F334912
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 222 | 166 | 168 | 350 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0021622|Ga0496126_0021622_2026_3288 |
| Length | 420 |
| Sequence | MLDKDNVAGNGAPGVYRWQPSGRRGTSALGPTWPMSIFREIADDLRSEAGVLIPINECECIWSYSNFRRGWELDMMRKFLSVAVAMLASSQAIADDDLMNAAKQSFTPIPSVLPAVKNNAVTRDKIELGKMLFFDPRLSASEIISCNTCHNIGTGGVDAGPTSVGHGWQKGPRRAPTVFNAVFNVAQFWDGRAADLKAQAKGPVQASVEMNATPDHVIKTLTSMPDYVAMFKKAFPNEASPVTFDNFAKAIEAFEATLITPAAPFDQYLEGDANALTEQQKAGLKLFMDKGCSSCHNGINIGGQDYFPFGVIEKPGSDVLPTADKGRFAVTKTASDEYVFRAAPLRNVALRAPYFHSGQVWNLKQAVGVMGEVQLGAKLNDKEENDIVAFLNSLTGQLPRIEYPILPTRTNTTPPPSLGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 4 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 5 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 8 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 9 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 10 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 11 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 12 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 13 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 14 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 15 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 16 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 17 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 18 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 19 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 20 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 21 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 22 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 23 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 24 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 25 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 26 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 27 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 28 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 29 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 30 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 31 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 32 | 2904699407 | |||
| 33 | 2906610324 | |||
| 34 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 35 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 36 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 37 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 38 | 2922368715 | |||
| 39 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 40 | 2922425934 | |||
| 41 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 42 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 43 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 44 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 45 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 46 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 47 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 48 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 49 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 50 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 62 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 70 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 71 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 72 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 73 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 96 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 97 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 98 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 99 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 100 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 101 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 102 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 110 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 113 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 114 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 117 