F334912

General Info

Members Datasets Scaffolds Average Seq Length
222 166 168 350

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0021622|Ga0496126_0021622_2026_3288
Length 420
Sequence MLDKDNVAGNGAPGVYRWQPSGRRGTSALGPTWPMSIFREIADDLRSEAGVLIPINECECIWSYSNFRRGWELDMMRKFLSVAVAMLASSQAIADDDLMNAAKQSFTPIPSVLPAVKNNAVTRDKIELGKMLFFDPRLSASEIISCNTCHNIGTGGVDAGPTSVGHGWQKGPRRAPTVFNAVFNVAQFWDGRAADLKAQAKGPVQASVEMNATPDHVIKTLTSMPDYVAMFKKAFPNEASPVTFDNFAKAIEAFEATLITPAAPFDQYLEGDANALTEQQKAGLKLFMDKGCSSCHNGINIGGQDYFPFGVIEKPGSDVLPTADKGRFAVTKTASDEYVFRAAPLRNVALRAPYFHSGQVWNLKQAVGVMGEVQLGAKLNDKEENDIVAFLNSLTGQLPRIEYPILPTRTNTTPPPSLGK

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
11 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
12 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
13 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
14 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
15 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
16 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
17 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
18 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
19 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
20 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
21 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
22 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
23 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
24 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
25 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
26 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
27 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
28 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
29 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
30 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
31 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
32 2904699407
33 2906610324
34 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
35 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
36 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
37 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
38 2922368715
39 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
40 2922425934
41 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
42 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
43 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
44 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
45 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
46 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
52 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
62 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
70 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
71 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
72 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
73 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
93 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
99 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
100 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
101 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
102 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
158 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
159 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
160 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
161 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
162 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
163 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
164 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
165 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
166 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 71.1
Metatranscriptomes 5.96
Isolates 22.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.11
Nodule 22.07
Rhizoplane 0
Rhizosphere 58.11
Stem 0
Stem Tuber 0
Unclassified 11.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001215 3300002705 Bacteria 11378
2 JGI25162J39368_1000138 3300002737 Bacteria 78713
3 JGI25157J39369_1000253 3300002741 Bacteria 39977
4 JGI25157J39369_1001086 3300002741 Bacteria 12214
5 JGI25163J39215_1000444 3300002771 Bacteria 12688
6 JGI25164J39214_1000170 3300002772 Bacteria 60952
7 JGI25165J46597_1000224 3300003214 Bacteria 78713
8 rootH1_10201137 3300003323 Unclassified 1781
9 Ga0055538_1003075 3300003751 Bacteria 2203
10 Ga0055535_1000216 3300003761 Bacteria 60912
11 Ga0055542_1000179 3300003762 Bacteria 78713
12 Ga0055529_1000189 3300003763 Bacteria 84123
13 Ga0070683_100034360 3300005329 Bacteria 4631
14 Ga0070713_100010304 3300005436 Bacteria 6748
15 Ga0070663_100138556 3300005455 Bacteria 1855
16 Ga0070672_100142341 3300005543 Bacteria 1979
17 Ga0068856_100388368 3300005614 Bacteria 1415
18 Ga0068859_100212387 3300005617 Bacteria 2021
19 Ga0070717_10112075 3300006028 Bacteria 2328
20 Ga0097620_100212399 3300006931 Bacteria 2021
21 Ga0099824_1015255 3300006942 Bacteria 7347
22 Ga0099822_1000090 3300006943 Bacteria 52821
23 Ga0105240_10042421 3300009093 Bacteria 5797
24 Ga0105240_10270067 3300009093 Bacteria 1958
25 Ga0105240_10358499 3300009093 Bacteria 1652
26 Ga0105237_10051495 3300009545 Bacteria 4135
27 Ga0105238_10085799 3300009551 Bacteria 3136
28 Ga0157369_10023356 3300013105 Bacteria 6888
29 Ga0157372_10130193 3300013307 Bacteria 2894
30 Ga0157380_10141632 3300014326 Bacteria 2067
31 Ga0214544_1004829 3300021320 Bacteria 26676
32 Ga0214544_1011549 3300021320 Bacteria 12123
33 Ga0214542_1004733 3300021321 Bacteria 26676
34 Ga0214542_1011457 3300021321 Bacteria 12123
35 Ga0214545_1004314 3300021324 Bacteria 26676
36 Ga0214545_1011545 3300021324 Bacteria 12123
37 Ga0214543_1004404 3300021327 Bacteria 26739
38 Ga0214543_1011733 3300021327 Bacteria 12099
39 Ga0209760_100737 3300025207 Bacteria 4808
40 Ga0209784_100068 3300025224 Bacteria 152526
41 Ga0209672_106949 3300025228 Bacteria 1791
42 Ga0209563_100053 3300025230 Bacteria 332370
43 Ga0207427_100140 3300025231 Bacteria 84637
44 Ga0209437_100147 3300025233 Bacteria 161997
45 Ga0209258_100360 3300025242 Bacteria 61533
46 Ga0209646_1000535 3300025246 Bacteria 16572
47 Ga0209026_1000099 3300025250 Bacteria 161750
48 Ga0209026_1000829 3300025250 Bacteria 16442
49 Ga0209148_1000010 3300025254 Bacteria 1265567
50 Ga0209759_1000755 3300025256 Bacteria 27927
51 Ga0209759_1001078 3300025256 Bacteria 17835
52 Ga0209233_1000009 3300025261 Bacteria 1265567
53 Ga0209455_1000086 3300025272 Bacteria 244650
54 Ga0207695_10099799 3300025913 Bacteria 2900
55 Ga0207695_10140651 3300025913 Bacteria 2362
56 Ga0207700_10292544 3300025928 Unclassified 1404
57 Ga0207661_10030640 3300025944 Bacteria 4146
58 Ga0207667_10166622 3300025949 Bacteria 2265
59 Ga0207639_10185438 3300026041 Bacteria 1773
60 Ga0207678_10349805 3300026067 Bacteria 1274
61 Ga0209489_100216 3300027361 Bacteria 95472
62 Ga0209700_100015 3300027363 Bacteria 257238
63 Ga0265327_10000665 3300031251 Bacteria 55138
64 Ga0316579_10001296 3300031691 Bacteria 9024
65 Ga0316579_10011655 3300031691 Bacteria 3741
66 Ga0316576_10001708 3300031727 Bacteria 12055
67 Ga0316576_10003573 3300031727 Bacteria 9158
68 Ga0316576_10028913 3300031727 Bacteria 3912
69 Ga0316576_10054231 3300031727 Bacteria 2923
70 Ga0316576_10088903 3300031727 Bacteria 2300
71 Ga0316576_10137127 3300031727 Bacteria 1842
72 Ga0316578_10001012 3300031728 Bacteria 10764
73 Ga0316578_10009818 3300031728 Bacteria 4938
74 Ga0316578_10013604 3300031728 Bacteria 4320
75 Ga0316578_10015682 3300031728 Bacteria 4081
76 Ga0316578_10062530 3300031728 Bacteria 2195
77 Ga0316577_10001501 3300031733 Bacteria 11051
78 Ga0316577_10008098 3300031733 Bacteria 5619
79 Ga0316577_10008194 3300031733 Bacteria 5594
80 Ga0316577_10028960 3300031733 Bacteria 3091
81 Ga0316577_10034222 3300031733 Bacteria 2839
82 Ga0316583_10000421 3300032133 Bacteria 12407
83 Ga0316585_10000095 3300032137 Bacteria 15825
84 Ga0316585_10002390 3300032137 Bacteria 5056
85 Ga0316580_10000169 3300032139 Bacteria 12934
86 Ga0316580_10000585 3300032139 Bacteria 8546
87 Ga0316580_10010473 3300032139 Bacteria 2803
88 Ga0316580_10016665 3300032139 Bacteria 2256
89 Ga0316592_1000409 3300033524 Bacteria 5780
90 Ga0316592_1001443 3300033524 Bacteria 3822
91 Ga0316592_1026394 3300033524 Bacteria 1254
92 Ga0316586_1004930 3300033527 Bacteria 1850
93 Ga0316588_1000422 3300033528 Bacteria 5639
94 Ga0316588_1010315 3300033528 Bacteria 1967
95 Ga0316588_1023043 3300033528 Bacteria 1426
96 Ga0316587_1013486 3300033529 Bacteria 1339
97 Ga0316596_1000747 3300033541 Bacteria 5939
98 Ga0316596_1002917 3300033541 Bacteria 3705
99 Ga0316596_1012330 3300033541 Bacteria 2102
100 Ga0316596_1018687 3300033541 Bacteria 1754
101 Ga0316596_1026952 3300033541 Bacteria 1482
102 Ga0373923_0086874 3300035111 Bacteria 1363
103 Ga0373932_0025350 3300035112 Bacteria 1604
104 Ga0373954_0048130 3300035118 Bacteria 1997
105 Ga0373956_0005206 3300035119 Bacteria 5207
106 Ga0373955_0024673 3300035172 Bacteria 3077
107 Ga0316574_0000777 3300035398 Bacteria 13773
108 Ga0316574_0001660 3300035398 Bacteria 10717
109 Ga0316574_0015190 3300035398 Bacteria 4467
110 Ga0373924_0128419 3300035410 Bacteria 1102
111 Ga0373933_0001166 3300035724 Bacteria 15582
112 Ga0373933_0160739 3300035724 Bacteria 1426
113 Ga0373937_0157241 3300036401 Bacteria 2131
114 Ga0316582_0001689 3300036647 Bacteria 9914
115 Ga0316582_0023121 3300036647 Bacteria 3700
116 Ga0316582_0030374 3300036647 Bacteria 3292
117 Ga0316582_0035179 3300036647 Bacteria 3090
118 Ga0316582_0053116 3300036647 Bacteria 2577
119 Ga0316584_0004455 3300036712 Bacteria 9268
120 Ga0316584_0030819 3300036712 Bacteria 3963
121 Ga0436360_0374983 3300039438 Bacteria 1129
122 Ga0436360_0398214 3300039438 Bacteria 1336
123 Ga0451577_0000188 3300042876 Bacteria 131320
124 Ga0451577_0067293 3300042876 Bacteria 3195
125 Ga0451577_0227715 3300042876 Bacteria 1685
126 Ga0453684_0000612 3300044712 Bacteria 131319
127 Ga0453684_0003172 3300044712 Bacteria 37778
128 Ga0451576_0065023 3300045051 Bacteria 3798
129 Ga0495592_0038566 3300046454 Bacteria 3594
130 Ga0495651_0066332 3300046462 Bacteria 2755
131 Ga0495653_0051004 3300046463 Bacteria 3179
132 Ga0495608_0084325 3300046511 Bacteria 2061
133 Ga0495628_0016530 3300046516 Bacteria 6154
134 Ga0495630_0005803 3300046517 Bacteria 8721
135 Ga0495652_0017289 3300046529 Bacteria 6437
136 Ga0495587_0000712 3300046536 Bacteria 22252
137 Ga0495587_0001756 3300046536 Bacteria 14485
138 Ga0495657_0082957 3300046675 Bacteria 2070
139 Ga0495599_0101595 3300046678 Bacteria 1792
140 Ga0495623_0012141 3300046679 Bacteria 5581
141 Ga0495613_0252770 3300046689 Bacteria 1229
142 Ga0495604_0140305 3300047317 Bacteria 1727
143 Ga0495604_0197844 3300047317 Bacteria 1396
144 Ga0495680_0102944 3300047322 Bacteria 2125
145 Ga0495675_0002554 3300047444 Bacteria 10892
146 Ga0495675_0009077 3300047444 Bacteria 6179
147 Ga0495684_0004899 3300047471 Bacteria 10444
148 Ga0495686_0037871 3300047472 Bacteria 3088
149 Ga0495602_0044513 3300048088 Unclassified 4025
150 Ga0496126_0021622 3300048929 Bacteria 6281
151 Ga0501036_0007393 3300049572 Bacteria 8951
152 Ga0501038_0019049 3300049574 Bacteria 6191
153 Ga0501040_0028300 3300049576 Bacteria 3777
154 Ga0501041_0033281 3300049577 Bacteria 3118
155 Ga0501042_0023785 3300049578 Bacteria 4291
156 Ga0501048_0006624 3300049582 Bacteria 8804
157 Ga0501069_0074783 3300049585 Bacteria 1902
158 Ga0501070_0014991 3300049586 Bacteria 6522
159 Ga0501070_0305177 3300049586 Bacteria 1296
160 Ga0501071_0004644 3300049587 Bacteria 8722
161 Ga0501072_0011148 3300049588 Bacteria 6861
162 Ga0501075_0007266 3300049591 Bacteria 7681
163 Ga0501075_0011768 3300049591 Bacteria 6203
164 Ga0501076_0004725 3300049592 Bacteria 9719
165 Ga0501035_0034011 3300049822 Bacteria 4633
166 Ga0501044_0193855 3300049823 Bacteria 1993
167 Ga0501045_0050938 3300049824 Bacteria 3021
168 Ga0495619_0223365 3300053085 Bacteria 1305

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025928 Ga0207700_10292544 Ga0207700_102925442 327
2 3300005436 Ga0070713_100010304 Ga0070713_1000103044 330
3 3300005614 Ga0068856_100388368 Ga0068856_1003883681 330
4 3300006028 Ga0070717_10112075 Ga0070717_101120751 331
5 3300006943 Ga0099822_1000090 Ga0099822_100009048 334
6 3300014326 Ga0157380_10141632 Ga0157380_101416322 335
7 3300031691 Ga0316579_10001296 Ga0316579_100012962 335
8 3300031727 Ga0316576_10001708 Ga0316576_100017087 335
9 3300031727 Ga0316576_10054231 Ga0316576_100542312 335
10 3300031728 Ga0316578_10001012 Ga0316578_100010127 335
11 3300031733 Ga0316577_10001501 Ga0316577_100015013 335
12 3300032133 Ga0316583_10000421 Ga0316583_100004212 335
13 3300032137 Ga0316585_10002390 Ga0316585_100023903 335
14 3300032139 Ga0316580_10000169 Ga0316580_100001692 335
15 3300033524 Ga0316592_1000409 Ga0316592_10004093 335
16 3300033527 Ga0316586_1004930 Ga0316586_10049301 335
17 3300033529 Ga0316587_1013486 Ga0316587_10134862 335
18 3300033541 Ga0316596_1002917 Ga0316596_10029171 335
19 3300035398 Ga0316574_0000777 Ga0316574_0000777_6269_7339 335
20 3300036647 Ga0316582_0001689 Ga0316582_0001689_8089_9159 335
21 3300006942 Ga0099824_1015255 Ga0099824_10152555 336
22 3300035724 Ga0373933_0160739 Ga0373933_0160739_387_1397 336
23 3300048088 Ga0495602_0044513 Ga0495602_0044513_2705_3724 336
24 iso_pu_bacteria 2513237087 2513594264 337
25 3300009093 Ga0105240_10270067 Ga0105240_102700672 339
26 3300009093 Ga0105240_10358499 Ga0105240_103584992 339
27 3300009545 Ga0105237_10051495 Ga0105237_100514953 339
28 3300009551 Ga0105238_10085799 Ga0105238_100857993 339
29 3300013105 Ga0157369_10023356 Ga0157369_100233565 339
30 3300013307 Ga0157372_10130193 Ga0157372_101301933 339
31 3300025913 Ga0207695_10099799 Ga0207695_100997992 339
32 iso_pu_bacteria 2513237102 2513706276 339
33 iso_pu_bacteria 2513237104 2513719991 339
34 iso_pu_bacteria 2524023210 2524466692 339
35 iso_pu_bacteria 2617270741 2617379913 339
36 iso_pu_bacteria 2728368998 2728749654 339
37 iso_pu_bacteria 2841949485 2841957665 339
38 iso_pu_bacteria 2881364244 2881367912 339
39 iso_pu_bacteria 2903768456 2903775942 339
40 iso_pu_bacteria 2922393267 2922395973 339
41 3300003323 rootH1_10201137 rootH1_102011371 340
42 3300026041 Ga0207639_10185438 Ga0207639_101854382 340
43 iso_pu_bacteria 2834578030 2834578748 340
44 iso_pu_bacteria 2904699407 2904706467 340
45 iso_pu_bacteria 2922368715 2922370366 340
46 iso_pu_bacteria 8054002106 8054003924 340
47 3300005329 Ga0070683_100034360 Ga0070683_1000343602 341
48 3300025944 Ga0207661_10030640 Ga0207661_100306407 341
49 3300042876 Ga0451577_0000188 Ga0451577_0000188_49853_50887 341
50 3300044712 Ga0453684_0000612 Ga0453684_0000612_49840_50874 341
51 3300049585 Ga0501069_0074783 Ga0501069_0074783_84_1181 341
52 3300049586 Ga0501070_0014991 Ga0501070_0014991_1370_2467 341
53 3300049586 Ga0501070_0305177 Ga0501070_0305177_155_1252 341
54 3300049591 Ga0501075_0011768 Ga0501075_0011768_1556_2653 341
55 iso_pu_bacteria 8045864390 8045866664 341
56 iso_pu_bacteria 8045864390 8045868441 341
57 3300005543 Ga0070672_100142341 Ga0070672_1001423412 342
58 3300005617 Ga0068859_100212387 Ga0068859_1002123871 342
59 3300006931 Ga0097620_100212399 Ga0097620_1002123992 342
60 3300021320 Ga0214544_1004829 Ga0214544_100482926 342
61 3300021320 Ga0214544_1011549 Ga0214544_10115494 342
62 3300021321 Ga0214542_1004733 Ga0214542_100473326 342
63 3300021321 Ga0214542_1011457 Ga0214542_10114574 342
64 3300021324 Ga0214545_1004314 Ga0214545_100431417 342
65 3300021324 Ga0214545_1011545 Ga0214545_10115454 342
66 3300021327 Ga0214543_1004404 Ga0214543_100440426 342
67 3300021327 Ga0214543_1011733 Ga0214543_10117334 342
68 3300025230 Ga0209563_100053 Ga0209563_100053154 342
69 3300035111 Ga0373923_0086874 Ga0373923_0086874_237_1277 342
70 3300035112 Ga0373932_0025350 Ga0373932_0025350_456_1496 342
71 3300035118 Ga0373954_0048130 Ga0373954_0048130_840_1880 342
72 3300035119 Ga0373956_0005206 Ga0373956_0005206_3126_4166 342
73 3300035172 Ga0373955_0024673 Ga0373955_0024673_1371_2411 342
74 3300035410 Ga0373924_0128419 Ga0373924_0128419_28_1068 342
75 3300035724 Ga0373933_0001166 Ga0373933_0001166_2606_3646 342
76 3300039438 Ga0436360_0374983 Ga0436360_0374983_20_1066 342
77 3300042876 Ga0451577_0227715 Ga0451577_0227715_413_1453 342
78 3300044712 Ga0453684_0003172 Ga0453684_0003172_12254_13294 342
79 3300045051 Ga0451576_0065023 Ga0451576_0065023_1408_2448 342
80 3300046454 Ga0495592_0038566 Ga0495592_0038566_1641_2681 342
81 3300046462 Ga0495651_0066332 Ga0495651_0066332_1654_2694 342
82 3300046463 Ga0495653_0051004 Ga0495653_0051004_615_1655 342
83 3300046511 Ga0495608_0084325 Ga0495608_0084325_34_1074 342
84 3300046517 Ga0495630_0005803 Ga0495630_0005803_7410_8450 342
85 3300046529 Ga0495652_0017289 Ga0495652_0017289_4995_6035 342
86 3300046536 Ga0495587_0000712 Ga0495587_0000712_5088_6128 342
87 3300046536 Ga0495587_0001756 Ga0495587_0001756_13412_14452 342
88 3300046675 Ga0495657_0082957 Ga0495657_0082957_1007_2047 342
89 3300046678 Ga0495599_0101595 Ga0495599_0101595_587_1627 342
90 3300046679 Ga0495623_0012141 Ga0495623_0012141_1130_2170 342
91 3300046689 Ga0495613_0252770 Ga0495613_0252770_115_1155 342
92 3300047317 Ga0495604_0140305 Ga0495604_0140305_585_1625 342
93 3300047317 Ga0495604_0197844 Ga0495604_0197844_35_1075 342
94 3300047322 Ga0495680_0102944 Ga0495680_0102944_588_1628 342
95 3300047444 Ga0495675_0002554 Ga0495675_0002554_217_1257 342
96 3300047444 Ga0495675_0009077 Ga0495675_0009077_5068_6108 342
97 3300047471 Ga0495684_0004899 Ga0495684_0004899_1134_2174 342
98 3300053085 Ga0495619_0223365 Ga0495619_0223365_187_1227 342
99 iso_pu_bacteria 2897803580 2897804031 342
100 3300002737 JGI25162J39368_1000138 JGI25162J39368_100013873 343
101 3300002741 JGI25157J39369_1000253 JGI25157J39369_100025330 343
102 3300002771 JGI25163J39215_1000444 JGI25163J39215_10004444 343
103 3300002772 JGI25164J39214_1000170 JGI25164J39214_100017053 343
104 3300003214 JGI25165J46597_1000224 JGI25165J46597_100022411 343
105 3300003751 Ga0055538_1003075 Ga0055538_10030751 343
106 3300003761 Ga0055535_1000216 Ga0055535_100021611 343
107 3300003762 Ga0055542_1000179 Ga0055542_100017911 343
108 3300003763 Ga0055529_1000189 Ga0055529_100018911 343
109 3300025207 Ga0209760_100737 Ga0209760_1007374 343
110 3300025224 Ga0209784_100068 Ga0209784_10006810 343
111 3300025228 Ga0209672_106949 Ga0209672_1069492 343
112 3300025231 Ga0207427_100140 Ga0207427_10014010 343
113 3300025233 Ga0209437_100147 Ga0209437_100147160 343
114 3300025242 Ga0209258_100360 Ga0209258_10036054 343
115 3300025250 Ga0209026_1000099 Ga0209026_100009910 343
116 3300025254 Ga0209148_1000010 Ga0209148_10000101072 343
117 3300025256 Ga0209759_1000755 Ga0209759_100075510 343
118 3300025261 Ga0209233_1000009 Ga0209233_100000997 343
119 3300025272 Ga0209455_1000086 Ga0209455_100008698 343
120 3300027361 Ga0209489_100216 Ga0209489_10021626 343
121 3300027363 Ga0209700_100015 Ga0209700_10001584 343
122 3300031251 Ga0265327_10000665 Ga0265327_1000066510 343
123 3300031727 Ga0316576_10003573 Ga0316576_100035738 343
124 3300031727 Ga0316576_10028913 Ga0316576_100289132 343
125 3300031727 Ga0316576_10088903 Ga0316576_100889032 343
126 3300031727 Ga0316576_10137127 Ga0316576_101371271 343
127 3300031728 Ga0316578_10013604 Ga0316578_100136043 343
128 3300031728 Ga0316578_10015682 Ga0316578_100156824 343
129 3300031728 Ga0316578_10062530 Ga0316578_100625302 343
130 3300031733 Ga0316577_10008194 Ga0316577_100081943 343
131 3300031733 Ga0316577_10028960 Ga0316577_100289602 343
132 3300031733 Ga0316577_10034222 Ga0316577_100342222 343
133 3300032139 Ga0316580_10010473 Ga0316580_100104733 343
134 3300032139 Ga0316580_10016665 Ga0316580_100166651 343
135 3300033524 Ga0316592_1001443 Ga0316592_10014432 343
136 3300033528 Ga0316588_1000422 Ga0316588_10004221 343
137 3300033528 Ga0316588_1010315 Ga0316588_10103152 343
138 3300033541 Ga0316596_1000747 Ga0316596_10007472 343
139 3300033541 Ga0316596_1012330 Ga0316596_10123302 343
140 3300033541 Ga0316596_1018687 Ga0316596_10186872 343
141 3300035398 Ga0316574_0015190 Ga0316574_0015190_851_1894 343
142 3300036647 Ga0316582_0030374 Ga0316582_0030374_416_1459 343
143 3300036647 Ga0316582_0035179 Ga0316582_0035179_643_1686 343
144 3300036647 Ga0316582_0053116 Ga0316582_0053116_418_1461 343
145 3300036712 Ga0316584_0004455 Ga0316584_0004455_1780_2823 343
146 3300039438 Ga0436360_0398214 Ga0436360_0398214_26_1069 343
147 3300046516 Ga0495628_0016530 Ga0495628_0016530_544_1647 343
148 3300047472 Ga0495686_0037871 Ga0495686_0037871_14_1174 343
149 3300048929 Ga0496126_0021622 Ga0496126_0021622_2026_3288 343
150 iso_pu_bacteria 2511231221 2512034545 343
151 iso_pu_bacteria 2513237096 2513659747 343
152 iso_pu_bacteria 2513237145 2513921734 343
153 iso_pu_bacteria 2513237145 2513921997 343
154 iso_pu_bacteria 2524023205 2524443576 343
155 iso_pu_bacteria 2524023228 2524541255 343
156 iso_pu_bacteria 2841974524 2841977128 343
157 iso_pu_bacteria 2842038055 2842044557 343
158 iso_pu_bacteria 2842045827 2842051454 343
159 iso_pu_bacteria 2874604998 2874605950 343
160 iso_pu_bacteria 2874612657 2874613824 343
161 iso_pu_bacteria 2874645413 2874646795 343
162 iso_pu_bacteria 2876771140 2876776629 343
163 iso_pu_bacteria 2876818435 2876824419 343
164 iso_pu_bacteria 2879074833 2879080766 343
165 iso_pu_bacteria 2879127579 2879133613 343
166 iso_pu_bacteria 2879142872 2879146590 343
167 iso_pu_bacteria 2889033259 2889041578 343
168 iso_pu_bacteria 2903748898 2903757064 343
169 iso_pu_bacteria 2904690495 2904692778 343
170 iso_pu_bacteria 2906610324 2906615015 343
171 iso_pu_bacteria 2906626472 2906632907 343
172 iso_pu_bacteria 2906660503 2906663814 343
173 iso_pu_bacteria 2906660503 2906664611 343
174 iso_pu_bacteria 2908739725 2908745397 343
175 iso_pu_bacteria 2908756301 2908758191 343
176 iso_pu_bacteria 2922425934 2922426833 343
177 iso_pu_bacteria 2935975950 2935982727 343
178 iso_pu_bacteria 8006933436 8006938168 343
179 iso_pu_bacteria 8006973647 8006978254 343
180 iso_pu_bacteria 8019619141 8019621778 343
181 iso_pu_bacteria 8019629233 8019631594 343
182 iso_pu_bacteria 8019638758 8019638977 343
183 iso_pu_bacteria 8019659431 8019668442 343
184 iso_pu_bacteria 8019668869 8019677800 343
185 iso_pu_bacteria 8019678201 8019687126 343
186 3300005455 Ga0070663_100138556 Ga0070663_1001385562 344
187 3300026067 Ga0207678_10349805 Ga0207678_103498052 344
188 3300036401 Ga0373937_0157241 Ga0373937_0157241_799_1836 344
189 3300042876 Ga0451577_0067293 Ga0451577_0067293_612_1646 344
190 3300049572 Ga0501036_0007393 Ga0501036_0007393_3061_4095 344
191 3300049574 Ga0501038_0019049 Ga0501038_0019049_2542_3576 344
192 3300049576 Ga0501040_0028300 Ga0501040_0028300_603_1637 344
193 3300049577 Ga0501041_0033281 Ga0501041_0033281_1951_2985 344
194 3300049578 Ga0501042_0023785 Ga0501042_0023785_1874_2908 344
195 3300049582 Ga0501048_0006624 Ga0501048_0006624_4999_6033 344
196 3300049587 Ga0501071_0004644 Ga0501071_0004644_3449_4483 344
197 3300049588 Ga0501072_0011148 Ga0501072_0011148_5381_6415 344
198 3300049591 Ga0501075_0007266 Ga0501075_0007266_4623_5657 344
199 3300049592 Ga0501076_0004725 Ga0501076_0004725_2169_3203 344
200 3300049822 Ga0501035_0034011 Ga0501035_0034011_1397_2431 344
201 3300049823 Ga0501044_0193855 Ga0501044_0193855_370_1404 344
202 3300049824 Ga0501045_0050938 Ga0501045_0050938_684_1718 344
203 3300009093 Ga0105240_10042421 Ga0105240_100424212 345
204 3300025913 Ga0207695_10140651 Ga0207695_101406512 345
205 3300031691 Ga0316579_10011655 Ga0316579_100116551 345
206 3300031728 Ga0316578_10009818 Ga0316578_100098185 345
207 3300031733 Ga0316577_10008098 Ga0316577_100080983 345
208 3300032137 Ga0316585_10000095 Ga0316585_1000009511 345
209 3300032139 Ga0316580_10000585 Ga0316580_100005856 345
210 3300033524 Ga0316592_1026394 Ga0316592_10263941 345
211 3300033528 Ga0316588_1023043 Ga0316588_10230431 345
212 3300033541 Ga0316596_1026952 Ga0316596_10269521 345
213 3300035398 Ga0316574_0001660 Ga0316574_0001660_22_1071 345
214 3300036647 Ga0316582_0023121 Ga0316582_0023121_2625_3674 345
215 3300036712 Ga0316584_0030819 Ga0316584_0030819_1115_2164 345
216 3300002705 JGI25156J39149_1001215 JGI25156J39149_10012157 347
217 3300002741 JGI25157J39369_1001086 JGI25157J39369_10010869 347
218 3300025246 Ga0209646_1000535 Ga0209646_100053514 347
219 3300025250 Ga0209026_1000829 Ga0209026_10008296 347
220 3300025256 Ga0209759_1001078 Ga0209759_10010786 347
221 3300025949 Ga0207667_10166622 Ga0207667_101666221 347
222 iso_pu_bacteria 2835312727 2835314521 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03150

CCP_MauG

Di-haem cytochrome c peroxidase

123

274

0.98

PF00034

Cytochrom_C

Cytochrome c

280

395

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aam-assembly1.cif.gz_A maca wild-type mixed-valence 0.9746 25 346
4aam-assembly1.cif.gz_A maca wild-type mixed-valence 0.9657 25 346
2vhd-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form 0.9652 25 346
2c1v-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from paracoccus pantotrophus - mixed valence form 0.9622 26 346
2vhd-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form 0.9594 25 346
ID Description Score Start End Superfamily
4aanA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.979 42 186 1.10.760.10
6fu3B01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9142 192 326 1.10.760.10
3o5cC01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9127 201 343 1.10.760.10
3sleA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9063 53 186 1.10.760.10
3o5cD02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9031 54 207 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A528A2G4-F1-model_v4 Cytochrome C peroxidase 0.9783 29 186 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A0F2QM10-F1-model_v4 Cytochrome C peroxidase 0.9775 25 346 GO:0004130
GO:0009055
GO:0020037
GO:0042597
GO:0046872
AF-P83787-F1-model_v4 Cytochrome c peroxidase 0.977 25 346 GO:0004130
GO:0009055
GO:0020037
GO:0042597
GO:0046872
AF-A0A4Q4KAT7-F1-model_v4 Cytochrome c peroxidase (EC 1.11.1.5) 0.9763 27 346 GO:0004130
GO:0009055
GO:0020037
GO:0042597
GO:0046872
AF-A0A0S8AP30-F1-model_v4 Cytochrome C peroxidase 0.9755 29 346 GO:0004130
GO:0009055
GO:0020037
GO:0042597
GO:0046872

Feature Viewer

pLDDT pTM Quality
84.09 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map