F334839

General Info

Members Datasets Scaffolds Average Seq Length
222 157 221 127

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0514435|Ga0495623_0514435_168_551
Length 121
Sequence LSKAVADTSIFIAQETGRELGVLPEKIAVSVITIAELELGVLRATDPDARARRLSTLSRVQSIYPLLPIGPEVASCFARIAAAERSRHDTWIAATAMKHAAVVVTQDSDFSSFDEVAVLRV

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
94 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 10.36
Rhizosphere 82.88
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000305 3300001977 Bacteria 7033
2 Ga0070683_100464625 3300005329 Bacteria 1208
3 Ga0070683_100749069 3300005329 Bacteria 936
4 Ga0070675_100000043 3300005354 Bacteria 77565
5 Ga0070659_100013777 3300005366 Bacteria 6030
6 Ga0070714_100000104 3300005435 Bacteria 70946
7 Ga0070714_100184357 3300005435 Bacteria 1901
8 Ga0070714_100222833 3300005435 Unclassified 1734
9 Ga0070713_100023361 3300005436 Bacteria 4797
10 Ga0070710_10000001 3300005437 Bacteria 552187
11 Ga0070711_100002198 3300005439 Bacteria 11075
12 Ga0070705_100004877 3300005440 Bacteria 6533
13 Ga0070662_100000009 3300005457 Bacteria 142979
14 Ga0070685_10000060 3300005466 Bacteria 63737
15 Ga0070684_100043402 3300005535 Bacteria 3882
16 Ga0070665_101115186 3300005548 Bacteria 800
17 Ga0068855_100063824 3300005563 Bacteria 4297
18 Ga0070664_100384665 3300005564 Bacteria 1281
19 Ga0068854_100000249 3300005578 Bacteria 36592
20 Ga0068856_101291405 3300005614 Bacteria 745
21 Ga0068861_100167292 3300005719 Bacteria 1819
22 Ga0068851_10001089 3300005834 Bacteria 11783
23 Ga0070712_100000291 3300006175 Bacteria 28230
24 Ga0075436_100473220 3300006914 Bacteria 914
25 Ga0105240_10100173 3300009093 Bacteria 3526
26 Ga0105240_10176924 3300009093 Bacteria 2522
27 Ga0105240_11150895 3300009093 Bacteria 823
28 Ga0105245_10000553 3300009098 Bacteria 33948
29 Ga0114129_12611165 3300009147 Unclassified 603
30 Ga0105243_10635690 3300009148 Bacteria 1032
31 Ga0105241_10073517 3300009174 Bacteria 2660
32 Ga0105237_10591714 3300009545 Bacteria 1116
33 Ga0105239_10038373 3300010375 Bacteria 5249
34 Ga0105246_10037438 3300011119 Bacteria 3256
35 Ga0157370_10090654 3300013104 Unclassified 2870
36 Ga0157375_12116959 3300013308 Unclassified 670
37 Ga0157377_10595611 3300014745 Bacteria 788
38 Ga0163161_10000018 3300017792 Bacteria 228801
39 Ga0154015_1558649 3300020610 Bacteria 1119
40 Ga0207656_10034140 3300025321 Bacteria 2122
41 Ga0207692_10000007 3300025898 Bacteria 233250
42 Ga0207654_10123945 3300025911 Bacteria 1626
43 Ga0207695_10070694 3300025913 Bacteria 3566
44 Ga0207695_10165520 3300025913 Bacteria 2140
45 Ga0207693_10000648 3300025915 Bacteria 31139
46 Ga0207693_10015100 3300025915 Bacteria 6199
47 Ga0207663_10001040 3300025916 Bacteria 12723
48 Ga0207657_11190372 3300025919 Unclassified 579
49 Ga0207659_10000276 3300025926 Bacteria 31262
50 Ga0207687_10000245 3300025927 Bacteria 36917
51 Ga0207700_11035237 3300025928 Unclassified 734
52 Ga0207664_10000004 3300025929 Bacteria 493014
53 Ga0207664_10021940 3300025929 Bacteria 4757
54 Ga0207664_10032028 3300025929 Bacteria 4027
55 Ga0207690_10003161 3300025932 Bacteria 9894
56 Ga0207706_10000001 3300025933 Bacteria 423014
57 Ga0207709_11442684 3300025935 Bacteria 570
58 Ga0207661_10000312 3300025944 Bacteria 30978
59 Ga0207661_10378121 3300025944 Bacteria 1282
60 Ga0207661_10476948 3300025944 Bacteria 1138
61 Ga0207679_10209122 3300025945 Bacteria 1635
62 Ga0207667_10229804 3300025949 Unclassified 1900
63 Ga0207640_10000114 3300025981 Bacteria 60718
64 Ga0207677_10000374 3300026023 Bacteria 31092
65 Ga0207678_10235537 3300026067 Unclassified 1568
66 Ga0207702_10004972 3300026078 Bacteria 11680
67 Ga0207702_10712269 3300026078 Unclassified 989
68 Ga0207648_10002000 3300026089 Bacteria 22250
69 Ga0268266_10318992 3300028379 Bacteria 1454
70 Ga0265326_10000093 3300028558 Bacteria 46031
71 Ga0265319_1001386 3300028563 Bacteria 14556
72 Ga0265334_10000035 3300028573 Bacteria 105691
73 Ga0265336_10002500 3300028666 Bacteria 7533
74 Ga0265338_10004183 3300028800 Bacteria 19684
75 Ga0265338_10192430 3300028800 Bacteria 1545
76 Ga0265324_10001841 3300029957 Bacteria 11494
77 Ga0373957_0180462 3300035120 Bacteria 875
78 Ga0373937_0437094 3300036401 Bacteria 1242
79 Ga0373937_0812216 3300036401 Unclassified 883
80 Ga0451807_1394619 3300041486 Bacteria 1813
81 Ga0466963_0901078 3300044694 Unclassified 623
82 Ga0466964_0824270 3300044706 Bacteria 526
83 Ga0466967_0110143 3300045976 Bacteria 2529
84 Ga0495627_200652 3300046453 Unclassified 549
85 Ga0495592_0367688 3300046454 Bacteria 918
86 Ga0495592_0496846 3300046454 Unclassified 757
87 Ga0495603_0001631 3300046455 Bacteria 13179
88 Ga0495638_0016906 3300046460 Bacteria 4877
89 Ga0495641_0071503 3300046461 Bacteria 1557
90 Ga0495653_0031193 3300046463 Bacteria 4238
91 Ga0495662_0009480 3300046476 Bacteria 4776
92 Ga0495662_0260132 3300046476 Bacteria 854
93 Ga0495596_0242862 3300046500 Unclassified 699
94 Ga0495608_0000042 3300046511 Bacteria 115906
95 Ga0495608_0001786 3300046511 Bacteria 15369
96 Ga0495628_0019192 3300046516 Bacteria 5654
97 Ga0495630_0076058 3300046517 Bacteria 2529
98 Ga0495630_1053095 3300046517 Bacteria 617
99 Ga0495632_0089886 3300046519 Bacteria 1457
100 Ga0495652_0000003 3300046529 Bacteria 597094
101 Ga0495640_0319732 3300046533 Bacteria 961
102 Ga0495586_0004732 3300046535 Bacteria 7275
103 Ga0495587_0007543 3300046536 Bacteria 7045
104 Ga0495587_0008801 3300046536 Bacteria 6478
105 Ga0495587_0171582 3300046536 Bacteria 1232
106 Ga0495587_0177567 3300046536 Bacteria 1208
107 Ga0495587_0720653 3300046536 Unclassified 546
108 Ga0495645_0000147 3300046543 Bacteria 48283
109 Ga0495645_0002818 3300046543 Bacteria 11795
110 Ga0495645_0301197 3300046543 Unclassified 1047
111 Ga0495634_0002077 3300046642 Bacteria 16918
112 Ga0495634_0005931 3300046642 Bacteria 9332
113 Ga0495635_0000037 3300046663 Bacteria 91677
114 Ga0495635_0265043 3300046663 Bacteria 1156
115 Ga0495588_0113861 3300046674 Bacteria 1425
116 Ga0495657_0000040 3300046675 Bacteria 115899
117 Ga0495657_0002398 3300046675 Bacteria 15780
118 Ga0495599_0107639 3300046678 Bacteria 1737
119 Ga0495623_0514435 3300046679 Bacteria 630
120 Ga0495658_0000803 3300046683 Bacteria 16854
121 Ga0495624_0036964 3300046690 Unclassified 3144
122 Ga0495600_0201014 3300046809 Unclassified 1280
123 Ga0495604_0002850 3300047317 Bacteria 13880
124 Ga0495674_0000020 3300047319 Bacteria 178465
125 Ga0495676_0000612 3300047321 Bacteria 29546
126 Ga0495676_0162105 3300047321 Unclassified 1581
127 Ga0495680_0119669 3300047322 Bacteria 1945
128 Ga0495680_0140209 3300047322 Unclassified 1769
129 Ga0495675_0000036 3300047444 Bacteria 91842
130 Ga0495675_0298735 3300047444 Bacteria 957
131 Ga0495602_0000032 3300048088 Bacteria 141185
132 Ga0496102_0227510 3300048905 Bacteria 1759
133 Ga0496103_0132957 3300048906 Bacteria 1589
134 Ga0496104_0000063 3300048907 Bacteria 116618
135 Ga0496104_0036673 3300048907 Bacteria 4584
136 Ga0496105_0000041 3300048908 Bacteria 116618
137 Ga0496108_0000137 3300048911 Bacteria 70783
138 Ga0496108_0000213 3300048911 Bacteria 52787
139 Ga0496108_0313160 3300048911 Bacteria 1368
140 Ga0496109_0000021 3300048912 Bacteria 189945
141 Ga0496109_0000088 3300048912 Bacteria 94877
142 Ga0496109_0434499 3300048912 Bacteria 1240
143 Ga0496110_0000018 3300048913 Bacteria 79734
144 Ga0496110_0030771 3300048913 Bacteria 4629
145 Ga0496110_0036226 3300048913 Bacteria 4284
146 Ga0496110_1284219 3300048913 Unclassified 641
147 Ga0496111_0000015 3300048914 Bacteria 77334
148 Ga0496111_0113007 3300048914 Bacteria 2001
149 Ga0496111_0667142 3300048914 Bacteria 758
150 Ga0496112_0000091 3300048915 Bacteria 59685
151 Ga0496112_0364274 3300048915 Bacteria 1387
152 Ga0496113_0003129 3300048916 Bacteria 9847
153 Ga0496113_0508525 3300048916 Unclassified 967
154 Ga0496116_0000740 3300048919 Bacteria 41619
155 Ga0496117_0066754 3300048920 Bacteria 2438
156 Ga0496117_0157202 3300048920 Bacteria 1337
157 Ga0496118_0053564 3300048921 Bacteria 3065
158 Ga0496118_0059680 3300048921 Bacteria 2838
159 Ga0496119_0012644 3300048922 Bacteria 6830
160 Ga0496119_0077892 3300048922 Bacteria 1919
161 Ga0496119_0427750 3300048922 Unclassified 627
162 Ga0496120_0001839 3300048923 Bacteria 23640
163 Ga0496120_0029595 3300048923 Bacteria 3342
164 Ga0496125_0082244 3300048928 Bacteria 2456
165 Ga0501031_0004703 3300049568 Bacteria 8856
166 Ga0501032_0005875 3300049569 Bacteria 9075
167 Ga0501033_0003242 3300049570 Bacteria 13462
168 Ga0501034_0003841 3300049571 Bacteria 16930
169 Ga0501036_0007184 3300049572 Bacteria 9073
170 Ga0501037_0005720 3300049573 Bacteria 9073
171 Ga0501038_0009391 3300049574 Bacteria 8974
172 Ga0501039_0006610 3300049575 Bacteria 8805
173 Ga0501039_0202493 3300049575 Bacteria 1561
174 Ga0501042_0017834 3300049578 Bacteria 4904
175 Ga0501043_0007214 3300049579 Bacteria 8831
176 Ga0501046_0001763 3300049580 Bacteria 20682
177 Ga0501047_0000125 3300049581 Bacteria 94038
178 Ga0501047_0108343 3300049581 Bacteria 2660
179 Ga0501048_0006563 3300049582 Bacteria 8844
180 Ga0501067_0121229 3300049583 Bacteria 1455
181 Ga0501068_0041055 3300049584 Bacteria 2779
182 Ga0501068_0658460 3300049584 Bacteria 684
183 Ga0501069_0349186 3300049585 Unclassified 872
184 Ga0501070_0000037 3300049586 Bacteria 122149
185 Ga0501070_0003954 3300049586 Bacteria 12756
186 Ga0501072_0098501 3300049588 Bacteria 2324
187 Ga0501072_0218502 3300049588 Bacteria 1519
188 Ga0501073_0006212 3300049589 Bacteria 8913
189 Ga0501074_0006071 3300049590 Bacteria 8722
190 Ga0501075_0177221 3300049591 Bacteria 1627
191 Ga0501076_0544102 3300049592 Bacteria 957
192 Ga0501079_0012251 3300049741 Bacteria 6544
193 Ga0501080_0009123 3300049742 Bacteria 9030
194 Ga0501081_0199974 3300049743 Bacteria 1449
195 Ga0501081_0282525 3300049743 Bacteria 1215
196 Ga0501083_0005623 3300049744 Bacteria 8874
197 Ga0501083_0044315 3300049744 Bacteria 3011
198 Ga0501035_0000966 3300049822 Bacteria 30375
199 Ga0501044_0013220 3300049823 Bacteria 8938
200 Ga0501044_0038198 3300049823 Bacteria 5015
201 Ga0501044_1565220 3300049823 Unclassified 524
202 Ga0501045_0040428 3300049824 Bacteria 3394
203 Ga0501045_0355649 3300049824 Bacteria 1090
204 nmdc:mga0rr50_1126508_c1 3300050513 Bacteria 667
205 nmdc:mga08x19_442781_c1 3300050514 Bacteria 914
206 Ga0495655_0000828 3300053083 Bacteria 4841
207 Ga0495595_0000009 3300053084 Bacteria 193039
208 Ga0495595_0000164 3300053084 Bacteria 26247
209 Ga0495595_0061321 3300053084 Bacteria 1761
210 Ga0495619_0000057 3300053085 Bacteria 93948
211 Ga0495619_0000075 3300053085 Bacteria 76341
212 Ga0500566_0110494 3300053094 Bacteria 1495
213 Ga0500641_0008397 3300053096 Bacteria 3683
214 Ga0500614_003228 3300053123 Bacteria 3530
215 Ga0500614_263779 3300053123 Bacteria 538
216 Ga0501084_0453043 3300054114 Bacteria 1085
217 Ga0501084_0689097 3300054114 Bacteria 862
218 Ga0501084_1840003 3300054114 Unclassified 505
219 Ga0501082_0025653 3300060353 Bacteria 5078
220 Ga0501082_0231297 3300060353 Bacteria 1609
221 Ga0530510_0101367 3300061734 Bacteria 2105

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0667142 Ga0496111_0667142_98_439 113
2 3300048915 Ga0496112_0000091 Ga0496112_0000091_6790_7173 117
3 3300046679 Ga0495623_0514435 Ga0495623_0514435_168_551 121
4 3300049581 Ga0501047_0108343 Ga0501047_0108343_366_746 126
5 3300054114 Ga0501084_0689097 Ga0501084_0689097_38_418 126
6 3300001977 JGI24746J21847_1000305 JGI24746J21847_10003052 127
7 3300005329 Ga0070683_100464625 Ga0070683_1004646251 127
8 3300005329 Ga0070683_100749069 Ga0070683_1007490692 127
9 3300005354 Ga0070675_100000043 Ga0070675_10000004318 127
10 3300005366 Ga0070659_100013777 Ga0070659_1000137773 127
11 3300005435 Ga0070714_100000104 Ga0070714_10000010457 127
12 3300005435 Ga0070714_100184357 Ga0070714_1001843571 127
13 3300005435 Ga0070714_100222833 Ga0070714_1002228332 127
14 3300005436 Ga0070713_100023361 Ga0070713_1000233611 127
15 3300005437 Ga0070710_10000001 Ga0070710_10000001554 127
16 3300005439 Ga0070711_100002198 Ga0070711_1000021985 127
17 3300005440 Ga0070705_100004877 Ga0070705_1000048777 127
18 3300005457 Ga0070662_100000009 Ga0070662_10000000911 127
19 3300005466 Ga0070685_10000060 Ga0070685_1000006028 127
20 3300005535 Ga0070684_100043402 Ga0070684_1000434026 127
21 3300005548 Ga0070665_101115186 Ga0070665_1011151862 127
22 3300005563 Ga0068855_100063824 Ga0068855_1000638246 127
23 3300005564 Ga0070664_100384665 Ga0070664_1003846652 127
24 3300005578 Ga0068854_100000249 Ga0068854_10000024921 127
25 3300005614 Ga0068856_101291405 Ga0068856_1012914052 127
26 3300005719 Ga0068861_100167292 Ga0068861_1001672922 127
27 3300005834 Ga0068851_10001089 Ga0068851_1000108914 127
28 3300006175 Ga0070712_100000291 Ga0070712_10000029129 127
29 3300006914 Ga0075436_100473220 Ga0075436_1004732202 127
30 3300009093 Ga0105240_10100173 Ga0105240_101001732 127
31 3300009093 Ga0105240_10176924 Ga0105240_101769243 127
32 3300009093 Ga0105240_11150895 Ga0105240_111508952 127
33 3300009098 Ga0105245_10000553 Ga0105245_100005538 127
34 3300009147 Ga0114129_12611165 Ga0114129_126111651 127
35 3300009148 Ga0105243_10635690 Ga0105243_106356902 127
36 3300009174 Ga0105241_10073517 Ga0105241_100735173 127
37 3300009545 Ga0105237_10591714 Ga0105237_105917142 127
38 3300010375 Ga0105239_10038373 Ga0105239_100383735 127
39 3300011119 Ga0105246_10037438 Ga0105246_100374384 127
40 3300013104 Ga0157370_10090654 Ga0157370_100906544 127
41 3300013308 Ga0157375_12116959 Ga0157375_121169592 127
42 3300014745 Ga0157377_10595611 Ga0157377_105956112 127
43 3300017792 Ga0163161_10000018 Ga0163161_100000185 127
44 3300020610 Ga0154015_1558649 Ga0154015_15586493 127
45 3300025321 Ga0207656_10034140 Ga0207656_100341402 127
46 3300025898 Ga0207692_10000007 Ga0207692_10000007224 127
47 3300025911 Ga0207654_10123945 Ga0207654_101239452 127
48 3300025913 Ga0207695_10070694 Ga0207695_100706945 127
49 3300025913 Ga0207695_10165520 Ga0207695_101655202 127
50 3300025915 Ga0207693_10000648 Ga0207693_1000064826 127
51 3300025915 Ga0207693_10015100 Ga0207693_100151001 127
52 3300025916 Ga0207663_10001040 Ga0207663_1000104016 127
53 3300025919 Ga0207657_11190372 Ga0207657_111903722 127
54 3300025926 Ga0207659_10000276 Ga0207659_1000027619 127
55 3300025927 Ga0207687_10000245 Ga0207687_100002457 127
56 3300025928 Ga0207700_11035237 Ga0207700_110352371 127
57 3300025929 Ga0207664_10000004 Ga0207664_10000004286 127
58 3300025929 Ga0207664_10021940 Ga0207664_100219403 127
59 3300025929 Ga0207664_10032028 Ga0207664_100320284 127
60 3300025932 Ga0207690_10003161 Ga0207690_100031619 127
61 3300025933 Ga0207706_10000001 Ga0207706_10000001142 127
62 3300025935 Ga0207709_11442684 Ga0207709_114426841 127
63 3300025944 Ga0207661_10000312 Ga0207661_1000031212 127
64 3300025944 Ga0207661_10378121 Ga0207661_103781212 127
65 3300025944 Ga0207661_10476948 Ga0207661_104769481 127
66 3300025945 Ga0207679_10209122 Ga0207679_102091222 127
67 3300025949 Ga0207667_10229804 Ga0207667_102298043 127
68 3300025981 Ga0207640_10000114 Ga0207640_1000011441 127
69 3300026023 Ga0207677_10000374 Ga0207677_100003749 127
70 3300026067 Ga0207678_10235537 Ga0207678_102355373 127
71 3300026078 Ga0207702_10004972 Ga0207702_1000497211 127
72 3300026078 Ga0207702_10712269 Ga0207702_107122692 127
73 3300026089 Ga0207648_10002000 Ga0207648_1000200023 127
74 3300028379 Ga0268266_10318992 Ga0268266_103189923 127
75 3300028558 Ga0265326_10000093 Ga0265326_1000009315 127
76 3300028563 Ga0265319_1001386 Ga0265319_100138616 127
77 3300028573 Ga0265334_10000035 Ga0265334_1000003533 127
78 3300028666 Ga0265336_10002500 Ga0265336_100025007 127
79 3300028800 Ga0265338_10004183 Ga0265338_1000418316 127
80 3300028800 Ga0265338_10192430 Ga0265338_101924302 127
81 3300029957 Ga0265324_10001841 Ga0265324_100018416 127
82 3300035120 Ga0373957_0180462 Ga0373957_0180462_164_547 127
83 3300036401 Ga0373937_0437094 Ga0373937_0437094_466_849 127
84 3300036401 Ga0373937_0812216 Ga0373937_0812216_397_780 127
85 3300041486 Ga0451807_1394619 Ga0451807_1394619_402_785 127
86 3300044694 Ga0466963_0901078 Ga0466963_0901078_222_605 127
87 3300044706 Ga0466964_0824270 Ga0466964_0824270_90_473 127
88 3300045976 Ga0466967_0110143 Ga0466967_0110143_877_1260 127
89 3300046453 Ga0495627_200652 Ga0495627_200652_42_425 127
90 3300046454 Ga0495592_0367688 Ga0495592_0367688_515_898 127
91 3300046454 Ga0495592_0496846 Ga0495592_0496846_294_677 127
92 3300046455 Ga0495603_0001631 Ga0495603_0001631_5591_5974 127
93 3300046460 Ga0495638_0016906 Ga0495638_0016906_4012_4395 127
94 3300046461 Ga0495641_0071503 Ga0495641_0071503_498_881 127
95 3300046463 Ga0495653_0031193 Ga0495653_0031193_1893_2276 127
96 3300046476 Ga0495662_0009480 Ga0495662_0009480_2110_2493 127
97 3300046476 Ga0495662_0260132 Ga0495662_0260132_265_648 127
98 3300046500 Ga0495596_0242862 Ga0495596_0242862_238_621 127
99 3300046511 Ga0495608_0000042 Ga0495608_0000042_86352_86735 127
100 3300046511 Ga0495608_0001786 Ga0495608_0001786_9654_10037 127
101 3300046516 Ga0495628_0019192 Ga0495628_0019192_3835_4218 127
102 3300046517 Ga0495630_0076058 Ga0495630_0076058_194_577 127
103 3300046517 Ga0495630_1053095 Ga0495630_1053095_129_512 127
104 3300046519 Ga0495632_0089886 Ga0495632_0089886_254_637 127
105 3300046529 Ga0495652_0000003 Ga0495652_0000003_129714_130097 127
106 3300046529 Ga0495652_0000003 Ga0495652_0000003_529896_530279 127
107 3300046533 Ga0495640_0319732 Ga0495640_0319732_108_491 127
108 3300046535 Ga0495586_0004732 Ga0495586_0004732_2958_3341 127
109 3300046536 Ga0495587_0007543 Ga0495587_0007543_4205_4588 127
110 3300046536 Ga0495587_0008801 Ga0495587_0008801_2148_2531 127
111 3300046536 Ga0495587_0171582 Ga0495587_0171582_828_1211 127
112 3300046536 Ga0495587_0177567 Ga0495587_0177567_51_434 127
113 3300046536 Ga0495587_0720653 Ga0495587_0720653_146_529 127
114 3300046543 Ga0495645_0000147 Ga0495645_0000147_31220_31603 127
115 3300046543 Ga0495645_0002818 Ga0495645_0002818_290_673 127
116 3300046543 Ga0495645_0301197 Ga0495645_0301197_330_713 127
117 3300046642 Ga0495634_0002077 Ga0495634_0002077_10127_10510 127
118 3300046642 Ga0495634_0005931 Ga0495634_0005931_1149_1532 127
119 3300046663 Ga0495635_0000037 Ga0495635_0000037_17954_18337 127
120 3300046663 Ga0495635_0265043 Ga0495635_0265043_464_847 127
121 3300046674 Ga0495588_0113861 Ga0495588_0113861_631_1014 127
122 3300046675 Ga0495657_0000040 Ga0495657_0000040_86352_86735 127
123 3300046675 Ga0495657_0002398 Ga0495657_0002398_6630_7013 127
124 3300046678 Ga0495599_0107639 Ga0495599_0107639_1156_1539 127
125 3300046683 Ga0495658_0000803 Ga0495658_0000803_2730_3113 127
126 3300046690 Ga0495624_0036964 Ga0495624_0036964_87_470 127
127 3300046809 Ga0495600_0201014 Ga0495600_0201014_493_876 127
128 3300047317 Ga0495604_0002850 Ga0495604_0002850_1728_2111 127
129 3300047319 Ga0495674_0000020 Ga0495674_0000020_110041_110424 127
130 3300047321 Ga0495676_0000612 Ga0495676_0000612_5738_6121 127
131 3300047321 Ga0495676_0162105 Ga0495676_0162105_878_1261 127
132 3300047322 Ga0495680_0119669 Ga0495680_0119669_73_456 127
133 3300047322 Ga0495680_0140209 Ga0495680_0140209_825_1208 127
134 3300047444 Ga0495675_0000036 Ga0495675_0000036_5938_6321 127
135 3300047444 Ga0495675_0298735 Ga0495675_0298735_12_395 127
136 3300048088 Ga0495602_0000032 Ga0495602_0000032_80584_80967 127
137 3300048905 Ga0496102_0227510 Ga0496102_0227510_1340_1723 127
138 3300048906 Ga0496103_0132957 Ga0496103_0132957_119_502 127
139 3300048907 Ga0496104_0000063 Ga0496104_0000063_33595_33978 127
140 3300048907 Ga0496104_0036673 Ga0496104_0036673_1937_2320 127
141 3300048908 Ga0496105_0000041 Ga0496105_0000041_82641_83024 127
142 3300048911 Ga0496108_0000137 Ga0496108_0000137_29578_29961 127
143 3300048911 Ga0496108_0000213 Ga0496108_0000213_1172_1555 127
144 3300048911 Ga0496108_0313160 Ga0496108_0313160_699_1082 127
145 3300048912 Ga0496109_0000021 Ga0496109_0000021_16707_17090 127
146 3300048912 Ga0496109_0000088 Ga0496109_0000088_28379_28762 127
147 3300048912 Ga0496109_0434499 Ga0496109_0434499_813_1196 127
148 3300048913 Ga0496110_0000018 Ga0496110_0000018_30370_30753 127
149 3300048913 Ga0496110_0030771 Ga0496110_0030771_1283_1666 127
150 3300048913 Ga0496110_0036226 Ga0496110_0036226_2886_3269 127
151 3300048913 Ga0496110_1284219 Ga0496110_1284219_104_487 127
152 3300048914 Ga0496111_0000015 Ga0496111_0000015_48966_49349 127
153 3300048914 Ga0496111_0113007 Ga0496111_0113007_817_1200 127
154 3300048915 Ga0496112_0364274 Ga0496112_0364274_321_704 127
155 3300048916 Ga0496113_0003129 Ga0496113_0003129_4561_4944 127
156 3300048916 Ga0496113_0508525 Ga0496113_0508525_551_934 127
157 3300048919 Ga0496116_0000740 Ga0496116_0000740_40054_40437 127
158 3300048920 Ga0496117_0066754 Ga0496117_0066754_1083_1466 127
159 3300048920 Ga0496117_0157202 Ga0496117_0157202_775_1158 127
160 3300048921 Ga0496118_0053564 Ga0496118_0053564_1522_1905 127
161 3300048921 Ga0496118_0059680 Ga0496118_0059680_1312_1695 127
162 3300048922 Ga0496119_0012644 Ga0496119_0012644_962_1345 127
163 3300048922 Ga0496119_0077892 Ga0496119_0077892_659_1042 127
164 3300048922 Ga0496119_0427750 Ga0496119_0427750_140_523 127
165 3300048923 Ga0496120_0001839 Ga0496120_0001839_22485_22868 127
166 3300048923 Ga0496120_0029595 Ga0496120_0029595_157_540 127
167 3300048928 Ga0496125_0082244 Ga0496125_0082244_168_551 127
168 3300049568 Ga0501031_0004703 Ga0501031_0004703_2356_2739 127
169 3300049569 Ga0501032_0005875 Ga0501032_0005875_6199_6582 127
170 3300049570 Ga0501033_0003242 Ga0501033_0003242_10664_11047 127
171 3300049571 Ga0501034_0003841 Ga0501034_0003841_2435_2818 127
172 3300049572 Ga0501036_0007184 Ga0501036_0007184_6145_6528 127
173 3300049573 Ga0501037_0005720 Ga0501037_0005720_2405_2788 127
174 3300049574 Ga0501038_0009391 Ga0501038_0009391_2471_2854 127
175 3300049575 Ga0501039_0006610 Ga0501039_0006610_2410_2793 127
176 3300049575 Ga0501039_0202493 Ga0501039_0202493_1027_1410 127
177 3300049578 Ga0501042_0017834 Ga0501042_0017834_2051_2434 127
178 3300049579 Ga0501043_0007214 Ga0501043_0007214_5952_6335 127
179 3300049580 Ga0501046_0001763 Ga0501046_0001763_13998_14381 127
180 3300049581 Ga0501047_0000125 Ga0501047_0000125_10536_10919 127
181 3300049582 Ga0501048_0006563 Ga0501048_0006563_6108_6491 127
182 3300049583 Ga0501067_0121229 Ga0501067_0121229_1042_1425 127
183 3300049584 Ga0501068_0041055 Ga0501068_0041055_720_1103 127
184 3300049584 Ga0501068_0658460 Ga0501068_0658460_116_499 127
185 3300049585 Ga0501069_0349186 Ga0501069_0349186_163_546 127
186 3300049586 Ga0501070_0000037 Ga0501070_0000037_107509_107892 127
187 3300049586 Ga0501070_0003954 Ga0501070_0003954_5824_6207 127
188 3300049588 Ga0501072_0098501 Ga0501072_0098501_570_953 127
189 3300049588 Ga0501072_0218502 Ga0501072_0218502_70_453 127
190 3300049589 Ga0501073_0006212 Ga0501073_0006212_2368_2751 127
191 3300049590 Ga0501074_0006071 Ga0501074_0006071_2437_2820 127
192 3300049591 Ga0501075_0177221 Ga0501075_0177221_1017_1400 127
193 3300049592 Ga0501076_0544102 Ga0501076_0544102_129_512 127
194 3300049741 Ga0501079_0012251 Ga0501079_0012251_3823_4206 127
195 3300049742 Ga0501080_0009123 Ga0501080_0009123_2458_2841 127
196 3300049743 Ga0501081_0199974 Ga0501081_0199974_756_1139 127
197 3300049743 Ga0501081_0282525 Ga0501081_0282525_737_1120 127
198 3300049744 Ga0501083_0005623 Ga0501083_0005623_6001_6384 127
199 3300049744 Ga0501083_0044315 Ga0501083_0044315_1346_1729 127
200 3300049822 Ga0501035_0000966 Ga0501035_0000966_27573_27956 127
201 3300049823 Ga0501044_0013220 Ga0501044_0013220_2435_2818 127
202 3300049823 Ga0501044_0038198 Ga0501044_0038198_134_517 127
203 3300049823 Ga0501044_1565220 Ga0501044_1565220_93_476 127
204 3300049824 Ga0501045_0040428 Ga0501045_0040428_1039_1422 127
205 3300049824 Ga0501045_0355649 Ga0501045_0355649_274_657 127
206 3300050513 nmdc:mga0rr50_1126508_c1 nmdc:mga0rr50_1126508_c1_204_587 127
207 3300050514 nmdc:mga08x19_442781_c1 nmdc:mga08x19_442781_c1_240_623 127
208 3300053083 Ga0495655_0000828 Ga0495655_0000828_1229_1612 127
209 3300053084 Ga0495595_0000009 Ga0495595_0000009_106305_106688 127
210 3300053084 Ga0495595_0000164 Ga0495595_0000164_18128_18511 127
211 3300053084 Ga0495595_0061321 Ga0495595_0061321_244_627 127
212 3300053085 Ga0495619_0000057 Ga0495619_0000057_29164_29547 127
213 3300053085 Ga0495619_0000075 Ga0495619_0000075_45050_45433 127
214 3300053094 Ga0500566_0110494 Ga0500566_0110494_644_1027 127
215 3300053096 Ga0500641_0008397 Ga0500641_0008397_1907_2290 127
216 3300053123 Ga0500614_003228 Ga0500614_003228_2707_3090 127
217 3300053123 Ga0500614_263779 Ga0500614_263779_89_472 127
218 3300054114 Ga0501084_0453043 Ga0501084_0453043_426_809 127
219 3300054114 Ga0501084_1840003 Ga0501084_1840003_89_472 127
220 3300060353 Ga0501082_0025653 Ga0501082_0025653_2304_2687 127
221 3300060353 Ga0501082_0231297 Ga0501082_0231297_189_572 127
222 3300061734 Ga0530510_0101367 Ga0530510_0101367_1216_1599 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

4

116

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dbo-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8779 1 127
3dbo-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8712 1 127
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.8518 1 126
5f22-assembly1.cif.gz_A c-terminal domain of sars-cov nsp8 complex with nsp7 0.8461 35 63
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.8335 1 126
ID Description Score Start End Superfamily
af_P9WFB1_8_111_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9468 4 101 3.40.50.1010
af_O07783_4_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9049 3 127 3.40.50.1010
af_P9WFB1_8_111_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8858 4 101 3.40.50.1010
3dboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8779 1 127 3.40.50.1010
3dboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8712 1 127 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A536GV99-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9806 6 127 GO:0000287
GO:0004540
GO:0090729
AF-A0A1M3BGX0-F1-model_v4 PIN domain-containing protein 0.9749 23 127 GO:0004518
GO:0046872
AF-A0A536EDP0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9677 3 127 GO:0000287
GO:0004540
GO:0090729
AF-A0A1M3BGX0-F1-model_v4 PIN domain-containing protein 0.9658 23 127 GO:0004518
GO:0046872
AF-A0A536GV99-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9574 6 127 GO:0000287
GO:0004540
GO:0090729

Feature Viewer

pLDDT pTM Quality
94.4 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map