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 118 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 119 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 141 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 158 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 159 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 160 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 161 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 162 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 163 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 164 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 165 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 166 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.1 |
| Metatranscriptomes | 5.96 |
| Isolates | 22.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.11 |
| Nodule | 22.07 |
| Rhizoplane | 0 |
| Rhizosphere | 58.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1001215 | 3300002705 | Bacteria | 11378 |
| 2 | JGI25162J39368_1000138 | 3300002737 | Bacteria | 78713 |
| 3 | JGI25157J39369_1000253 | 3300002741 | Bacteria | 39977 |
| 4 | JGI25157J39369_1001086 | 3300002741 | Bacteria | 12214 |
| 5 | JGI25163J39215_1000444 | 3300002771 | Bacteria | 12688 |
| 6 | JGI25164J39214_1000170 | 3300002772 | Bacteria | 60952 |
| 7 | JGI25165J46597_1000224 | 3300003214 | Bacteria | 78713 |
| 8 | rootH1_10201137 | 3300003323 | Unclassified | 1781 |
| 9 | Ga0055538_1003075 | 3300003751 | Bacteria | 2203 |
| 10 | Ga0055535_1000216 | 3300003761 | Bacteria | 60912 |
| 11 | Ga0055542_1000179 | 3300003762 | Bacteria | 78713 |
| 12 | Ga0055529_1000189 | 3300003763 | Bacteria | 84123 |
| 13 | Ga0070683_100034360 | 3300005329 | Bacteria | 4631 |
| 14 | Ga0070713_100010304 | 3300005436 | Bacteria | 6748 |
| 15 | Ga0070663_100138556 | 3300005455 | Bacteria | 1855 |
| 16 | Ga0070672_100142341 | 3300005543 | Bacteria | 1979 |
| 17 | Ga0068856_100388368 | 3300005614 | Bacteria | 1415 |
| 18 | Ga0068859_100212387 | 3300005617 | Bacteria | 2021 |
| 19 | Ga0070717_10112075 | 3300006028 | Bacteria | 2328 |
| 20 | Ga0097620_100212399 | 3300006931 | Bacteria | 2021 |
| 21 | Ga0099824_1015255 | 3300006942 | Bacteria | 7347 |
| 22 | Ga0099822_1000090 | 3300006943 | Bacteria | 52821 |
| 23 | Ga0105240_10042421 | 3300009093 | Bacteria | 5797 |
| 24 | Ga0105240_10270067 | 3300009093 | Bacteria | 1958 |
| 25 | Ga0105240_10358499 | 3300009093 | Bacteria | 1652 |
| 26 | Ga0105237_10051495 | 3300009545 | Bacteria | 4135 |
| 27 | Ga0105238_10085799 | 3300009551 | Bacteria | 3136 |
| 28 | Ga0157369_10023356 | 3300013105 | Bacteria | 6888 |
| 29 | Ga0157372_10130193 | 3300013307 | Bacteria | 2894 |
| 30 | Ga0157380_10141632 | 3300014326 | Bacteria | 2067 |
| 31 | Ga0214544_1004829 | 3300021320 | Bacteria | 26676 |
| 32 | Ga0214544_1011549 | 3300021320 | Bacteria | 12123 |
| 33 | Ga0214542_1004733 | 3300021321 | Bacteria | 26676 |
| 34 | Ga0214542_1011457 | 3300021321 | Bacteria | 12123 |
| 35 | Ga0214545_1004314 | 3300021324 | Bacteria | 26676 |
| 36 | Ga0214545_1011545 | 3300021324 | Bacteria | 12123 |
| 37 | Ga0214543_1004404 | 3300021327 | Bacteria | 26739 |
| 38 | Ga0214543_1011733 | 3300021327 | Bacteria | 12099 |
| 39 | Ga0209760_100737 | 3300025207 | Bacteria | 4808 |
| 40 | Ga0209784_100068 | 3300025224 | Bacteria | 152526 |
| 41 | Ga0209672_106949 | 3300025228 | Bacteria | 1791 |
| 42 | Ga0209563_100053 | 3300025230 | Bacteria | 332370 |
| 43 | Ga0207427_100140 | 3300025231 | Bacteria | 84637 |
| 44 | Ga0209437_100147 | 3300025233 | Bacteria | 161997 |
| 45 | Ga0209258_100360 | 3300025242 | Bacteria | 61533 |
| 46 | Ga0209646_1000535 | 3300025246 | Bacteria | 16572 |
| 47 | Ga0209026_1000099 | 3300025250 | Bacteria | 161750 |
| 48 | Ga0209026_1000829 | 3300025250 | Bacteria | 16442 |
| 49 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 50 | Ga0209759_1000755 | 3300025256 | Bacteria | 27927 |
| 51 | Ga0209759_1001078 | 3300025256 | Bacteria | 17835 |
| 52 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 53 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 54 | Ga0207695_10099799 | 3300025913 | Bacteria | 2900 |
| 55 | Ga0207695_10140651 | 3300025913 | Bacteria | 2362 |
| 56 | Ga0207700_10292544 | 3300025928 | Unclassified | 1404 |
| 57 | Ga0207661_10030640 | 3300025944 | Bacteria | 4146 |
| 58 | Ga0207667_10166622 | 3300025949 | Bacteria | 2265 |
| 59 | Ga0207639_10185438 | 3300026041 | Bacteria | 1773 |
| 60 | Ga0207678_10349805 | 3300026067 | Bacteria | 1274 |
| 61 | Ga0209489_100216 | 3300027361 | Bacteria | 95472 |
| 62 | Ga0209700_100015 | 3300027363 | Bacteria | 257238 |
| 63 | Ga0265327_10000665 | 3300031251 | Bacteria | 55138 |
| 64 | Ga0316579_10001296 | 3300031691 | Bacteria | 9024 |
| 65 | Ga0316579_10011655 | 3300031691 | Bacteria | 3741 |
| 66 | Ga0316576_10001708 | 3300031727 | Bacteria | 12055 |
| 67 | Ga0316576_10003573 | 3300031727 | Bacteria | 9158 |
| 68 | Ga0316576_10028913 | 3300031727 | Bacteria | 3912 |
| 69 | Ga0316576_10054231 | 3300031727 | Bacteria | 2923 |
| 70 | Ga0316576_10088903 | 3300031727 | Bacteria | 2300 |
| 71 | Ga0316576_10137127 | 3300031727 | Bacteria | 1842 |
| 72 | Ga0316578_10001012 | 3300031728 | Bacteria | 10764 |
| 73 | Ga0316578_10009818 | 3300031728 | Bacteria | 4938 |
| 74 | Ga0316578_10013604 | 3300031728 | Bacteria | 4320 |
| 75 | Ga0316578_10015682 | 3300031728 | Bacteria | 4081 |
| 76 | Ga0316578_10062530 | 3300031728 | Bacteria | 2195 |
| 77 | Ga0316577_10001501 | 3300031733 | Bacteria | 11051 |
| 78 | Ga0316577_10008098 | 3300031733 | Bacteria | 5619 |
| 79 | Ga0316577_10008194 | 3300031733 | Bacteria | 5594 |
| 80 | Ga0316577_10028960 | 3300031733 | Bacteria | 3091 |
| 81 | Ga0316577_10034222 | 3300031733 | Bacteria | 2839 |
| 82 | Ga0316583_10000421 | 3300032133 | Bacteria | 12407 |
| 83 | Ga0316585_10000095 | 3300032137 | Bacteria | 15825 |
| 84 | Ga0316585_10002390 | 3300032137 | Bacteria | 5056 |
| 85 | Ga0316580_10000169 | 3300032139 | Bacteria | 12934 |
| 86 | Ga0316580_10000585 | 3300032139 | Bacteria | 8546 |
| 87 | Ga0316580_10010473 | 3300032139 | Bacteria | 2803 |
| 88 | Ga0316580_10016665 | 3300032139 | Bacteria | 2256 |
| 89 | Ga0316592_1000409 | 3300033524 | Bacteria | 5780 |
| 90 | Ga0316592_1001443 | 3300033524 | Bacteria | 3822 |
| 91 | Ga0316592_1026394 | 3300033524 | Bacteria | 1254 |
| 92 | Ga0316586_1004930 | 3300033527 | Bacteria | 1850 |
| 93 | Ga0316588_1000422 | 3300033528 | Bacteria | 5639 |
| 94 | Ga0316588_1010315 | 3300033528 | Bacteria | 1967 |
| 95 | Ga0316588_1023043 | 3300033528 | Bacteria | 1426 |
| 96 | Ga0316587_1013486 | 3300033529 | Bacteria | 1339 |
| 97 | Ga0316596_1000747 | 3300033541 | Bacteria | 5939 |
| 98 | Ga0316596_1002917 | 3300033541 | Bacteria | 3705 |
| 99 | Ga0316596_1012330 | 3300033541 | Bacteria | 2102 |
| 100 | Ga0316596_1018687 | 3300033541 | Bacteria | 1754 |
| 101 | Ga0316596_1026952 | 3300033541 | Bacteria | 1482 |
| 102 | Ga0373923_0086874 | 3300035111 | Bacteria | 1363 |
| 103 | Ga0373932_0025350 | 3300035112 | Bacteria | 1604 |
| 104 | Ga0373954_0048130 | 3300035118 | Bacteria | 1997 |
| 105 | Ga0373956_0005206 | 3300035119 | Bacteria | 5207 |
| 106 | Ga0373955_0024673 | 3300035172 | Bacteria | 3077 |
| 107 | Ga0316574_0000777 | 3300035398 | Bacteria | 13773 |
| 108 | Ga0316574_0001660 | 3300035398 | Bacteria | 10717 |
| 109 | Ga0316574_0015190 | 3300035398 | Bacteria | 4467 |
| 110 | Ga0373924_0128419 | 3300035410 | Bacteria | 1102 |
| 111 | Ga0373933_0001166 | 3300035724 | Bacteria | 15582 |
| 112 | Ga0373933_0160739 | 3300035724 | Bacteria | 1426 |
| 113 | Ga0373937_0157241 | 3300036401 | Bacteria | 2131 |
| 114 | Ga0316582_0001689 | 3300036647 | Bacteria | 9914 |
| 115 | Ga0316582_0023121 | 3300036647 | Bacteria | 3700 |
| 116 | Ga0316582_0030374 | 3300036647 | Bacteria | 3292 |
| 117 | Ga0316582_0035179 | 3300036647 | Bacteria | 3090 |
| 118 | Ga0316582_0053116 | 3300036647 | Bacteria | 2577 |
| 119 | Ga0316584_0004455 | 3300036712 | Bacteria | 9268 |
| 120 | Ga0316584_0030819 | 3300036712 | Bacteria | 3963 |
| 121 | Ga0436360_0374983 | 3300039438 | Bacteria | 1129 |
| 122 | Ga0436360_0398214 | 3300039438 | Bacteria | 1336 |
| 123 | Ga0451577_0000188 | 3300042876 | Bacteria | 131320 |
| 124 | Ga0451577_0067293 | 3300042876 | Bacteria | 3195 |
| 125 | Ga0451577_0227715 | 3300042876 | Bacteria | 1685 |
| 126 | Ga0453684_0000612 | 3300044712 | Bacteria | 131319 |
| 127 | Ga0453684_0003172 | 3300044712 | Bacteria | 37778 |
| 128 | Ga0451576_0065023 | 3300045051 | Bacteria | 3798 |
| 129 | Ga0495592_0038566 | 3300046454 | Bacteria | 3594 |
| 130 | Ga0495651_0066332 | 3300046462 | Bacteria | 2755 |
| 131 | Ga0495653_0051004 | 3300046463 | Bacteria | 3179 |
| 132 | Ga0495608_0084325 | 3300046511 | Bacteria | 2061 |
| 133 | Ga0495628_0016530 | 3300046516 | Bacteria | 6154 |
| 134 | Ga0495630_0005803 | 3300046517 | Bacteria | 8721 |
| 135 | Ga0495652_0017289 | 3300046529 | Bacteria | 6437 |
| 136 | Ga0495587_0000712 | 3300046536 | Bacteria | 22252 |
| 137 | Ga0495587_0001756 | 3300046536 | Bacteria | 14485 |
| 138 | Ga0495657_0082957 | 3300046675 | Bacteria | 2070 |
| 139 | Ga0495599_0101595 | 3300046678 | Bacteria | 1792 |
| 140 | Ga0495623_0012141 | 3300046679 | Bacteria | 5581 |
| 141 | Ga0495613_0252770 | 3300046689 | Bacteria | 1229 |
| 142 | Ga0495604_0140305 | 3300047317 | Bacteria | 1727 |
| 143 | Ga0495604_0197844 | 3300047317 | Bacteria | 1396 |
| 144 | Ga0495680_0102944 | 3300047322 | Bacteria | 2125 |
| 145 | Ga0495675_0002554 | 3300047444 | Bacteria | 10892 |
| 146 | Ga0495675_0009077 | 3300047444 | Bacteria | 6179 |
| 147 | Ga0495684_0004899 | 3300047471 | Bacteria | 10444 |
| 148 | Ga0495686_0037871 | 3300047472 | Bacteria | 3088 |
| 149 | Ga0495602_0044513 | 3300048088 | Unclassified | 4025 |
| 150 | Ga0496126_0021622 | 3300048929 | Bacteria | 6281 |
| 151 | Ga0501036_0007393 | 3300049572 | Bacteria | 8951 |
| 152 | Ga0501038_0019049 | 3300049574 | Bacteria | 6191 |
| 153 | Ga0501040_0028300 | 3300049576 | Bacteria | 3777 |
| 154 | Ga0501041_0033281 | 3300049577 | Bacteria | 3118 |
| 155 | Ga0501042_0023785 | 3300049578 | Bacteria | 4291 |
| 156 | Ga0501048_0006624 | 3300049582 | Bacteria | 8804 |
| 157 | Ga0501069_0074783 | 3300049585 | Bacteria | 1902 |
| 158 | Ga0501070_0014991 | 3300049586 | Bacteria | 6522 |
| 159 | Ga0501070_0305177 | 3300049586 | Bacteria | 1296 |
| 160 | Ga0501071_0004644 | 3300049587 | Bacteria | 8722 |
| 161 | Ga0501072_0011148 | 3300049588 | Bacteria | 6861 |
| 162 | Ga0501075_0007266 | 3300049591 | Bacteria | 7681 |
| 163 | Ga0501075_0011768 | 3300049591 | Bacteria | 6203 |
| 164 | Ga0501076_0004725 | 3300049592 | Bacteria | 9719 |
| 165 | Ga0501035_0034011 | 3300049822 | Bacteria | 4633 |
| 166 | Ga0501044_0193855 | 3300049823 | Bacteria | 1993 |
| 167 | Ga0501045_0050938 | 3300049824 | Bacteria | 3021 |
| 168 | Ga0495619_0223365 | 3300053085 | Bacteria | 1305 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025928 | Ga0207700_10292544 | Ga0207700_102925442 | 327 |
| 2 | 3300005436 | Ga0070713_100010304 | Ga0070713_1000103044 | 330 |
| 3 | 3300005614 | Ga0068856_100388368 | Ga0068856_1003883681 | 330 |
| 4 | 3300006028 | Ga0070717_10112075 | Ga0070717_101120751 | 331 |
| 5 | 3300006943 | Ga0099822_1000090 | Ga0099822_100009048 | 334 |
| 6 | 3300014326 | Ga0157380_10141632 | Ga0157380_101416322 | 335 |
| 7 | 3300031691 | Ga0316579_10001296 | Ga0316579_100012962 | 335 |
| 8 | 3300031727 | Ga0316576_10001708 | Ga0316576_100017087 | 335 |
| 9 | 3300031727 | Ga0316576_10054231 | Ga0316576_100542312 | 335 |
| 10 | 3300031728 | Ga0316578_10001012 | Ga0316578_100010127 | 335 |
| 11 | 3300031733 | Ga0316577_10001501 | Ga0316577_100015013 | 335 |
| 12 | 3300032133 | Ga0316583_10000421 | Ga0316583_100004212 | 335 |
| 13 | 3300032137 | Ga0316585_10002390 | Ga0316585_100023903 | 335 |
| 14 | 3300032139 | Ga0316580_10000169 | Ga0316580_100001692 | 335 |
| 15 | 3300033524 | Ga0316592_1000409 | Ga0316592_10004093 | 335 |
| 16 | 3300033527 | Ga0316586_1004930 | Ga0316586_10049301 | 335 |
| 17 | 3300033529 | Ga0316587_1013486 | Ga0316587_10134862 | 335 |
| 18 | 3300033541 | Ga0316596_1002917 | Ga0316596_10029171 | 335 |
| 19 | 3300035398 | Ga0316574_0000777 | Ga0316574_0000777_6269_7339 | 335 |
| 20 | 3300036647 | Ga0316582_0001689 | Ga0316582_0001689_8089_9159 | 335 |
| 21 | 3300006942 | Ga0099824_1015255 | Ga0099824_10152555 | 336 |
| 22 | 3300035724 | Ga0373933_0160739 | Ga0373933_0160739_387_1397 | 336 |
| 23 | 3300048088 | Ga0495602_0044513 | Ga0495602_0044513_2705_3724 | 336 |
| 24 | iso_pu_bacteria | 2513237087 | 2513594264 | 337 |
| 25 | 3300009093 | Ga0105240_10270067 | Ga0105240_102700672 | 339 |
| 26 | 3300009093 | Ga0105240_10358499 | Ga0105240_103584992 | 339 |
| 27 | 3300009545 | Ga0105237_10051495 | Ga0105237_100514953 | 339 |
| 28 | 3300009551 | Ga0105238_10085799 | Ga0105238_100857993 | 339 |
| 29 | 3300013105 | Ga0157369_10023356 | Ga0157369_100233565 | 339 |
| 30 | 3300013307 | Ga0157372_10130193 | Ga0157372_101301933 | 339 |
| 31 | 3300025913 | Ga0207695_10099799 | Ga0207695_100997992 | 339 |
| 32 | iso_pu_bacteria | 2513237102 | 2513706276 | 339 |
| 33 | iso_pu_bacteria | 2513237104 | 2513719991 | 339 |
| 34 | iso_pu_bacteria | 2524023210 | 2524466692 | 339 |
| 35 | iso_pu_bacteria | 2617270741 | 2617379913 | 339 |
| 36 | iso_pu_bacteria | 2728368998 | 2728749654 | 339 |
| 37 | iso_pu_bacteria | 2841949485 | 2841957665 | 339 |
| 38 | iso_pu_bacteria | 2881364244 | 2881367912 | 339 |
| 39 | iso_pu_bacteria | 2903768456 | 2903775942 | 339 |
| 40 | iso_pu_bacteria | 2922393267 | 2922395973 | 339 |
| 41 | 3300003323 | rootH1_10201137 | rootH1_102011371 | 340 |
| 42 | 3300026041 | Ga0207639_10185438 | Ga0207639_101854382 | 340 |
| 43 | iso_pu_bacteria | 2834578030 | 2834578748 | 340 |
| 44 | iso_pu_bacteria | 2904699407 | 2904706467 | 340 |
| 45 | iso_pu_bacteria | 2922368715 | 2922370366 | 340 |
| 46 | iso_pu_bacteria | 8054002106 | 8054003924 | 340 |
| 47 | 3300005329 | Ga0070683_100034360 | Ga0070683_1000343602 | 341 |
| 48 | 3300025944 | Ga0207661_10030640 | Ga0207661_100306407 | 341 |
| 49 | 3300042876 | Ga0451577_0000188 | Ga0451577_0000188_49853_50887 | 341 |
| 50 | 3300044712 | Ga0453684_0000612 | Ga0453684_0000612_49840_50874 | 341 |
| 51 | 3300049585 | Ga0501069_0074783 | Ga0501069_0074783_84_1181 | 341 |
| 52 | 3300049586 | Ga0501070_0014991 | Ga0501070_0014991_1370_2467 | 341 |
| 53 | 3300049586 | Ga0501070_0305177 | Ga0501070_0305177_155_1252 | 341 |
| 54 | 3300049591 | Ga0501075_0011768 | Ga0501075_0011768_1556_2653 | 341 |
| 55 | iso_pu_bacteria | 8045864390 | 8045866664 | 341 |
| 56 | iso_pu_bacteria | 8045864390 | 8045868441 | 341 |
| 57 | 3300005543 | Ga0070672_100142341 | Ga0070672_1001423412 | 342 |
| 58 | 3300005617 | Ga0068859_100212387 | Ga0068859_1002123871 | 342 |
| 59 | 3300006931 | Ga0097620_100212399 | Ga0097620_1002123992 | 342 |
| 60 | 3300021320 | Ga0214544_1004829 | Ga0214544_100482926 | 342 |
| 61 | 3300021320 | Ga0214544_1011549 | Ga0214544_10115494 | 342 |
| 62 | 3300021321 | Ga0214542_1004733 | Ga0214542_100473326 | 342 |
| 63 | 3300021321 | Ga0214542_1011457 | Ga0214542_10114574 | 342 |
| 64 | 3300021324 | Ga0214545_1004314 | Ga0214545_100431417 | 342 |
| 65 | 3300021324 | Ga0214545_1011545 | Ga0214545_10115454 | 342 |
| 66 | 3300021327 | Ga0214543_1004404 | Ga0214543_100440426 | 342 |
| 67 | 3300021327 | Ga0214543_1011733 | Ga0214543_10117334 | 342 |
| 68 | 3300025230 | Ga0209563_100053 | Ga0209563_100053154 | 342 |
| 69 | 3300035111 | Ga0373923_0086874 | Ga0373923_0086874_237_1277 | 342 |
| 70 | 3300035112 | Ga0373932_0025350 | Ga0373932_0025350_456_1496 | 342 |
| 71 | 3300035118 | Ga0373954_0048130 | Ga0373954_0048130_840_1880 | 342 |
| 72 | 3300035119 | Ga0373956_0005206 | Ga0373956_0005206_3126_4166 | 342 |
| 73 | 3300035172 | Ga0373955_0024673 | Ga0373955_0024673_1371_2411 | 342 |
| 74 | 3300035410 | Ga0373924_0128419 | Ga0373924_0128419_28_1068 | 342 |
| 75 | 3300035724 | Ga0373933_0001166 | Ga0373933_0001166_2606_3646 | 342 |
| 76 | 3300039438 | Ga0436360_0374983 | Ga0436360_0374983_20_1066 | 342 |
| 77 | 3300042876 | Ga0451577_0227715 | Ga0451577_0227715_413_1453 | 342 |
| 78 | 3300044712 | Ga0453684_0003172 | Ga0453684_0003172_12254_13294 | 342 |
| 79 | 3300045051 | Ga0451576_0065023 | Ga0451576_0065023_1408_2448 | 342 |
| 80 | 3300046454 | Ga0495592_0038566 | Ga0495592_0038566_1641_2681 | 342 |
| 81 | 3300046462 | Ga0495651_0066332 | Ga0495651_0066332_1654_2694 | 342 |
| 82 | 3300046463 | Ga0495653_0051004 | Ga0495653_0051004_615_1655 | 342 |
| 83 | 3300046511 | Ga0495608_0084325 | Ga0495608_0084325_34_1074 | 342 |
| 84 | 3300046517 | Ga0495630_0005803 | Ga0495630_0005803_7410_8450 | 342 |
| 85 | 3300046529 | Ga0495652_0017289 | Ga0495652_0017289_4995_6035 | 342 |
| 86 | 3300046536 | Ga0495587_0000712 | Ga0495587_0000712_5088_6128 | 342 |
| 87 | 3300046536 | Ga0495587_0001756 | Ga0495587_0001756_13412_14452 | 342 |
| 88 | 3300046675 | Ga0495657_0082957 | Ga0495657_0082957_1007_2047 | 342 |
| 89 | 3300046678 | Ga0495599_0101595 | Ga0495599_0101595_587_1627 | 342 |
| 90 | 3300046679 | Ga0495623_0012141 | Ga0495623_0012141_1130_2170 | 342 |
| 91 | 3300046689 | Ga0495613_0252770 | Ga0495613_0252770_115_1155 | 342 |
| 92 | 3300047317 | Ga0495604_0140305 | Ga0495604_0140305_585_1625 | 342 |
| 93 | 3300047317 | Ga0495604_0197844 | Ga0495604_0197844_35_1075 | 342 |
| 94 | 3300047322 | Ga0495680_0102944 | Ga0495680_0102944_588_1628 | 342 |
| 95 | 3300047444 | Ga0495675_0002554 | Ga0495675_0002554_217_1257 | 342 |
| 96 | 3300047444 | Ga0495675_0009077 | Ga0495675_0009077_5068_6108 | 342 |
| 97 | 3300047471 | Ga0495684_0004899 | Ga0495684_0004899_1134_2174 | 342 |
| 98 | 3300053085 | Ga0495619_0223365 | Ga0495619_0223365_187_1227 | 342 |
| 99 | iso_pu_bacteria | 2897803580 | 2897804031 | 342 |
| 100 | 3300002737 | JGI25162J39368_1000138 | JGI25162J39368_100013873 | 343 |
| 101 | 3300002741 | JGI25157J39369_1000253 | JGI25157J39369_100025330 | 343 |
| 102 | 3300002771 | JGI25163J39215_1000444 | JGI25163J39215_10004444 | 343 |
| 103 | 3300002772 | JGI25164J39214_1000170 | JGI25164J39214_100017053 | 343 |
| 104 | 3300003214 | JGI25165J46597_1000224 | JGI25165J46597_100022411 | 343 |
| 105 | 3300003751 | Ga0055538_1003075 | Ga0055538_10030751 | 343 |
| 106 | 3300003761 | Ga0055535_1000216 | Ga0055535_100021611 | 343 |
| 107 | 3300003762 | Ga0055542_1000179 | Ga0055542_100017911 | 343 |
| 108 | 3300003763 | Ga0055529_1000189 | Ga0055529_100018911 | 343 |
| 109 | 3300025207 | Ga0209760_100737 | Ga0209760_1007374 | 343 |
| 110 | 3300025224 | Ga0209784_100068 | Ga0209784_10006810 | 343 |
| 111 | 3300025228 | Ga0209672_106949 | Ga0209672_1069492 | 343 |
| 112 | 3300025231 | Ga0207427_100140 | Ga0207427_10014010 | 343 |
| 113 | 3300025233 | Ga0209437_100147 | Ga0209437_100147160 | 343 |
| 114 | 3300025242 | Ga0209258_100360 | Ga0209258_10036054 | 343 |
| 115 | 3300025250 | Ga0209026_1000099 | Ga0209026_100009910 | 343 |
| 116 | 3300025254 | Ga0209148_1000010 | Ga0209148_10000101072 | 343 |
| 117 | 3300025256 | Ga0209759_1000755 | Ga0209759_100075510 | 343 |
| 118 | 3300025261 | Ga0209233_1000009 | Ga0209233_100000997 | 343 |
| 119 | 3300025272 | Ga0209455_1000086 | Ga0209455_100008698 | 343 |
| 120 | 3300027361 | Ga0209489_100216 | Ga0209489_10021626 | 343 |
| 121 | 3300027363 | Ga0209700_100015 | Ga0209700_10001584 | 343 |
| 122 | 3300031251 | Ga0265327_10000665 | Ga0265327_1000066510 | 343 |
| 123 | 3300031727 | Ga0316576_10003573 | Ga0316576_100035738 | 343 |
| 124 | 3300031727 | Ga0316576_10028913 | Ga0316576_100289132 | 343 |
| 125 | 3300031727 | Ga0316576_10088903 | Ga0316576_100889032 | 343 |
| 126 | 3300031727 | Ga0316576_10137127 | Ga0316576_101371271 | 343 |
| 127 | 3300031728 | Ga0316578_10013604 | Ga0316578_100136043 | 343 |
| 128 | 3300031728 | Ga0316578_10015682 | Ga0316578_100156824 | 343 |
| 129 | 3300031728 | Ga0316578_10062530 | Ga0316578_100625302 | 343 |
| 130 | 3300031733 | Ga0316577_10008194 | Ga0316577_100081943 | 343 |
| 131 | 3300031733 | Ga0316577_10028960 | Ga0316577_100289602 | 343 |
| 132 | 3300031733 | Ga0316577_10034222 | Ga0316577_100342222 | 343 |
| 133 | 3300032139 | Ga0316580_10010473 | Ga0316580_100104733 | 343 |
| 134 | 3300032139 | Ga0316580_10016665 | Ga0316580_100166651 | 343 |
| 135 | 3300033524 | Ga0316592_1001443 | Ga0316592_10014432 | 343 |
| 136 | 3300033528 | Ga0316588_1000422 | Ga0316588_10004221 | 343 |
| 137 | 3300033528 | Ga0316588_1010315 | Ga0316588_10103152 | 343 |
| 138 | 3300033541 | Ga0316596_1000747 | Ga0316596_10007472 | 343 |
| 139 | 3300033541 | Ga0316596_1012330 | Ga0316596_10123302 | 343 |
| 140 | 3300033541 | Ga0316596_1018687 | Ga0316596_10186872 | 343 |
| 141 | 3300035398 | Ga0316574_0015190 | Ga0316574_0015190_851_1894 | 343 |
| 142 | 3300036647 | Ga0316582_0030374 | Ga0316582_0030374_416_1459 | 343 |
| 143 | 3300036647 | Ga0316582_0035179 | Ga0316582_0035179_643_1686 | 343 |
| 144 | 3300036647 | Ga0316582_0053116 | Ga0316582_0053116_418_1461 | 343 |
| 145 | 3300036712 | Ga0316584_0004455 | Ga0316584_0004455_1780_2823 | 343 |
| 146 | 3300039438 | Ga0436360_0398214 | Ga0436360_0398214_26_1069 | 343 |
| 147 | 3300046516 | Ga0495628_0016530 | Ga0495628_0016530_544_1647 | 343 |
| 148 | 3300047472 | Ga0495686_0037871 | Ga0495686_0037871_14_1174 | 343 |
| 149 | 3300048929 | Ga0496126_0021622 | Ga0496126_0021622_2026_3288 | 343 |
| 150 | iso_pu_bacteria | 2511231221 | 2512034545 | 343 |
| 151 | iso_pu_bacteria | 2513237096 | 2513659747 | 343 |
| 152 | iso_pu_bacteria | 2513237145 | 2513921734 | 343 |
| 153 | iso_pu_bacteria | 2513237145 | 2513921997 | 343 |
| 154 | iso_pu_bacteria | 2524023205 | 2524443576 | 343 |
| 155 | iso_pu_bacteria | 2524023228 | 2524541255 | 343 |
| 156 | iso_pu_bacteria | 2841974524 | 2841977128 | 343 |
| 157 | iso_pu_bacteria | 2842038055 | 2842044557 | 343 |
| 158 | iso_pu_bacteria | 2842045827 | 2842051454 | 343 |
| 159 | iso_pu_bacteria | 2874604998 | 2874605950 | 343 |
| 160 | iso_pu_bacteria | 2874612657 | 2874613824 | 343 |
| 161 | iso_pu_bacteria | 2874645413 | 2874646795 | 343 |
| 162 | iso_pu_bacteria | 2876771140 | 2876776629 | 343 |
| 163 | iso_pu_bacteria | 2876818435 | 2876824419 | 343 |
| 164 | iso_pu_bacteria | 2879074833 | 2879080766 | 343 |
| 165 | iso_pu_bacteria | 2879127579 | 2879133613 | 343 |
| 166 | iso_pu_bacteria | 2879142872 | 2879146590 | 343 |
| 167 | iso_pu_bacteria | 2889033259 | 2889041578 | 343 |
| 168 | iso_pu_bacteria | 2903748898 | 2903757064 | 343 |
| 169 | iso_pu_bacteria | 2904690495 | 2904692778 | 343 |
| 170 | iso_pu_bacteria | 2906610324 | 2906615015 | 343 |
| 171 | iso_pu_bacteria | 2906626472 | 2906632907 | 343 |
| 172 | iso_pu_bacteria | 2906660503 | 2906663814 | 343 |
| 173 | iso_pu_bacteria | 2906660503 | 2906664611 | 343 |
| 174 | iso_pu_bacteria | 2908739725 | 2908745397 | 343 |
| 175 | iso_pu_bacteria | 2908756301 | 2908758191 | 343 |
| 176 | iso_pu_bacteria | 2922425934 | 2922426833 | 343 |
| 177 | iso_pu_bacteria | 2935975950 | 2935982727 | 343 |
| 178 | iso_pu_bacteria | 8006933436 | 8006938168 | 343 |
| 179 | iso_pu_bacteria | 8006973647 | 8006978254 | 343 |
| 180 | iso_pu_bacteria | 8019619141 | 8019621778 | 343 |
| 181 | iso_pu_bacteria | 8019629233 | 8019631594 | 343 |
| 182 | iso_pu_bacteria | 8019638758 | 8019638977 | 343 |
| 183 | iso_pu_bacteria | 8019659431 | 8019668442 | 343 |
| 184 | iso_pu_bacteria | 8019668869 | 8019677800 | 343 |
| 185 | iso_pu_bacteria | 8019678201 | 8019687126 | 343 |
| 186 | 3300005455 | Ga0070663_100138556 | Ga0070663_1001385562 | 344 |
| 187 | 3300026067 | Ga0207678_10349805 | Ga0207678_103498052 | 344 |
| 188 | 3300036401 | Ga0373937_0157241 | Ga0373937_0157241_799_1836 | 344 |
| 189 | 3300042876 | Ga0451577_0067293 | Ga0451577_0067293_612_1646 | 344 |
| 190 | 3300049572 | Ga0501036_0007393 | Ga0501036_0007393_3061_4095 | 344 |
| 191 | 3300049574 | Ga0501038_0019049 | Ga0501038_0019049_2542_3576 | 344 |
| 192 | 3300049576 | Ga0501040_0028300 | Ga0501040_0028300_603_1637 | 344 |
| 193 | 3300049577 | Ga0501041_0033281 | Ga0501041_0033281_1951_2985 | 344 |
| 194 | 3300049578 | Ga0501042_0023785 | Ga0501042_0023785_1874_2908 | 344 |
| 195 | 3300049582 | Ga0501048_0006624 | Ga0501048_0006624_4999_6033 | 344 |
| 196 | 3300049587 | Ga0501071_0004644 | Ga0501071_0004644_3449_4483 | 344 |
| 197 | 3300049588 | Ga0501072_0011148 | Ga0501072_0011148_5381_6415 | 344 |
| 198 | 3300049591 | Ga0501075_0007266 | Ga0501075_0007266_4623_5657 | 344 |
| 199 | 3300049592 | Ga0501076_0004725 | Ga0501076_0004725_2169_3203 | 344 |
| 200 | 3300049822 | Ga0501035_0034011 | Ga0501035_0034011_1397_2431 | 344 |
| 201 | 3300049823 | Ga0501044_0193855 | Ga0501044_0193855_370_1404 | 344 |
| 202 | 3300049824 | Ga0501045_0050938 | Ga0501045_0050938_684_1718 | 344 |
| 203 | 3300009093 | Ga0105240_10042421 | Ga0105240_100424212 | 345 |
| 204 | 3300025913 | Ga0207695_10140651 | Ga0207695_101406512 | 345 |
| 205 | 3300031691 | Ga0316579_10011655 | Ga0316579_100116551 | 345 |
| 206 | 3300031728 | Ga0316578_10009818 | Ga0316578_100098185 | 345 |
| 207 | 3300031733 | Ga0316577_10008098 | Ga0316577_100080983 | 345 |
| 208 | 3300032137 | Ga0316585_10000095 | Ga0316585_1000009511 | 345 |
| 209 | 3300032139 | Ga0316580_10000585 | Ga0316580_100005856 | 345 |
| 210 | 3300033524 | Ga0316592_1026394 | Ga0316592_10263941 | 345 |
| 211 | 3300033528 | Ga0316588_1023043 | Ga0316588_10230431 | 345 |
| 212 | 3300033541 | Ga0316596_1026952 | Ga0316596_10269521 | 345 |
| 213 | 3300035398 | Ga0316574_0001660 | Ga0316574_0001660_22_1071 | 345 |
| 214 | 3300036647 | Ga0316582_0023121 | Ga0316582_0023121_2625_3674 | 345 |
| 215 | 3300036712 | Ga0316584_0030819 | Ga0316584_0030819_1115_2164 | 345 |
| 216 | 3300002705 | JGI25156J39149_1001215 | JGI25156J39149_10012157 | 347 |
| 217 | 3300002741 | JGI25157J39369_1001086 | JGI25157J39369_10010869 | 347 |
| 218 | 3300025246 | Ga0209646_1000535 | Ga0209646_100053514 | 347 |
| 219 | 3300025250 | Ga0209026_1000829 | Ga0209026_10008296 | 347 |
| 220 | 3300025256 | Ga0209759_1001078 | Ga0209759_10010786 | 347 |
| 221 | 3300025949 | Ga0207667_10166622 | Ga0207667_101666221 | 347 |
| 222 | iso_pu_bacteria | 2835312727 | 2835314521 | 347 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4aam-assembly1.cif.gz_A | maca wild-type mixed-valence | 0.9746 | 25 | 346 |
| 4aam-assembly1.cif.gz_A | maca wild-type mixed-valence | 0.9657 | 25 | 346 |
| 2vhd-assembly1.cif.gz_B | crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form | 0.9652 | 25 | 346 |
| 2c1v-assembly1.cif.gz_B | crystal structure of the di-haem cytochrome c peroxidase from paracoccus pantotrophus - mixed valence form | 0.9622 | 26 | 346 |
| 2vhd-assembly1.cif.gz_B | crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form | 0.9594 | 25 | 346 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4aanA02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.979 | 42 | 186 | 1.10.760.10 |
| 6fu3B01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9142 | 192 | 326 | 1.10.760.10 |
| 3o5cC01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9127 | 201 | 343 | 1.10.760.10 |
| 3sleA01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9063 | 53 | 186 | 1.10.760.10 |
| 3o5cD02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9031 | 54 | 207 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528A2G4-F1-model_v4 | Cytochrome C peroxidase | 0.9783 | 29 | 186 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-A0A0F2QM10-F1-model_v4 | Cytochrome C peroxidase | 0.9775 | 25 | 346 |
GO:0004130
GO:0009055 GO:0020037 GO:0042597 GO:0046872 |
| AF-P83787-F1-model_v4 | Cytochrome c peroxidase | 0.977 | 25 | 346 |
GO:0004130
GO:0009055 GO:0020037 GO:0042597 GO:0046872 |
| AF-A0A4Q4KAT7-F1-model_v4 | Cytochrome c peroxidase (EC 1.11.1.5) | 0.9763 | 27 | 346 |
GO:0004130
GO:0009055 GO:0020037 GO:0042597 GO:0046872 |
| AF-A0A0S8AP30-F1-model_v4 | Cytochrome C peroxidase | 0.9755 | 29 | 346 |
GO:0004130
GO:0009055 GO:0020037 GO:0042597 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar