F334770

General Info

Members Datasets Scaffolds Average Seq Length
222 164 444 200

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_010502|Ga0495617_010502_1344_2024
Length 226
Sequence MPQRGPAGASLRRVWLPLWQQWTVEHMSEKQKKHKLVIIVGSVREGRFGPVVTSWVAEQARVHGGFDVEVVDLADIEIPLSLPAASPKFAGDSYPRPEAMAPLTSRLEGAEAFILVTPEYNHSYPASLKAAIDWHFTQWTAKPVAFVSYGGAAGGRHAVLHLENVLTELHAVTIRDGLAFPNYFTAWQDGQPLDPEAPGYAKTLLDQLAWWAAALSAARDASPYPA

Samples

Sample ID Description Type Environment
1 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
5 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
8 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
9 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
10 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
11 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
20 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
21 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
27 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
28 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
29 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
30 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
33 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
34 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
35 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
36 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
37 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
38 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
39 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
40 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
41 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
44 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
45 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
46 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
47 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
70 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
71 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
87 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
97 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
100 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
131 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
132 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
135 2527291627 Frankia casuarinae Thr Isolate Nodule
136 2527291629 Frankia sp. BMG5.23 Isolate Nodule
137 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
138 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
139 2576861822 Frankia sp. CeD Isolate Nodule
140 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
141 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
142 2643221647 Streptomyces sp. Root369 Isolate Unclassified
143 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
144 2643221692 Nocardia sp. Root136 Isolate Unclassified
145 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
146 2684623036 Frankia sp. CgIM4 Isolate Nodule
147 2687453737 Frankia sp. BMG5.36 Isolate Nodule
148 2710264753 Frankia sp. KB5 Isolate Nodule
149 2773857924 Frankia sp. CgIS1 Isolate Nodule
150 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
151 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
152 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
153 2862574272 Streptomyces sp. AcE210 Isolate Nodule
154 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
155 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
156 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
157 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
158 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
159 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
160 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
161 637000116 Frankia casuarinae CcI3 Isolate Nodule
162 8002775197 Frankia nepalensis CN7 Isolate Nodule
163 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
164 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.49
Metatranscriptomes 0
Isolates 13.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 4.5
Rhizoplane 2.25
Rhizosphere 71.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495617_010502 3300046452 Bacteria 3172
2 JGI24738J21930_10045871 3300002075 Bacteria 889
3 rootH1_10111506 3300003323 Bacteria 2117
4 Ga0068856_100128299 3300005614 Bacteria 2540
5 Ga0068863_100006491 3300005841 Bacteria 11470
6 Ga0081455_10219366 3300005937 Bacteria 1411
7 Ga0070715_10240919 3300006163 Bacteria 940
8 Ga0075428_100087996 3300006844 Bacteria 3388
9 Ga0075430_100078444 3300006846 Bacteria 2768
10 Ga0075431_100084785 3300006847 Bacteria 3271
11 Ga0075431_100088161 3300006847 Bacteria 3202
12 Ga0075431_100124789 3300006847 Bacteria 2657
13 Ga0075429_100072435 3300006880 Bacteria 3001
14 Ga0075429_100227794 3300006880 Bacteria 1632
15 Ga0105244_10136129 3300009036 Bacteria 1183
16 Ga0111539_10221327 3300009094 Bacteria 2204
17 Ga0105247_10003354 3300009101 Bacteria 10479
18 Ga0114129_10057656 3300009147 Bacteria 5433
19 Ga0114129_10804276 3300009147 Bacteria 1199
20 Ga0105243_10712820 3300009148 Bacteria 979
21 Ga0105248_10020025 3300009177 Bacteria 7408
22 Ga0105246_10023827 3300011119 Bacteria 3967
23 Ga0157380_10171568 3300014326 Bacteria 1896
24 Ga0157379_10007294 3300014968 Bacteria 9571
25 Ga0207710_10000175 3300025900 Bacteria 65485
26 Ga0207647_10020999 3300025904 Bacteria 4366
27 Ga0207702_10580368 3300026078 Bacteria 1099
28 Ga0207641_10003944 3300026088 Bacteria 12963
29 Ga0209371_1031840 3300027312 Bacteria 1140
30 Ga0307517_10079096 3300028786 Bacteria 2833
31 Ga0307515_10000535 3300028794 Bacteria 89416
32 Ga0307515_10220891 3300028794 Bacteria 1713
33 Ga0307515_10342360 3300028794 Bacteria 1147
34 Ga0265338_10031859 3300028800 Bacteria 5159
35 Ga0268256_1043160 3300030500 Bacteria 997
36 Ga0307511_10000940 3300030521 Bacteria 30847
37 Ga0307511_10003983 3300030521 Bacteria 15103
38 Ga0307512_10003507 3300030522 Bacteria 18139
39 Ga0307512_10008633 3300030522 Bacteria 9902
40 Ga0307512_10215009 3300030522 Bacteria 1015
41 Ga0307509_10004747 3300031507 Bacteria 19386
42 Ga0307509_10029322 3300031507 Bacteria 6109
43 Ga0307509_10055069 3300031507 Bacteria 4229
44 Ga0307508_10003278 3300031616 Bacteria 16503
45 Ga0307508_10040246 3300031616 Bacteria 4197
46 Ga0307514_10028302 3300031649 Bacteria 4522
47 Ga0307514_10189290 3300031649 Bacteria 1313
48 Ga0307516_10005066 3300031730 Bacteria 15946
49 Ga0307518_10079839 3300031838 Bacteria 2362
50 Ga0307518_10172614 3300031838 Bacteria 1472
51 Ga0307407_10560266 3300031903 Bacteria 846
52 Ga0307411_10056775 3300032005 Bacteria 2583
53 Ga0307507_10025676 3300033179 Bacteria 6380
54 Ga0307507_10057968 3300033179 Bacteria 3641
55 Ga0307510_10031456 3300033180 Bacteria 5996
56 Ga0307510_10264789 3300033180 Bacteria 1198
57 Ga0316214_1001192 3300033545 Bacteria 2948
58 Ga0395898_0031037 3300037466 Bacteria 5344
59 Ga0451802_1088862 3300041460 Bacteria 796
60 Ga0451841_0401401 3300041498 Bacteria 1237
61 Ga0439449_0012372 3300042007 Bacteria 3209
62 Ga0439458_0011740 3300042157 Bacteria 1961
63 Ga0439458_0075024 3300042157 Bacteria 858
64 Ga0466969_0065979 3300044656 Bacteria 1748
65 Ga0466972_0066171 3300044658 Bacteria 1728
66 Ga0466972_0094963 3300044658 Bacteria 1413
67 Ga0466966_0076713 3300044684 Bacteria 2086
68 Ga0466966_0123538 3300044684 Bacteria 1589
69 Ga0466961_0030485 3300044693 Bacteria 3466
70 Ga0466963_0054421 3300044694 Bacteria 2660
71 Ga0466964_0122513 3300044706 Bacteria 1174
72 Ga0466971_0003344 3300044719 Bacteria 6846
73 Ga0466971_0040480 3300044719 Bacteria 2093
74 Ga0466968_0001865 3300044735 Bacteria 7625
75 Ga0466968_0192682 3300044735 Bacteria 952
76 Ga0466970_0002888 3300044765 Bacteria 8318
77 Ga0466970_0080155 3300044765 Bacteria 1764
78 Ga0466960_0027163 3300044901 Bacteria 2608
79 Ga0466959_0045620 3300045049 Bacteria 3227
80 Ga0466959_0272633 3300045049 Bacteria 1163
81 Ga0466958_0100800 3300045836 Bacteria 1795
82 Ga0466967_0907609 3300045976 Bacteria 876
83 Ga0495592_0067680 3300046454 Bacteria 2609
84 Ga0495603_0051150 3300046455 Bacteria 2455
85 Ga0495629_0013684 3300046459 Bacteria 5854
86 Ga0495629_0135881 3300046459 Bacteria 1712
87 Ga0495638_0117300 3300046460 Bacteria 1576
88 Ga0495638_0136756 3300046460 Bacteria 1434
89 Ga0495638_0178848 3300046460 Bacteria 1212
90 Ga0495653_0480981 3300046463 Bacteria 777
91 Ga0495662_0025461 3300046476 Bacteria 2857
92 Ga0495585_0030676 3300046492 Bacteria 3057
93 Ga0495594_0353431 3300046499 Bacteria 837
94 Ga0495607_0048432 3300046501 Bacteria 2485
95 Ga0495606_0001231 3300046507 Bacteria 35820
96 Ga0495631_0168604 3300046518 Bacteria 939
97 Ga0495666_0241728 3300046526 Bacteria 824
98 Ga0495652_0045032 3300046529 Bacteria 3797
99 Ga0495640_0056059 3300046533 Bacteria 2694
100 Ga0495587_0032840 3300046536 Bacteria 3135
101 Ga0495645_0077420 3300046543 Bacteria 2391
102 Ga0495622_0017610 3300046557 Bacteria 3327
103 Ga0495668_0000326 3300046616 Bacteria 65274
104 Ga0495634_0004093 3300046642 Bacteria 11549
105 Ga0495611_0154625 3300046648 Bacteria 1071
106 Ga0495625_0005980 3300046660 Bacteria 10938
107 Ga0495625_0021931 3300046660 Bacteria 4905
108 Ga0495625_0053018 3300046660 Bacteria 2903
109 Ga0495625_0067897 3300046660 Bacteria 2508
110 Ga0495625_0080645 3300046660 Bacteria 2266
111 Ga0495635_0080975 3300046663 Bacteria 2222
112 Ga0495657_0005015 3300046675 Bacteria 10517
113 Ga0495657_0014956 3300046675 Bacteria 5691
114 Ga0495646_0231268 3300046680 Bacteria 996
115 Ga0495613_0007586 3300046689 Bacteria 8066
116 Ga0495613_0011271 3300046689 Bacteria 6640
117 Ga0495613_0183150 3300046689 Bacteria 1483
118 Ga0495671_0027482 3300046692 Bacteria 2939
119 Ga0495589_0008702 3300046794 Bacteria 5286
120 Ga0495660_0126573 3300046810 Bacteria 1286
121 Ga0495581_0154111 3300047315 Bacteria 1343
122 Ga0495604_0001665 3300047317 Bacteria 18291
123 Ga0495636_0156722 3300047318 Bacteria 1024
124 Ga0495674_0570057 3300047319 Bacteria 899
125 Ga0495676_0002502 3300047321 Bacteria 16361
126 Ga0495683_0001033 3300047323 Bacteria 19350
127 Ga0495683_0001091 3300047323 Bacteria 18767
128 Ga0495687_003685 3300047443 Bacteria 10907
129 Ga0495687_042356 3300047443 Bacteria 1990
130 Ga0495675_0053174 3300047444 Bacteria 2571
131 Ga0495685_005090 3300047447 Bacteria 4281
132 Ga0495685_016617 3300047447 Bacteria 2515
133 Ga0495685_024127 3300047447 Bacteria 2093
134 Ga0495685_038679 3300047447 Bacteria 1634
135 Ga0495681_0003427 3300047470 Bacteria 11030
136 Ga0495684_0088634 3300047471 Bacteria 2345
137 Ga0495614_0010586 3300048089 Bacteria 4065
138 Ga0495614_0202433 3300048089 Bacteria 898
139 Ga0495614_0274266 3300048089 Bacteria 775
140 Ga0495626_0000046 3300048091 Bacteria 162660
141 Ga0496101_0026329 3300048904 Bacteria 4044
142 Ga0496102_0000044 3300048905 Bacteria 187834
143 Ga0496103_0000123 3300048906 Bacteria 83794
144 Ga0496118_0025756 3300048921 Bacteria 5032
145 Ga0496119_0002433 3300048922 Bacteria 20443
146 Ga0496119_0023241 3300048922 Bacteria 4406
147 Ga0496120_0001130 3300048923 Bacteria 34458
148 Ga0496121_0007884 3300048924 Bacteria 12741
149 Ga0496121_0012689 3300048924 Bacteria 9144
150 Ga0496126_0483284 3300048929 Bacteria 992
151 Ga0501031_0260440 3300049568 Bacteria 1127
152 Ga0501032_0168241 3300049569 Bacteria 1438
153 Ga0501033_0003662 3300049570 Bacteria 12529
154 Ga0501033_0118774 3300049570 Bacteria 1920
155 Ga0501034_1166991 3300049571 Bacteria 649
156 Ga0501037_0097690 3300049573 Bacteria 2122
157 Ga0501037_0105978 3300049573 Bacteria 2026
158 Ga0501038_0000755 3300049574 Bacteria 28852
159 Ga0501038_0053772 3300049574 Bacteria 3465
160 Ga0501042_0261063 3300049578 Bacteria 1250
161 Ga0501043_0079996 3300049579 Bacteria 2568
162 Ga0501047_0000056 3300049581 Bacteria 143501
163 Ga0501047_0028670 3300049581 Bacteria 5369
164 Ga0501047_0051632 3300049581 Bacteria 3973
165 Ga0501047_0104579 3300049581 Bacteria 2711
166 Ga0501070_0630010 3300049586 Bacteria 853
167 Ga0501072_0062661 3300049588 Bacteria 2933
168 Ga0501072_0301522 3300049588 Bacteria 1274
169 Ga0501075_0074218 3300049591 Bacteria 2573
170 Ga0501076_0591481 3300049592 Bacteria 915
171 Ga0501080_0097755 3300049742 Bacteria 2726
172 Ga0501035_0034823 3300049822 Bacteria 4574
173 Ga0501035_0055990 3300049822 Bacteria 3520
174 Ga0501035_0142529 3300049822 Bacteria 2083
175 Ga0501035_0190797 3300049822 Bacteria 1762
176 Ga0501035_0293613 3300049822 Bacteria 1371
177 Ga0501044_0009928 3300049823 Bacteria 10340
178 Ga0501044_0220647 3300049823 Bacteria 1846
179 nmdc:mga05p37_184106_c1 3300050507 Bacteria 2540
180 nmdc:mga05p37_468664_c1 3300050507 Bacteria 1454
181 nmdc:mga09592_45031_c1 3300050508 Bacteria 3716
182 nmdc:mga0qj67_42157_c1 3300050509 Bacteria 3592
183 nmdc:mga0qj67_862437_c1 3300050509 Bacteria 715
184 nmdc:mga06r32_261650_c1 3300050510 Bacteria 1718
185 nmdc:mga06r32_713709_c1 3300050510 Bacteria 968
186 Ga0495619_0068253 3300053085 Bacteria 2375
187 Ga0500640_038271 3300053095 Bacteria 2107
188 Ga0500553_052473 3300053101 Bacteria 1949
189 Ga0500600_0296871 3300053149 Bacteria 694
190 Ga0500616_0000880 3300053153 Bacteria 33112
191 Ga0466962_0011464 3300061719 Bacteria 4267
192 Ga0466962_0044543 3300061719 Bacteria 2122
193 2528202822 2527291627 Bacteria 5309833
194 2528213198 2527291629 Bacteria 5267418
195 2546947664 2546825537 Bacteria 5389291
196 2552109998 2551306166 Bacteria 9731570
197 2579748351 2576861822 Bacteria 5004595
198 2585305561 2582581313 Bacteria 10042643
199 2623585604 2622736626 Bacteria 7181580
200 2644262657 2643221647 Bacteria 10741251
201 2644440697 2643221678 Bacteria 9540101
202 2644513359 2643221692 Bacteria 7282860
203 2686536188 2684623035 Bacteria 8032739
204 2686542131 2684623036 Bacteria 5199090
205 2689955850 2687453737 Bacteria 11203906
206 2710605097 2710264753 Bacteria 5455564
207 2774864205 2773857924 Bacteria 5256821
208 2785370224 2784746768 Bacteria 10036182
209 2795782433 2795385470 Bacteria 8317180
210 2819744364 2818991472 Bacteria 10089953
211 2862581381 2862574272 Bacteria 10567477
212 2867305518 2867302475 Bacteria 7087181
213 2867317933 2867312974 Bacteria 7058875
214 2867319629 2867319477 Bacteria 7069771
215 2919716267 2919713450 Bacteria 7431245
216 2929224118 2929219909 Bacteria 6984360
217 2954385561 2954380949 Bacteria 10050426
218 2996225374 2996221748 Bacteria 6799777
219 637877538 637000116 Bacteria 5433628
220 8002780402 8002775197 Bacteria 10728764
221 8055068151 8055066027 Bacteria 9479577
222 8055175108 8055172936 Bacteria 9305943
223 Ga0495617_010502
224 JGI24738J21930_10045871
225 rootH1_10111506
226 Ga0068856_100128299
227 Ga0068863_100006491
228 Ga0081455_10219366
229 Ga0070715_10240919
230 Ga0075428_100087996
231 Ga0075430_100078444
232 Ga0075431_100084785
233 Ga0075431_100088161
234 Ga0075431_100124789
235 Ga0075429_100072435
236 Ga0075429_100227794
237 Ga0105244_10136129
238 Ga0111539_10221327
239 Ga0105247_10003354
240 Ga0114129_10057656
241 Ga0114129_10804276
242 Ga0105243_10712820
243 Ga0105248_10020025
244 Ga0105246_10023827
245 Ga0157380_10171568
246 Ga0157379_10007294
247 Ga0207710_10000175
248 Ga0207647_10020999
249 Ga0207702_10580368
250 Ga0207641_10003944
251 Ga0209371_1031840
252 Ga0307517_10079096
253 Ga0307515_10000535
254 Ga0307515_10220891
255 Ga0307515_10342360
256 Ga0265338_10031859
257 Ga0268256_1043160
258 Ga0307511_10000940
259 Ga0307511_10003983
260 Ga0307512_10003507
261 Ga0307512_10008633
262 Ga0307512_10215009
263 Ga0307509_10004747
264 Ga0307509_10029322
265 Ga0307509_10055069
266 Ga0307508_10003278
267 Ga0307508_10040246
268 Ga0307514_10028302
269 Ga0307514_10189290
270 Ga0307516_10005066
271 Ga0307518_10079839
272 Ga0307518_10172614
273 Ga0307407_10560266
274 Ga0307411_10056775
275 Ga0307507_10025676
276 Ga0307507_10057968
277 Ga0307510_10031456
278 Ga0307510_10264789
279 Ga0316214_1001192
280 Ga0395898_0031037
281 Ga0451802_1088862
282 Ga0451841_0401401
283 Ga0439449_0012372
284 Ga0439458_0011740
285 Ga0439458_0075024
286 Ga0466969_0065979
287 Ga0466972_0066171
288 Ga0466972_0094963
289 Ga0466966_0076713
290 Ga0466966_0123538
291 Ga0466961_0030485
292 Ga0466963_0054421
293 Ga0466964_0122513
294 Ga0466971_0003344
295 Ga0466971_0040480
296 Ga0466968_0001865
297 Ga0466968_0192682
298 Ga0466970_0002888
299 Ga0466970_0080155
300 Ga0466960_0027163
301 Ga0466959_0045620
302 Ga0466959_0272633
303 Ga0466958_0100800
304 Ga0466967_0907609
305 Ga0495592_0067680
306 Ga0495603_0051150
307 Ga0495629_0013684
308 Ga0495629_0135881
309 Ga0495638_0117300
310 Ga0495638_0136756
311 Ga0495638_0178848
312 Ga0495653_0480981
313 Ga0495662_0025461
314 Ga0495585_0030676
315 Ga0495594_0353431
316 Ga0495607_0048432
317 Ga0495606_0001231
318 Ga0495631_0168604
319 Ga0495666_0241728
320 Ga0495652_0045032
321 Ga0495640_0056059
322 Ga0495587_0032840
323 Ga0495645_0077420
324 Ga0495622_0017610
325 Ga0495668_0000326
326 Ga0495634_0004093
327 Ga0495611_0154625
328 Ga0495625_0005980
329 Ga0495625_0021931
330 Ga0495625_0053018
331 Ga0495625_0067897
332 Ga0495625_0080645
333 Ga0495635_0080975
334 Ga0495657_0005015
335 Ga0495657_0014956
336 Ga0495646_0231268
337 Ga0495613_0007586
338 Ga0495613_0011271
339 Ga0495613_0183150
340 Ga0495671_0027482
341 Ga0495589_0008702
342 Ga0495660_0126573
343 Ga0495581_0154111
344 Ga0495604_0001665
345 Ga0495636_0156722
346 Ga0495674_0570057
347 Ga0495676_0002502
348 Ga0495683_0001033
349 Ga0495683_0001091
350 Ga0495687_003685
351 Ga0495687_042356
352 Ga0495675_0053174
353 Ga0495685_005090
354 Ga0495685_016617
355 Ga0495685_024127
356 Ga0495685_038679
357 Ga0495681_0003427
358 Ga0495684_0088634
359 Ga0495614_0010586
360 Ga0495614_0202433
361 Ga0495614_0274266
362 Ga0495626_0000046
363 Ga0496101_0026329
364 Ga0496102_0000044
365 Ga0496103_0000123
366 Ga0496118_0025756
367 Ga0496119_0002433
368 Ga0496119_0023241
369 Ga0496120_0001130
370 Ga0496121_0007884
371 Ga0496121_0012689
372 Ga0496126_0483284
373 Ga0501031_0260440
374 Ga0501032_0168241
375 Ga0501033_0003662
376 Ga0501033_0118774
377 Ga0501034_1166991
378 Ga0501037_0097690
379 Ga0501037_0105978
380 Ga0501038_0000755
381 Ga0501038_0053772
382 Ga0501042_0261063
383 Ga0501043_0079996
384 Ga0501047_0000056
385 Ga0501047_0028670
386 Ga0501047_0051632
387 Ga0501047_0104579
388 Ga0501070_0630010
389 Ga0501072_0062661
390 Ga0501072_0301522
391 Ga0501075_0074218
392 Ga0501076_0591481
393 Ga0501080_0097755
394 Ga0501035_0034823
395 Ga0501035_0055990
396 Ga0501035_0142529
397 Ga0501035_0190797
398 Ga0501035_0293613
399 Ga0501044_0009928
400 Ga0501044_0220647
401 nmdc:mga05p37_184106_c1
402 nmdc:mga05p37_468664_c1
403 nmdc:mga09592_45031_c1
404 nmdc:mga0qj67_42157_c1
405 nmdc:mga0qj67_862437_c1
406 nmdc:mga06r32_261650_c1
407 nmdc:mga06r32_713709_c1
408 Ga0495619_0068253
409 Ga0500640_038271
410 Ga0500553_052473
411 Ga0500600_0296871
412 Ga0500616_0000880
413 Ga0466962_0011464
414 Ga0466962_0044543
415 2528202822
416 2528213198
417 2546947664
418 2552109998
419 2579748351
420 2585305561
421 2623585604
422 2644262657
423 2644440697
424 2644513359
425 2686536188
426 2686542131
427 2689955850
428 2710605097
429 2774864205
430 2785370224
431 2795782433
432 2819744364
433 2862581381
434 2867305518
435 2867317933
436 2867319629
437 2919716267
438 2929224118
439 2954385561
440 2996225374
441 637877538
442 8002780402
443 8055068151
444 8055175108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

34

185

0.91

PF02525

Flavodoxin_2

Flavodoxin-like fold

34

176

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bx9-assembly1.cif.gz_A purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis 0.8725 31 206
3gfr-assembly2.cif.gz_B structure of yhda, d137l variant 0.863 32 208
2fzv-assembly1.cif.gz_D crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.862 29 216
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.859 32 209
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8572 32 209
ID Description Score Start End Superfamily
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9407 31 176 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8674 31 211 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8538 29 216 3.40.50.360
af_Q54QT4_9_187_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8506 31 200 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8493 31 211 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A5N0UXA3-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9966 29 221 GO:0005829
GO:0010181
GO:0016491
AF-A0A0N1FKG5-F1-model_v4 NADPH-dependent FMN reductase 0.9951 28 221 GO:0005829
GO:0010181
GO:0016491
AF-A0A0K1JE68-F1-model_v4 FMN reductase 0.9868 28 221 GO:0005829
GO:0010181
GO:0016491
AF-A0A5N0UXA3-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9864 29 221 GO:0005829
GO:0010181
GO:0016491
AF-A0A419YAU6-F1-model_v4 NAD(P)H-dependent FMN reductase 0.9788 29 218 GO:0005829
GO:0010181
GO:0016491

Map