F334839
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 222 | 157 | 221 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300046679|Ga0495623_0514435|Ga0495623_0514435_168_551 |
| Length | 121 |
| Sequence | LSKAVADTSIFIAQETGRELGVLPEKIAVSVITIAELELGVLRATDPDARARRLSTLSRVQSIYPLLPIGPEVASCFARIAAAERSRHDTWIAATAMKHAAVVVTQDSDFSSFDEVAVLRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 15 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 19 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 20 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 22 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 35 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 59 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 60 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 61 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 62 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 63 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 64 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 65 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 66 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 67 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 68 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 69 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 70 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 103 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 104 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 105 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 106 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 108 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 109 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 110 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 111 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 112 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 113 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 114 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 115 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 116 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 117 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 118 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 153 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 154 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 155 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.8 |
| Nodule | 0 |
| Rhizoplane | 10.36 |
| Rhizosphere | 82.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000305 | 3300001977 | Bacteria | 7033 |
| 2 | Ga0070683_100464625 | 3300005329 | Bacteria | 1208 |
| 3 | Ga0070683_100749069 | 3300005329 | Bacteria | 936 |
| 4 | Ga0070675_100000043 | 3300005354 | Bacteria | 77565 |
| 5 | Ga0070659_100013777 | 3300005366 | Bacteria | 6030 |
| 6 | Ga0070714_100000104 | 3300005435 | Bacteria | 70946 |
| 7 | Ga0070714_100184357 | 3300005435 | Bacteria | 1901 |
| 8 | Ga0070714_100222833 | 3300005435 | Unclassified | 1734 |
| 9 | Ga0070713_100023361 | 3300005436 | Bacteria | 4797 |
| 10 | Ga0070710_10000001 | 3300005437 | Bacteria | 552187 |
| 11 | Ga0070711_100002198 | 3300005439 | Bacteria | 11075 |
| 12 | Ga0070705_100004877 | 3300005440 | Bacteria | 6533 |
| 13 | Ga0070662_100000009 | 3300005457 | Bacteria | 142979 |
| 14 | Ga0070685_10000060 | 3300005466 | Bacteria | 63737 |
| 15 | Ga0070684_100043402 | 3300005535 | Bacteria | 3882 |
| 16 | Ga0070665_101115186 | 3300005548 | Bacteria | 800 |
| 17 | Ga0068855_100063824 | 3300005563 | Bacteria | 4297 |
| 18 | Ga0070664_100384665 | 3300005564 | Bacteria | 1281 |
| 19 | Ga0068854_100000249 | 3300005578 | Bacteria | 36592 |
| 20 | Ga0068856_101291405 | 3300005614 | Bacteria | 745 |
| 21 | Ga0068861_100167292 | 3300005719 | Bacteria | 1819 |
| 22 | Ga0068851_10001089 | 3300005834 | Bacteria | 11783 |
| 23 | Ga0070712_100000291 | 3300006175 | Bacteria | 28230 |
| 24 | Ga0075436_100473220 | 3300006914 | Bacteria | 914 |
| 25 | Ga0105240_10100173 | 3300009093 | Bacteria | 3526 |
| 26 | Ga0105240_10176924 | 3300009093 | Bacteria | 2522 |
| 27 | Ga0105240_11150895 | 3300009093 | Bacteria | 823 |
| 28 | Ga0105245_10000553 | 3300009098 | Bacteria | 33948 |
| 29 | Ga0114129_12611165 | 3300009147 | Unclassified | 603 |
| 30 | Ga0105243_10635690 | 3300009148 | Bacteria | 1032 |
| 31 | Ga0105241_10073517 | 3300009174 | Bacteria | 2660 |
| 32 | Ga0105237_10591714 | 3300009545 | Bacteria | 1116 |
| 33 | Ga0105239_10038373 | 3300010375 | Bacteria | 5249 |
| 34 | Ga0105246_10037438 | 3300011119 | Bacteria | 3256 |
| 35 | Ga0157370_10090654 | 3300013104 | Unclassified | 2870 |
| 36 | Ga0157375_12116959 | 3300013308 | Unclassified | 670 |
| 37 | Ga0157377_10595611 | 3300014745 | Bacteria | 788 |
| 38 | Ga0163161_10000018 | 3300017792 | Bacteria | 228801 |
| 39 | Ga0154015_1558649 | 3300020610 | Bacteria | 1119 |
| 40 | Ga0207656_10034140 | 3300025321 | Bacteria | 2122 |
| 41 | Ga0207692_10000007 | 3300025898 | Bacteria | 233250 |
| 42 | Ga0207654_10123945 | 3300025911 | Bacteria | 1626 |
| 43 | Ga0207695_10070694 | 3300025913 | Bacteria | 3566 |
| 44 | Ga0207695_10165520 | 3300025913 | Bacteria | 2140 |
| 45 | Ga0207693_10000648 | 3300025915 | Bacteria | 31139 |
| 46 | Ga0207693_10015100 | 3300025915 | Bacteria | 6199 |
| 47 | Ga0207663_10001040 | 3300025916 | Bacteria | 12723 |
| 48 | Ga0207657_11190372 | 3300025919 | Unclassified | 579 |
| 49 | Ga0207659_10000276 | 3300025926 | Bacteria | 31262 |
| 50 | Ga0207687_10000245 | 3300025927 | Bacteria | 36917 |
| 51 | Ga0207700_11035237 | 3300025928 | Unclassified | 734 |
| 52 | Ga0207664_10000004 | 3300025929 | Bacteria | 493014 |
| 53 | Ga0207664_10021940 | 3300025929 | Bacteria | 4757 |
| 54 | Ga0207664_10032028 | 3300025929 | Bacteria | 4027 |
| 55 | Ga0207690_10003161 | 3300025932 | Bacteria | 9894 |
| 56 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 57 | Ga0207709_11442684 | 3300025935 | Bacteria | 570 |
| 58 | Ga0207661_10000312 | 3300025944 | Bacteria | 30978 |
| 59 | Ga0207661_10378121 | 3300025944 | Bacteria | 1282 |
| 60 | Ga0207661_10476948 | 3300025944 | Bacteria | 1138 |
| 61 | Ga0207679_10209122 | 3300025945 | Bacteria | 1635 |
| 62 | Ga0207667_10229804 | 3300025949 | Unclassified | 1900 |
| 63 | Ga0207640_10000114 | 3300025981 | Bacteria | 60718 |
| 64 | Ga0207677_10000374 | 3300026023 | Bacteria | 31092 |
| 65 | Ga0207678_10235537 | 3300026067 | Unclassified | 1568 |
| 66 | Ga0207702_10004972 | 3300026078 | Bacteria | 11680 |
| 67 | Ga0207702_10712269 | 3300026078 | Unclassified | 989 |
| 68 | Ga0207648_10002000 | 3300026089 | Bacteria | 22250 |
| 69 | Ga0268266_10318992 | 3300028379 | Bacteria | 1454 |
| 70 | Ga0265326_10000093 | 3300028558 | Bacteria | 46031 |
| 71 | Ga0265319_1001386 | 3300028563 | Bacteria | 14556 |
| 72 | Ga0265334_10000035 | 3300028573 | Bacteria | 105691 |
| 73 | Ga0265336_10002500 | 3300028666 | Bacteria | 7533 |
| 74 | Ga0265338_10004183 | 3300028800 | Bacteria | 19684 |
| 75 | Ga0265338_10192430 | 3300028800 | Bacteria | 1545 |
| 76 | Ga0265324_10001841 | 3300029957 | Bacteria | 11494 |
| 77 | Ga0373957_0180462 | 3300035120 | Bacteria | 875 |
| 78 | Ga0373937_0437094 | 3300036401 | Bacteria | 1242 |
| 79 | Ga0373937_0812216 | 3300036401 | Unclassified | 883 |
| 80 | Ga0451807_1394619 | 3300041486 | Bacteria | 1813 |
| 81 | Ga0466963_0901078 | 3300044694 | Unclassified | 623 |
| 82 | Ga0466964_0824270 | 3300044706 | Bacteria | 526 |
| 83 | Ga0466967_0110143 | 3300045976 | Bacteria | 2529 |
| 84 | Ga0495627_200652 | 3300046453 | Unclassified | 549 |
| 85 | Ga0495592_0367688 | 3300046454 | Bacteria | 918 |
| 86 | Ga0495592_0496846 | 3300046454 | Unclassified | 757 |
| 87 | Ga0495603_0001631 | 3300046455 | Bacteria | 13179 |
| 88 | Ga0495638_0016906 | 3300046460 | Bacteria | 4877 |
| 89 | Ga0495641_0071503 | 3300046461 | Bacteria | 1557 |
| 90 | Ga0495653_0031193 | 3300046463 | Bacteria | 4238 |
| 91 | Ga0495662_0009480 | 3300046476 | Bacteria | 4776 |
| 92 | Ga0495662_0260132 | 3300046476 | Bacteria | 854 |
| 93 | Ga0495596_0242862 | 3300046500 | Unclassified | 699 |
| 94 | Ga0495608_0000042 | 3300046511 | Bacteria | 115906 |
| 95 | Ga0495608_0001786 | 3300046511 | Bacteria | 15369 |
| 96 | Ga0495628_0019192 | 3300046516 | Bacteria | 5654 |
| 97 | Ga0495630_0076058 | 3300046517 | Bacteria | 2529 |
| 98 | Ga0495630_1053095 | 3300046517 | Bacteria | 617 |
| 99 | Ga0495632_0089886 | 3300046519 | Bacteria | 1457 |
| 100 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 101 | Ga0495640_0319732 | 3300046533 | Bacteria | 961 |
| 102 | Ga0495586_0004732 | 3300046535 | Bacteria | 7275 |
| 103 | Ga0495587_0007543 | 3300046536 | Bacteria | 7045 |
| 104 | Ga0495587_0008801 | 3300046536 | Bacteria | 6478 |
| 105 | Ga0495587_0171582 | 3300046536 | Bacteria | 1232 |
| 106 | Ga0495587_0177567 | 3300046536 | Bacteria | 1208 |
| 107 | Ga0495587_0720653 | 3300046536 | Unclassified | 546 |
| 108 | Ga0495645_0000147 | 3300046543 | Bacteria | 48283 |
| 109 | Ga0495645_0002818 | 3300046543 | Bacteria | 11795 |
| 110 | Ga0495645_0301197 | 3300046543 | Unclassified | 1047 |
| 111 | Ga0495634_0002077 | 3300046642 | Bacteria | 16918 |
| 112 | Ga0495634_0005931 | 3300046642 | Bacteria | 9332 |
| 113 | Ga0495635_0000037 | 3300046663 | Bacteria | 91677 |
| 114 | Ga0495635_0265043 | 3300046663 | Bacteria | 1156 |
| 115 | Ga0495588_0113861 | 3300046674 | Bacteria | 1425 |
| 116 | Ga0495657_0000040 | 3300046675 | Bacteria | 115899 |
| 117 | Ga0495657_0002398 | 3300046675 | Bacteria | 15780 |
| 118 | Ga0495599_0107639 | 3300046678 | Bacteria | 1737 |
| 119 | Ga0495623_0514435 | 3300046679 | Bacteria | 630 |
| 120 | Ga0495658_0000803 | 3300046683 | Bacteria | 16854 |
| 121 | Ga0495624_0036964 | 3300046690 | Unclassified | 3144 |
| 122 | Ga0495600_0201014 | 3300046809 | Unclassified | 1280 |
| 123 | Ga0495604_0002850 | 3300047317 | Bacteria | 13880 |
| 124 | Ga0495674_0000020 | 3300047319 | Bacteria | 178465 |
| 125 | Ga0495676_0000612 | 3300047321 | Bacteria | 29546 |
| 126 | Ga0495676_0162105 | 3300047321 | Unclassified | 1581 |
| 127 | Ga0495680_0119669 | 3300047322 | Bacteria | 1945 |
| 128 | Ga0495680_0140209 | 3300047322 | Unclassified | 1769 |
| 129 | Ga0495675_0000036 | 3300047444 | Bacteria | 91842 |
| 130 | Ga0495675_0298735 | 3300047444 | Bacteria | 957 |
| 131 | Ga0495602_0000032 | 3300048088 | Bacteria | 141185 |
| 132 | Ga0496102_0227510 | 3300048905 | Bacteria | 1759 |
| 133 | Ga0496103_0132957 | 3300048906 | Bacteria | 1589 |
| 134 | Ga0496104_0000063 | 3300048907 | Bacteria | 116618 |
| 135 | Ga0496104_0036673 | 3300048907 | Bacteria | 4584 |
| 136 | Ga0496105_0000041 | 3300048908 | Bacteria | 116618 |
| 137 | Ga0496108_0000137 | 3300048911 | Bacteria | 70783 |
| 138 | Ga0496108_0000213 | 3300048911 | Bacteria | 52787 |
| 139 | Ga0496108_0313160 | 3300048911 | Bacteria | 1368 |
| 140 | Ga0496109_0000021 | 3300048912 | Bacteria | 189945 |
| 141 | Ga0496109_0000088 | 3300048912 | Bacteria | 94877 |
| 142 | Ga0496109_0434499 | 3300048912 | Bacteria | 1240 |
| 143 | Ga0496110_0000018 | 3300048913 | Bacteria | 79734 |
| 144 | Ga0496110_0030771 | 3300048913 | Bacteria | 4629 |
| 145 | Ga0496110_0036226 | 3300048913 | Bacteria | 4284 |
| 146 | Ga0496110_1284219 | 3300048913 | Unclassified | 641 |
| 147 | Ga0496111_0000015 | 3300048914 | Bacteria | 77334 |
| 148 | Ga0496111_0113007 | 3300048914 | Bacteria | 2001 |
| 149 | Ga0496111_0667142 | 3300048914 | Bacteria | 758 |
| 150 | Ga0496112_0000091 | 3300048915 | Bacteria | 59685 |
| 151 | Ga0496112_0364274 | 3300048915 | Bacteria | 1387 |
| 152 | Ga0496113_0003129 | 3300048916 | Bacteria | 9847 |
| 153 | Ga0496113_0508525 | 3300048916 | Unclassified | 967 |
| 154 | Ga0496116_0000740 | 3300048919 | Bacteria | 41619 |
| 155 | Ga0496117_0066754 | 3300048920 | Bacteria | 2438 |
| 156 | Ga0496117_0157202 | 3300048920 | Bacteria | 1337 |
| 157 | Ga0496118_0053564 | 3300048921 | Bacteria | 3065 |
| 158 | Ga0496118_0059680 | 3300048921 | Bacteria | 2838 |
| 159 | Ga0496119_0012644 | 3300048922 | Bacteria | 6830 |
| 160 | Ga0496119_0077892 | 3300048922 | Bacteria | 1919 |
| 161 | Ga0496119_0427750 | 3300048922 | Unclassified | 627 |
| 162 | Ga0496120_0001839 | 3300048923 | Bacteria | 23640 |
| 163 | Ga0496120_0029595 | 3300048923 | Bacteria | 3342 |
| 164 | Ga0496125_0082244 | 3300048928 | Bacteria | 2456 |
| 165 | Ga0501031_0004703 | 3300049568 | Bacteria | 8856 |
| 166 | Ga0501032_0005875 | 3300049569 | Bacteria | 9075 |
| 167 | Ga0501033_0003242 | 3300049570 | Bacteria | 13462 |
| 168 | Ga0501034_0003841 | 3300049571 | Bacteria | 16930 |
| 169 | Ga0501036_0007184 | 3300049572 | Bacteria | 9073 |
| 170 | Ga0501037_0005720 | 3300049573 | Bacteria | 9073 |
| 171 | Ga0501038_0009391 | 3300049574 | Bacteria | 8974 |
| 172 | Ga0501039_0006610 | 3300049575 | Bacteria | 8805 |
| 173 | Ga0501039_0202493 | 3300049575 | Bacteria | 1561 |
| 174 | Ga0501042_0017834 | 3300049578 | Bacteria | 4904 |
| 175 | Ga0501043_0007214 | 3300049579 | Bacteria | 8831 |
| 176 | Ga0501046_0001763 | 3300049580 | Bacteria | 20682 |
| 177 | Ga0501047_0000125 | 3300049581 | Bacteria | 94038 |
| 178 | Ga0501047_0108343 | 3300049581 | Bacteria | 2660 |
| 179 | Ga0501048_0006563 | 3300049582 | Bacteria | 8844 |
| 180 | Ga0501067_0121229 | 3300049583 | Bacteria | 1455 |
| 181 | Ga0501068_0041055 | 3300049584 | Bacteria | 2779 |
| 182 | Ga0501068_0658460 | 3300049584 | Bacteria | 684 |
| 183 | Ga0501069_0349186 | 3300049585 | Unclassified | 872 |
| 184 | Ga0501070_0000037 | 3300049586 | Bacteria | 122149 |
| 185 | Ga0501070_0003954 | 3300049586 | Bacteria | 12756 |
| 186 | Ga0501072_0098501 | 3300049588 | Bacteria | 2324 |
| 187 | Ga0501072_0218502 | 3300049588 | Bacteria | 1519 |
| 188 | Ga0501073_0006212 | 3300049589 | Bacteria | 8913 |
| 189 | Ga0501074_0006071 | 3300049590 | Bacteria | 8722 |
| 190 | Ga0501075_0177221 | 3300049591 | Bacteria | 1627 |
| 191 | Ga0501076_0544102 | 3300049592 | Bacteria | 957 |
| 192 | Ga0501079_0012251 | 3300049741 | Bacteria | 6544 |
| 193 | Ga0501080_0009123 | 3300049742 | Bacteria | 9030 |
| 194 | Ga0501081_0199974 | 3300049743 | Bacteria | 1449 |
| 195 | Ga0501081_0282525 | 3300049743 | Bacteria | 1215 |
| 196 | Ga0501083_0005623 | 3300049744 | Bacteria | 8874 |
| 197 | Ga0501083_0044315 | 3300049744 | Bacteria | 3011 |
| 198 | Ga0501035_0000966 | 3300049822 | Bacteria | 30375 |
| 199 | Ga0501044_0013220 | 3300049823 | Bacteria | 8938 |
| 200 | Ga0501044_0038198 | 3300049823 | Bacteria | 5015 |
| 201 | Ga0501044_1565220 | 3300049823 | Unclassified | 524 |
| 202 | Ga0501045_0040428 | 3300049824 | Bacteria | 3394 |
| 203 | Ga0501045_0355649 | 3300049824 | Bacteria | 1090 |
| 204 | nmdc:mga0rr50_1126508_c1 | 3300050513 | Bacteria | 667 |
| 205 | nmdc:mga08x19_442781_c1 | 3300050514 | Bacteria | 914 |
| 206 | Ga0495655_0000828 | 3300053083 | Bacteria | 4841 |
| 207 | Ga0495595_0000009 | 3300053084 | Bacteria | 193039 |
| 208 | Ga0495595_0000164 | 3300053084 | Bacteria | 26247 |
| 209 | Ga0495595_0061321 | 3300053084 | Bacteria | 1761 |
| 210 | Ga0495619_0000057 | 3300053085 | Bacteria | 93948 |
| 211 | Ga0495619_0000075 | 3300053085 | Bacteria | 76341 |
| 212 | Ga0500566_0110494 | 3300053094 | Bacteria | 1495 |
| 213 | Ga0500641_0008397 | 3300053096 | Bacteria | 3683 |
| 214 | Ga0500614_003228 | 3300053123 | Bacteria | 3530 |
| 215 | Ga0500614_263779 | 3300053123 | Bacteria | 538 |
| 216 | Ga0501084_0453043 | 3300054114 | Bacteria | 1085 |
| 217 | Ga0501084_0689097 | 3300054114 | Bacteria | 862 |
| 218 | Ga0501084_1840003 | 3300054114 | Unclassified | 505 |
| 219 | Ga0501082_0025653 | 3300060353 | Bacteria | 5078 |
| 220 | Ga0501082_0231297 | 3300060353 | Bacteria | 1609 |
| 221 | Ga0530510_0101367 | 3300061734 | Bacteria | 2105 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048914 | Ga0496111_0667142 | Ga0496111_0667142_98_439 | 113 |
| 2 | 3300048915 | Ga0496112_0000091 | Ga0496112_0000091_6790_7173 | 117 |
| 3 | 3300046679 | Ga0495623_0514435 | Ga0495623_0514435_168_551 | 121 |
| 4 | 3300049581 | Ga0501047_0108343 | Ga0501047_0108343_366_746 | 126 |
| 5 | 3300054114 | Ga0501084_0689097 | Ga0501084_0689097_38_418 | 126 |
| 6 | 3300001977 | JGI24746J21847_1000305 | JGI24746J21847_10003052 | 127 |
| 7 | 3300005329 | Ga0070683_100464625 | Ga0070683_1004646251 | 127 |
| 8 | 3300005329 | Ga0070683_100749069 | Ga0070683_1007490692 | 127 |
| 9 | 3300005354 | Ga0070675_100000043 | Ga0070675_10000004318 | 127 |
| 10 | 3300005366 | Ga0070659_100013777 | Ga0070659_1000137773 | 127 |
| 11 | 3300005435 | Ga0070714_100000104 | Ga0070714_10000010457 | 127 |
| 12 | 3300005435 | Ga0070714_100184357 | Ga0070714_1001843571 | 127 |
| 13 | 3300005435 | Ga0070714_100222833 | Ga0070714_1002228332 | 127 |
| 14 | 3300005436 | Ga0070713_100023361 | Ga0070713_1000233611 | 127 |
| 15 | 3300005437 | Ga0070710_10000001 | Ga0070710_10000001554 | 127 |
| 16 | 3300005439 | Ga0070711_100002198 | Ga0070711_1000021985 | 127 |
| 17 | 3300005440 | Ga0070705_100004877 | Ga0070705_1000048777 | 127 |
| 18 | 3300005457 | Ga0070662_100000009 | Ga0070662_10000000911 | 127 |
| 19 | 3300005466 | Ga0070685_10000060 | Ga0070685_1000006028 | 127 |
| 20 | 3300005535 | Ga0070684_100043402 | Ga0070684_1000434026 | 127 |
| 21 | 3300005548 | Ga0070665_101115186 | Ga0070665_1011151862 | 127 |
| 22 | 3300005563 | Ga0068855_100063824 | Ga0068855_1000638246 | 127 |
| 23 | 3300005564 | Ga0070664_100384665 | Ga0070664_1003846652 | 127 |
| 24 | 3300005578 | Ga0068854_100000249 | Ga0068854_10000024921 | 127 |
| 25 | 3300005614 | Ga0068856_101291405 | Ga0068856_1012914052 | 127 |
| 26 | 3300005719 | Ga0068861_100167292 | Ga0068861_1001672922 | 127 |
| 27 | 3300005834 | Ga0068851_10001089 | Ga0068851_1000108914 | 127 |
| 28 | 3300006175 | Ga0070712_100000291 | Ga0070712_10000029129 | 127 |
| 29 | 3300006914 | Ga0075436_100473220 | Ga0075436_1004732202 | 127 |
| 30 | 3300009093 | Ga0105240_10100173 | Ga0105240_101001732 | 127 |
| 31 | 3300009093 | Ga0105240_10176924 | Ga0105240_101769243 | 127 |
| 32 | 3300009093 | Ga0105240_11150895 | Ga0105240_111508952 | 127 |
| 33 | 3300009098 | Ga0105245_10000553 | Ga0105245_100005538 | 127 |
| 34 | 3300009147 | Ga0114129_12611165 | Ga0114129_126111651 | 127 |
| 35 | 3300009148 | Ga0105243_10635690 | Ga0105243_106356902 | 127 |
| 36 | 3300009174 | Ga0105241_10073517 | Ga0105241_100735173 | 127 |
| 37 | 3300009545 | Ga0105237_10591714 | Ga0105237_105917142 | 127 |
| 38 | 3300010375 | Ga0105239_10038373 | Ga0105239_100383735 | 127 |
| 39 | 3300011119 | Ga0105246_10037438 | Ga0105246_100374384 | 127 |
| 40 | 3300013104 | Ga0157370_10090654 | Ga0157370_100906544 | 127 |
| 41 | 3300013308 | Ga0157375_12116959 | Ga0157375_121169592 | 127 |
| 42 | 3300014745 | Ga0157377_10595611 | Ga0157377_105956112 | 127 |
| 43 | 3300017792 | Ga0163161_10000018 | Ga0163161_100000185 | 127 |
| 44 | 3300020610 | Ga0154015_1558649 | Ga0154015_15586493 | 127 |
| 45 | 3300025321 | Ga0207656_10034140 | Ga0207656_100341402 | 127 |
| 46 | 3300025898 | Ga0207692_10000007 | Ga0207692_10000007224 | 127 |
| 47 | 3300025911 | Ga0207654_10123945 | Ga0207654_101239452 | 127 |
| 48 | 3300025913 | Ga0207695_10070694 | Ga0207695_100706945 | 127 |
| 49 | 3300025913 | Ga0207695_10165520 | Ga0207695_101655202 | 127 |
| 50 | 3300025915 | Ga0207693_10000648 | Ga0207693_1000064826 | 127 |
| 51 | 3300025915 | Ga0207693_10015100 | Ga0207693_100151001 | 127 |
| 52 | 3300025916 | Ga0207663_10001040 | Ga0207663_1000104016 | 127 |
| 53 | 3300025919 | Ga0207657_11190372 | Ga0207657_111903722 | 127 |
| 54 | 3300025926 | Ga0207659_10000276 | Ga0207659_1000027619 | 127 |
| 55 | 3300025927 | Ga0207687_10000245 | Ga0207687_100002457 | 127 |
| 56 | 3300025928 | Ga0207700_11035237 | Ga0207700_110352371 | 127 |
| 57 | 3300025929 | Ga0207664_10000004 | Ga0207664_10000004286 | 127 |
| 58 | 3300025929 | Ga0207664_10021940 | Ga0207664_100219403 | 127 |
| 59 | 3300025929 | Ga0207664_10032028 | Ga0207664_100320284 | 127 |
| 60 | 3300025932 | Ga0207690_10003161 | Ga0207690_100031619 | 127 |
| 61 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001142 | 127 |
| 62 | 3300025935 | Ga0207709_11442684 | Ga0207709_114426841 | 127 |
| 63 | 3300025944 | Ga0207661_10000312 | Ga0207661_1000031212 | 127 |
| 64 | 3300025944 | Ga0207661_10378121 | Ga0207661_103781212 | 127 |
| 65 | 3300025944 | Ga0207661_10476948 | Ga0207661_104769481 | 127 |
| 66 | 3300025945 | Ga0207679_10209122 | Ga0207679_102091222 | 127 |
| 67 | 3300025949 | Ga0207667_10229804 | Ga0207667_102298043 | 127 |
| 68 | 3300025981 | Ga0207640_10000114 | Ga0207640_1000011441 | 127 |
| 69 | 3300026023 | Ga0207677_10000374 | Ga0207677_100003749 | 127 |
| 70 | 3300026067 | Ga0207678_10235537 | Ga0207678_102355373 | 127 |
| 71 | 3300026078 | Ga0207702_10004972 | Ga0207702_1000497211 | 127 |
| 72 | 3300026078 | Ga0207702_10712269 | Ga0207702_107122692 | 127 |
| 73 | 3300026089 | Ga0207648_10002000 | Ga0207648_1000200023 | 127 |
| 74 | 3300028379 | Ga0268266_10318992 | Ga0268266_103189923 | 127 |
| 75 | 3300028558 | Ga0265326_10000093 | Ga0265326_1000009315 | 127 |
| 76 | 3300028563 | Ga0265319_1001386 | Ga0265319_100138616 | 127 |
| 77 | 3300028573 | Ga0265334_10000035 | Ga0265334_1000003533 | 127 |
| 78 | 3300028666 | Ga0265336_10002500 | Ga0265336_100025007 | 127 |
| 79 | 3300028800 | Ga0265338_10004183 | Ga0265338_1000418316 | 127 |
| 80 | 3300028800 | Ga0265338_10192430 | Ga0265338_101924302 | 127 |
| 81 | 3300029957 | Ga0265324_10001841 | Ga0265324_100018416 | 127 |
| 82 | 3300035120 | Ga0373957_0180462 | Ga0373957_0180462_164_547 | 127 |
| 83 | 3300036401 | Ga0373937_0437094 | Ga0373937_0437094_466_849 | 127 |
| 84 | 3300036401 | Ga0373937_0812216 | Ga0373937_0812216_397_780 | 127 |
| 85 | 3300041486 | Ga0451807_1394619 | Ga0451807_1394619_402_785 | 127 |
| 86 | 3300044694 | Ga0466963_0901078 | Ga0466963_0901078_222_605 | 127 |
| 87 | 3300044706 | Ga0466964_0824270 | Ga0466964_0824270_90_473 | 127 |
| 88 | 3300045976 | Ga0466967_0110143 | Ga0466967_0110143_877_1260 | 127 |
| 89 | 3300046453 | Ga0495627_200652 | Ga0495627_200652_42_425 | 127 |
| 90 | 3300046454 | Ga0495592_0367688 | Ga0495592_0367688_515_898 | 127 |
| 91 | 3300046454 | Ga0495592_0496846 | Ga0495592_0496846_294_677 | 127 |
| 92 | 3300046455 | Ga0495603_0001631 | Ga0495603_0001631_5591_5974 | 127 |
| 93 | 3300046460 | Ga0495638_0016906 | Ga0495638_0016906_4012_4395 | 127 |
| 94 | 3300046461 | Ga0495641_0071503 | Ga0495641_0071503_498_881 | 127 |
| 95 | 3300046463 | Ga0495653_0031193 | Ga0495653_0031193_1893_2276 | 127 |
| 96 | 3300046476 | Ga0495662_0009480 | Ga0495662_0009480_2110_2493 | 127 |
| 97 | 3300046476 | Ga0495662_0260132 | Ga0495662_0260132_265_648 | 127 |
| 98 | 3300046500 | Ga0495596_0242862 | Ga0495596_0242862_238_621 | 127 |
| 99 | 3300046511 | Ga0495608_0000042 | Ga0495608_0000042_86352_86735 | 127 |
| 100 | 3300046511 | Ga0495608_0001786 | Ga0495608_0001786_9654_10037 | 127 |
| 101 | 3300046516 | Ga0495628_0019192 | Ga0495628_0019192_3835_4218 | 127 |
| 102 | 3300046517 | Ga0495630_0076058 | Ga0495630_0076058_194_577 | 127 |
| 103 | 3300046517 | Ga0495630_1053095 | Ga0495630_1053095_129_512 | 127 |
| 104 | 3300046519 | Ga0495632_0089886 | Ga0495632_0089886_254_637 | 127 |
| 105 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_129714_130097 | 127 |
| 106 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_529896_530279 | 127 |
| 107 | 3300046533 | Ga0495640_0319732 | Ga0495640_0319732_108_491 | 127 |
| 108 | 3300046535 | Ga0495586_0004732 | Ga0495586_0004732_2958_3341 | 127 |
| 109 | 3300046536 | Ga0495587_0007543 | Ga0495587_0007543_4205_4588 | 127 |
| 110 | 3300046536 | Ga0495587_0008801 | Ga0495587_0008801_2148_2531 | 127 |
| 111 | 3300046536 | Ga0495587_0171582 | Ga0495587_0171582_828_1211 | 127 |
| 112 | 3300046536 | Ga0495587_0177567 | Ga0495587_0177567_51_434 | 127 |
| 113 | 3300046536 | Ga0495587_0720653 | Ga0495587_0720653_146_529 | 127 |
| 114 | 3300046543 | Ga0495645_0000147 | Ga0495645_0000147_31220_31603 | 127 |
| 115 | 3300046543 | Ga0495645_0002818 | Ga0495645_0002818_290_673 | 127 |
| 116 | 3300046543 | Ga0495645_0301197 | Ga0495645_0301197_330_713 | 127 |
| 117 | 3300046642 | Ga0495634_0002077 | Ga0495634_0002077_10127_10510 | 127 |
| 118 | 3300046642 | Ga0495634_0005931 | Ga0495634_0005931_1149_1532 | 127 |
| 119 | 3300046663 | Ga0495635_0000037 | Ga0495635_0000037_17954_18337 | 127 |
| 120 | 3300046663 | Ga0495635_0265043 | Ga0495635_0265043_464_847 | 127 |
| 121 | 3300046674 | Ga0495588_0113861 | Ga0495588_0113861_631_1014 | 127 |
| 122 | 3300046675 | Ga0495657_0000040 | Ga0495657_0000040_86352_86735 | 127 |
| 123 | 3300046675 | Ga0495657_0002398 | Ga0495657_0002398_6630_7013 | 127 |
| 124 | 3300046678 | Ga0495599_0107639 | Ga0495599_0107639_1156_1539 | 127 |
| 125 | 3300046683 | Ga0495658_0000803 | Ga0495658_0000803_2730_3113 | 127 |
| 126 | 3300046690 | Ga0495624_0036964 | Ga0495624_0036964_87_470 | 127 |
| 127 | 3300046809 | Ga0495600_0201014 | Ga0495600_0201014_493_876 | 127 |
| 128 | 3300047317 | Ga0495604_0002850 | Ga0495604_0002850_1728_2111 | 127 |
| 129 | 3300047319 | Ga0495674_0000020 | Ga0495674_0000020_110041_110424 | 127 |
| 130 | 3300047321 | Ga0495676_0000612 | Ga0495676_0000612_5738_6121 | 127 |
| 131 | 3300047321 | Ga0495676_0162105 | Ga0495676_0162105_878_1261 | 127 |
| 132 | 3300047322 | Ga0495680_0119669 | Ga0495680_0119669_73_456 | 127 |
| 133 | 3300047322 | Ga0495680_0140209 | Ga0495680_0140209_825_1208 | 127 |
| 134 | 3300047444 | Ga0495675_0000036 | Ga0495675_0000036_5938_6321 | 127 |
| 135 | 3300047444 | Ga0495675_0298735 | Ga0495675_0298735_12_395 | 127 |
| 136 | 3300048088 | Ga0495602_0000032 | Ga0495602_0000032_80584_80967 | 127 |
| 137 | 3300048905 | Ga0496102_0227510 | Ga0496102_0227510_1340_1723 | 127 |
| 138 | 3300048906 | Ga0496103_0132957 | Ga0496103_0132957_119_502 | 127 |
| 139 | 3300048907 | Ga0496104_0000063 | Ga0496104_0000063_33595_33978 | 127 |
| 140 | 3300048907 | Ga0496104_0036673 | Ga0496104_0036673_1937_2320 | 127 |
| 141 | 3300048908 | Ga0496105_0000041 | Ga0496105_0000041_82641_83024 | 127 |
| 142 | 3300048911 | Ga0496108_0000137 | Ga0496108_0000137_29578_29961 | 127 |
| 143 | 3300048911 | Ga0496108_0000213 | Ga0496108_0000213_1172_1555 | 127 |
| 144 | 3300048911 | Ga0496108_0313160 | Ga0496108_0313160_699_1082 | 127 |
| 145 | 3300048912 | Ga0496109_0000021 | Ga0496109_0000021_16707_17090 | 127 |
| 146 | 3300048912 | Ga0496109_0000088 | Ga0496109_0000088_28379_28762 | 127 |
| 147 | 3300048912 | Ga0496109_0434499 | Ga0496109_0434499_813_1196 | 127 |
| 148 | 3300048913 | Ga0496110_0000018 | Ga0496110_0000018_30370_30753 | 127 |
| 149 | 3300048913 | Ga0496110_0030771 | Ga0496110_0030771_1283_1666 | 127 |
| 150 | 3300048913 | Ga0496110_0036226 | Ga0496110_0036226_2886_3269 | 127 |
| 151 | 3300048913 | Ga0496110_1284219 | Ga0496110_1284219_104_487 | 127 |
| 152 | 3300048914 | Ga0496111_0000015 | Ga0496111_0000015_48966_49349 | 127 |
| 153 | 3300048914 | Ga0496111_0113007 | Ga0496111_0113007_817_1200 | 127 |
| 154 | 3300048915 | Ga0496112_0364274 | Ga0496112_0364274_321_704 | 127 |
| 155 | 3300048916 | Ga0496113_0003129 | Ga0496113_0003129_4561_4944 | 127 |
| 156 | 3300048916 | Ga0496113_0508525 | Ga0496113_0508525_551_934 | 127 |
| 157 | 3300048919 | Ga0496116_0000740 | Ga0496116_0000740_40054_40437 | 127 |
| 158 | 3300048920 | Ga0496117_0066754 | Ga0496117_0066754_1083_1466 | 127 |
| 159 | 3300048920 | Ga0496117_0157202 | Ga0496117_0157202_775_1158 | 127 |
| 160 | 3300048921 | Ga0496118_0053564 | Ga0496118_0053564_1522_1905 | 127 |
| 161 | 3300048921 | Ga0496118_0059680 | Ga0496118_0059680_1312_1695 | 127 |
| 162 | 3300048922 | Ga0496119_0012644 | Ga0496119_0012644_962_1345 | 127 |
| 163 | 3300048922 | Ga0496119_0077892 | Ga0496119_0077892_659_1042 | 127 |
| 164 | 3300048922 | Ga0496119_0427750 | Ga0496119_0427750_140_523 | 127 |
| 165 | 3300048923 | Ga0496120_0001839 | Ga0496120_0001839_22485_22868 | 127 |
| 166 | 3300048923 | Ga0496120_0029595 | Ga0496120_0029595_157_540 | 127 |
| 167 | 3300048928 | Ga0496125_0082244 | Ga0496125_0082244_168_551 | 127 |
| 168 | 3300049568 | Ga0501031_0004703 | Ga0501031_0004703_2356_2739 | 127 |
| 169 | 3300049569 | Ga0501032_0005875 | Ga0501032_0005875_6199_6582 | 127 |
| 170 | 3300049570 | Ga0501033_0003242 | Ga0501033_0003242_10664_11047 | 127 |
| 171 | 3300049571 | Ga0501034_0003841 | Ga0501034_0003841_2435_2818 | 127 |
| 172 | 3300049572 | Ga0501036_0007184 | Ga0501036_0007184_6145_6528 | 127 |
| 173 | 3300049573 | Ga0501037_0005720 | Ga0501037_0005720_2405_2788 | 127 |
| 174 | 3300049574 | Ga0501038_0009391 | Ga0501038_0009391_2471_2854 | 127 |
| 175 | 3300049575 | Ga0501039_0006610 | Ga0501039_0006610_2410_2793 | 127 |
| 176 | 3300049575 | Ga0501039_0202493 | Ga0501039_0202493_1027_1410 | 127 |
| 177 | 3300049578 | Ga0501042_0017834 | Ga0501042_0017834_2051_2434 | 127 |
| 178 | 3300049579 | Ga0501043_0007214 | Ga0501043_0007214_5952_6335 | 127 |
| 179 | 3300049580 | Ga0501046_0001763 | Ga0501046_0001763_13998_14381 | 127 |
| 180 | 3300049581 | Ga0501047_0000125 | Ga0501047_0000125_10536_10919 | 127 |
| 181 | 3300049582 | Ga0501048_0006563 | Ga0501048_0006563_6108_6491 | 127 |
| 182 | 3300049583 | Ga0501067_0121229 | Ga0501067_0121229_1042_1425 | 127 |
| 183 | 3300049584 | Ga0501068_0041055 | Ga0501068_0041055_720_1103 | 127 |
| 184 | 3300049584 | Ga0501068_0658460 | Ga0501068_0658460_116_499 | 127 |
| 185 | 3300049585 | Ga0501069_0349186 | Ga0501069_0349186_163_546 | 127 |
| 186 | 3300049586 | Ga0501070_0000037 | Ga0501070_0000037_107509_107892 | 127 |
| 187 | 3300049586 | Ga0501070_0003954 | Ga0501070_0003954_5824_6207 | 127 |
| 188 | 3300049588 | Ga0501072_0098501 | Ga0501072_0098501_570_953 | 127 |
| 189 | 3300049588 | Ga0501072_0218502 | Ga0501072_0218502_70_453 | 127 |
| 190 | 3300049589 | Ga0501073_0006212 | Ga0501073_0006212_2368_2751 | 127 |
| 191 | 3300049590 | Ga0501074_0006071 | Ga0501074_0006071_2437_2820 | 127 |
| 192 | 3300049591 | Ga0501075_0177221 | Ga0501075_0177221_1017_1400 | 127 |
| 193 | 3300049592 | Ga0501076_0544102 | Ga0501076_0544102_129_512 | 127 |
| 194 | 3300049741 | Ga0501079_0012251 | Ga0501079_0012251_3823_4206 | 127 |
| 195 | 3300049742 | Ga0501080_0009123 | Ga0501080_0009123_2458_2841 | 127 |
| 196 | 3300049743 | Ga0501081_0199974 | Ga0501081_0199974_756_1139 | 127 |
| 197 | 3300049743 | Ga0501081_0282525 | Ga0501081_0282525_737_1120 | 127 |
| 198 | 3300049744 | Ga0501083_0005623 | Ga0501083_0005623_6001_6384 | 127 |
| 199 | 3300049744 | Ga0501083_0044315 | Ga0501083_0044315_1346_1729 | 127 |
| 200 | 3300049822 | Ga0501035_0000966 | Ga0501035_0000966_27573_27956 | 127 |
| 201 | 3300049823 | Ga0501044_0013220 | Ga0501044_0013220_2435_2818 | 127 |
| 202 | 3300049823 | Ga0501044_0038198 | Ga0501044_0038198_134_517 | 127 |
| 203 | 3300049823 | Ga0501044_1565220 | Ga0501044_1565220_93_476 | 127 |
| 204 | 3300049824 | Ga0501045_0040428 | Ga0501045_0040428_1039_1422 | 127 |
| 205 | 3300049824 | Ga0501045_0355649 | Ga0501045_0355649_274_657 | 127 |
| 206 | 3300050513 | nmdc:mga0rr50_1126508_c1 | nmdc:mga0rr50_1126508_c1_204_587 | 127 |
| 207 | 3300050514 | nmdc:mga08x19_442781_c1 | nmdc:mga08x19_442781_c1_240_623 | 127 |
| 208 | 3300053083 | Ga0495655_0000828 | Ga0495655_0000828_1229_1612 | 127 |
| 209 | 3300053084 | Ga0495595_0000009 | Ga0495595_0000009_106305_106688 | 127 |
| 210 | 3300053084 | Ga0495595_0000164 | Ga0495595_0000164_18128_18511 | 127 |
| 211 | 3300053084 | Ga0495595_0061321 | Ga0495595_0061321_244_627 | 127 |
| 212 | 3300053085 | Ga0495619_0000057 | Ga0495619_0000057_29164_29547 | 127 |
| 213 | 3300053085 | Ga0495619_0000075 | Ga0495619_0000075_45050_45433 | 127 |
| 214 | 3300053094 | Ga0500566_0110494 | Ga0500566_0110494_644_1027 | 127 |
| 215 | 3300053096 | Ga0500641_0008397 | Ga0500641_0008397_1907_2290 | 127 |
| 216 | 3300053123 | Ga0500614_003228 | Ga0500614_003228_2707_3090 | 127 |
| 217 | 3300053123 | Ga0500614_263779 | Ga0500614_263779_89_472 | 127 |
| 218 | 3300054114 | Ga0501084_0453043 | Ga0501084_0453043_426_809 | 127 |
| 219 | 3300054114 | Ga0501084_1840003 | Ga0501084_1840003_89_472 | 127 |
| 220 | 3300060353 | Ga0501082_0025653 | Ga0501082_0025653_2304_2687 | 127 |
| 221 | 3300060353 | Ga0501082_0231297 | Ga0501082_0231297_189_572 | 127 |
| 222 | 3300061734 | Ga0530510_0101367 | Ga0530510_0101367_1216_1599 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dbo-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8779 | 1 | 127 |
| 3dbo-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8712 | 1 | 127 |
| 5ecw-assembly1.cif.gz_B | structure of the shigella flexneri vapc mutant d7a | 0.8518 | 1 | 126 |
| 5f22-assembly1.cif.gz_A | c-terminal domain of sars-cov nsp8 complex with nsp7 | 0.8461 | 35 | 63 |
| 5ecw-assembly1.cif.gz_B | structure of the shigella flexneri vapc mutant d7a | 0.8335 | 1 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFB1_8_111_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9468 | 4 | 101 | 3.40.50.1010 |
| af_O07783_4_130_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9049 | 3 | 127 | 3.40.50.1010 |
| af_P9WFB1_8_111_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8858 | 4 | 101 | 3.40.50.1010 |
| 3dboB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8779 | 1 | 127 | 3.40.50.1010 |
| 3dboB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8712 | 1 | 127 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536GV99-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9806 | 6 | 127 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A1M3BGX0-F1-model_v4 | PIN domain-containing protein | 0.9749 | 23 | 127 |
GO:0004518
GO:0046872 |
| AF-A0A536EDP0-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9677 | 3 | 127 |
GO:0000287
GO:0004540 GO:0090729 |
| AF-A0A1M3BGX0-F1-model_v4 | PIN domain-containing protein | 0.9658 | 23 | 127 |
GO:0004518
GO:0046872 |
| AF-A0A536GV99-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9574 | 6 | 127 |
GO:0000287
GO:0004540 GO:0090729 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar