga06r32_99170_c1 3300050510 Bacteria 2857
206 nmdc:mga08y16_189710_c1 3300050511 Bacteria 2132
207 nmdc:mga08y16_22676_c1 3300050511 Bacteria 6629
208 nmdc:mga08y16_68339_c1 3300050511 Bacteria 3704
209 Ga0500635_0003781 3300053080 Bacteria 3835
210 Ga0500566_0000180 3300053094 Bacteria 32425
211 Ga0500568_0000069 3300053139 Bacteria 99921
212 Ga0500616_0000190 3300053153 Bacteria 100836
213 Ga0500616_0019280 3300053153 Bacteria 3846
214 Ga0500620_006335 3300053155 Bacteria 2831
215 Ga0501084_0001286 3300054114 Bacteria 19770
216 Ga0501084_0003260 3300054114 Bacteria 13131
217 Ga0501082_0010007 3300060353 Bacteria 8177
218 Ga0501082_0145417 3300060353 Bacteria 2058
219 Ga0530510_0003064 3300061734 Bacteria 11474
220 Ga0530510_0011773 3300061734 Bacteria 6138
221 Ga0530510_0030795 3300061734 Bacteria 3855
222 Ga0530510_0047425 3300061734 Bacteria 3104
223 Ga0501082_0010652
224 JGI25407J50210_10000110
225 Ga0070661_100045901
226 Ga0070671_100005222
227 Ga0070714_100070474
228 Ga0068867_100022933
229 Ga0070706_100023648
230 Ga0068854_100117160
231 Ga0068863_100135091
232 Ga0068858_100060009
233 Ga0068860_100009030
234 Ga0068860_100288243
235 Ga0068862_100050917
236 Ga0081455_10002923
237 Ga0081455_10006732
238 Ga0081538_10000294
239 Ga0081538_10002497
240 Ga0075365_10004048
241 Ga0075365_10005046
242 Ga0075365_10021913
243 Ga0075365_10054415
244 Ga0075363_100023341
245 Ga0075364_10006005
246 Ga0075364_10021183
247 Ga0075364_10063203
248 Ga0075362_10024696
249 Ga0075367_10150326
250 Ga0075428_100000163
251 Ga0075428_100002087
252 Ga0075428_100007404
253 Ga0075428_100047753
254 Ga0075430_100000102
255 Ga0075430_100004396
256 Ga0075430_100165440
257 Ga0075431_100000434
258 Ga0075431_100003866
259 Ga0075431_100013679
260 Ga0075429_100001071
261 Ga0075429_100010395
262 Ga0075429_100040072
263 Ga0111539_10129647
264 Ga0105245_10000475
265 Ga0105245_10071187
266 Ga0114129_10001952
267 Ga0114129_10256109
268 Ga0105243_10079186
269 Ga0105248_10076403
270 Ga0157369_10073145
271 Ga0157378_10088626
272 Ga0182008_10054042
273 Ga0213873_10003813
274 Ga0213876_10008114
275 Ga0207684_10016243
276 Ga0207662_10015518
277 Ga0207649_10047142
278 Ga0207681_10151787
279 Ga0207687_10003876
280 Ga0207712_10035104
281 Ga0207641_10133631
282 Ga0207648_10010612
283 Ga0207675_100075414
284 Ga0209813_10011083
285 Ga0207428_10010602
286 Ga0268265_10073277
287 Ga0268264_10001949
288 Ga0268264_10023843
289 Ga0265338_10100891
290 Ga0265327_10003377
291 Ga0316576_10013250
292 Ga0316576_10042646
293 Ga0316576_10043664
294 Ga0316576_10087187
295 Ga0316576_10099134
296 Ga0316578_10011675
297 Ga0316577_10007773
298 Ga0316577_10010469
299 Ga0307409_100022560
300 Ga0307409_100038019
301 Ga0307416_100017934
302 Ga0307411_10067987
303 Ga0307415_100126907
304 Ga0373930_0000717
305 Ga0373932_0000616
306 Ga0373957_0035191
307 Ga0316574_0004944
308 Ga0316574_0006579
309 Ga0316574_0094474
310 Ga0373931_0000026
311 Ga0373931_0000057
312 Ga0373933_0057534
313 Ga0373937_0002782
314 Ga0316582_0132034
315 Ga0316582_0136336
316 Ga0316584_0005679
317 Ga0316584_0045574
318 Ga0316584_0052619
319 Ga0373925_0029949
320 Ga0436364_0872009
321 Ga0436364_1369919
322 Ga0400485_03477
323 Ga0400485_15684
324 Ga0400483_078063
325 Ga0400483_129561
326 Ga0400483_140722
327 Ga0400483_212389
328 Ga0400483_259898
329 Ga0400483_292027
330 Ga0436365_1177081
331 Ga0439463_002265
332 Ga0451577_0000151
333 Ga0451577_0001086
334 Ga0453683_0000250
335 Ga0466966_0017011
336 Ga0453684_0000424
337 Ga0453684_0017366
338 Ga0453684_0088107
339 Ga0453684_0103148
340 Ga0466959_0044431
341 Ga0451576_0289122
342 Ga0495653_0139256
343 Ga0495630_0051853
344 Ga0495630_0066722
345 Ga0495630_0211599
346 Ga0495587_0006639
347 Ga0495667_0005393
348 Ga0495634_0025721
349 Ga0495623_0020543
350 Ga0495613_0009769
351 Ga0495600_0028141
352 Ga0495672_0003183
353 Ga0495680_0009101
354 Ga0496101_0007964
355 Ga0496110_0015037
356 Ga0496111_0068307
357 Ga0501032_0003660
358 Ga0501033_0000777
359 Ga0501034_0026675
360 Ga0501036_0002536
361 Ga0501036_0092141
362 Ga0501037_0020517
363 Ga0501037_0123265
364 Ga0501039_0026571
365 Ga0501040_0001810
366 Ga0501041_0001295
367 Ga0501042_0001339
368 Ga0501042_0090586
369 Ga0501046_0011483
370 Ga0501048_0003743
371 Ga0501067_0054718
372 Ga0501068_0001534
373 Ga0501069_0000081
374 Ga0501069_0029611
375 Ga0501070_0000010
376 Ga0501070_0001142
377 Ga0501070_0034360
378 Ga0501071_0040794
379 Ga0501072_0007138
380 Ga0501072_0026662
381 Ga0501072_0027686
382 Ga0501072_0033398
383 Ga0501072_0069982
384 Ga0501072_0142774
385 Ga0501073_0000464
386 Ga0501073_0001759
387 Ga0501074_0005158
388 Ga0501074_0016728
389 Ga0501075_0003281
390 Ga0501075_0019711
391 Ga0501075_0029453
392 Ga0501076_0002375
393 Ga0501077_0000696
394 Ga0501077_0074872
395 Ga0501079_0001107
396 Ga0501079_0016934
397 Ga0501080_0001561
398 Ga0501080_0008934
399 Ga0501080_0011791
400 Ga0501083_0003202
401 Ga0501083_0011279
402 Ga0501035_0177570
403 Ga0501044_0004831
404 Ga0501045_0001890
405 Ga0501045_0069445
406 nmdc:mga03n38_22483_c1
407 nmdc:mga00v17_1559_c1
408 nmdc:mga00v17_19241_c2
409 nmdc:mga0yw44_19586_c1
410 nmdc:mga0yw44_1988_c1
411 nmdc:mga0yw44_3053_c1
412 nmdc:mga0yw44_3092_c1
413 nmdc:mga0yw44_376_c1
414 nmdc:mga07m45_40078_c1
415 nmdc:mga05p37_1063_c1
416 nmdc:mga05p37_370469_c1
417 nmdc:mga09592_13561_c1
418 nmdc:mga09592_18345_c1
419 nmdc:mga09592_4320_c1
420 nmdc:mga0qj67_134069_c1
421 nmdc:mga0qj67_229169_c1
422 nmdc:mga0qj67_3598_c1
423 nmdc:mga0qj67_4949_c1
424 nmdc:mga06r32_216559_c1
425 nmdc:mga06r32_37776_c1
426 nmdc:mga06r32_49283_c1
427 nmdc:mga06r32_99170_c1
428 nmdc:mga08y16_189710_c1
429 nmdc:mga08y16_22676_c1
430 nmdc:mga08y16_68339_c1
431 Ga0500635_0003781
432 Ga0500566_0000180
433 Ga0500568_0000069
434 Ga0500616_0000190
435 Ga0500616_0019280
436 Ga0500620_006335
437 Ga0501084_0001286
438 Ga0501084_0003260
439 Ga0501082_0010007
440 Ga0501082_0145417
441 Ga0530510_0003064
442 Ga0530510_0011773
443 Ga0530510_0030795
444 Ga0530510_0047425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19238

Radical_SAM_2

Radical SAM-like domain

66

216

0.98

PF04459

DUF512

Protein of unknown function (DUF512)

219

322

0.93

PF17820

PDZ_6

PDZ domain

5

55

0.89

PF04459

DUF512

Protein of unknown function (DUF512)

382

495

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pv5-assembly1.cif.gz_D structure of legionella fallonii degq (n189g/p190g variant) 0.9041 5 64
3pv2-assembly1.cif.gz_D structure of legionella fallonii degq (wt) 0.9038 5 64
3pv2-assembly1.cif.gz_A structure of legionella fallonii degq (wt) 0.8997 5 64
3pv5-assembly1.cif.gz_A-3 structure of legionella fallonii degq (n189g/p190g variant) 0.8981 5 64
3pv3-assembly1.cif.gz_A structure of legionella fallonii degq (s193a variant) 0.8935 5 64
ID Description Score Start End Superfamily
af_Q9VFJ3_320_421_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9233 5 65 2.30.42.10
af_A0A143ZXD4_317_404_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9132 5 65 2.30.42.10
3pv2A03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9094 5 64 2.30.42.10
af_Q10149_17_117_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9085 3 77 2.30.42.10
af_Q4CNT4_283_369_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.906 1 65 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A355FZ89-F1-model_v4 Radical SAM protein 0.949 179 315
AF-A0A7U9T7T9-F1-model_v4 Uncharacterized protein 0.9446 137 307
AF-A0A7C7PUQ8-F1-model_v4 PDZ domain-containing protein 0.9434 5 72
AF-A0A7V6DPE9-F1-model_v4 PDZ domain-containing protein 0.9388 5 66
AF-A0A349DES3-F1-model_v4 Radical SAM protein 0.9373 146 305

Map