F334752

General Info

Members Datasets Scaffolds Average Seq Length
222 147 444 234

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0421062|Ga0453684_0421062_13_846
Length 277
Sequence LTFDVVTIFPEFFRGPFEFGVVGQAVKSGILSIQVHDLRTWTHDRHRTVDDRPFGGGEGMLLKAEPLFTAVESILPERGPRTKVVLVSASGRPYDQNVAREWSQNVDRLVILCGRYEGVDARVSEHLVDDEVAIGDFVLSGGELAAAVIVDSVARLLPGVVGNVDSTVNESYSVLNVEDKVWKKGRDKRGKRFKGSRELQLLDCPQYTRPAEFRGWKVPEVLLGGNHEEIRKWRLETAIRKTAQSRPDLLPADLLEELELERLKEQSHDERDAAERL

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 2.25
Rhizosphere 85.14
Stem 0
Stem Tuber 0
Unclassified 9.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0421062 3300044712 Bacteria 1492
2 JGI24744J21845_10001163 3300002077 Bacteria 5123
3 JGI24033J26618_1002698 3300002155 Bacteria 1830
4 Ga0058862_12679783 3300004803 Bacteria 2264
5 Ga0070658_10069712 3300005327 Bacteria 2877
6 Ga0070683_100011214 3300005329 Bacteria 7732
7 Ga0070683_100089415 3300005329 Bacteria 2890
8 Ga0070680_100006714 3300005336 Bacteria 8766
9 Ga0070682_100540228 3300005337 Bacteria 910
10 Ga0070660_100041023 3300005339 Bacteria 3526
11 Ga0070660_100431590 3300005339 Bacteria 1092
12 Ga0070689_100463044 3300005340 Bacteria 1080
13 Ga0070691_10001535 3300005341 Bacteria 9938
14 Ga0070661_100087174 3300005344 Bacteria 2309
15 Ga0070692_10291176 3300005345 Bacteria 993
16 Ga0070659_100132551 3300005366 Unclassified 2025
17 Ga0070709_10146382 3300005434 Bacteria 1628
18 Ga0070709_10578040 3300005434 Bacteria 863
19 Ga0070714_100009180 3300005435 Bacteria 7762
20 Ga0070714_100101193 3300005435 Bacteria 2539
21 Ga0070714_100807316 3300005435 Bacteria 909
22 Ga0070711_100052203 3300005439 Bacteria 2812
23 Ga0070711_100140726 3300005439 Bacteria 1809
24 Ga0070678_100270407 3300005456 Bacteria 1433
25 Ga0070662_100467661 3300005457 Bacteria 1049
26 Ga0070662_100549801 3300005457 Bacteria 967
27 Ga0070681_10022454 3300005458 Bacteria 6335
28 Ga0070681_10186980 3300005458 Bacteria 1992
29 Ga0070681_10523938 3300005458 Bacteria 1099
30 Ga0070706_100085035 3300005467 Bacteria 2931
31 Ga0070707_100005705 3300005468 Bacteria 11613
32 Ga0070698_100004732 3300005471 Bacteria 14948
33 Ga0070698_100324688 3300005471 Bacteria 1470
34 Ga0070698_100945638 3300005471 Bacteria 808
35 Ga0070679_100020513 3300005530 Bacteria 6444
36 Ga0070679_100111673 3300005530 Unclassified 2720
37 Ga0070684_100000533 3300005535 Bacteria 26106
38 Ga0070697_100142108 3300005536 Bacteria 2019
39 Ga0070697_100153189 3300005536 Bacteria 1944
40 Ga0068855_100062393 3300005563 Bacteria 4351
41 Ga0070664_100273225 3300005564 Bacteria 1523
42 Ga0068857_100011683 3300005577 Bacteria 7636
43 Ga0068857_100013077 3300005577 Bacteria 7231
44 Ga0068856_100008551 3300005614 Bacteria 9949
45 Ga0068856_100025189 3300005614 Bacteria 5796
46 Ga0068856_100063908 3300005614 Bacteria 3636
47 Ga0068862_100345891 3300005844 Bacteria 1378
48 Ga0070717_10002300 3300006028 Bacteria 13405
49 Ga0070717_10010038 3300006028 Bacteria 7129
50 Ga0070717_10016754 3300006028 Bacteria 5688
51 Ga0075362_10096654 3300006177 Bacteria 1377
52 Ga0097621_100093804 3300006237 Bacteria 2516
53 Ga0068871_100090668 3300006358 Bacteria 2546
54 Ga0075431_100005024 3300006847 Bacteria 13013
55 Ga0075436_100002381 3300006914 Bacteria 12966
56 Ga0075436_100482002 3300006914 Unclassified 906
57 Ga0105240_10027809 3300009093 Bacteria 7399
58 Ga0105245_10196894 3300009098 Bacteria 1933
59 Ga0105241_10015997 3300009174 Bacteria 5498
60 Ga0105241_10057659 3300009174 Bacteria 2980
61 Ga0105248_10082592 3300009177 Bacteria 3613
62 Ga0105248_10533647 3300009177 Bacteria 1323
63 Ga0105237_10014554 3300009545 Bacteria 8220
64 Ga0105238_10016924 3300009551 Bacteria 7399
65 Ga0105239_10011644 3300010375 Bacteria 9816
66 Ga0105239_10725779 3300010375 Bacteria 1137
67 Ga0157373_10016270 3300013100 Bacteria 5428
68 Ga0157371_10286708 3300013102 Bacteria 1190
69 Ga0157370_10000243 3300013104 Bacteria 69659
70 Ga0157370_10039844 3300013104 Bacteria 4537
71 Ga0157370_10048944 3300013104 Bacteria 4048
72 Ga0157370_10070885 3300013104 Bacteria 3289
73 Ga0157369_10012437 3300013105 Bacteria 9660
74 Ga0157369_10019437 3300013105 Bacteria 7599
75 Ga0157369_10344978 3300013105 Bacteria 1547
76 Ga0157374_10016689 3300013296 Bacteria 6459
77 Ga0157374_10073937 3300013296 Unclassified 3217
78 Ga0157374_10118992 3300013296 Bacteria 2548
79 Ga0157374_10901213 3300013296 Unclassified 902
80 Ga0157378_10773363 3300013297 Bacteria 984
81 Ga0157372_10011034 3300013307 Bacteria 9617
82 Ga0157375_10313400 3300013308 Bacteria 1733
83 Ga0163163_10080054 3300014325 Bacteria 3266
84 Ga0157379_10009047 3300014968 Bacteria 8678
85 Ga0213876_10007510 3300021384 Bacteria 5926
86 Ga0213875_10000349 3300021388 Bacteria 43467
87 Ga0213875_10000770 3300021388 Bacteria 23997
88 Ga0213875_10001516 3300021388 Bacteria 14941
89 Ga0213875_10006432 3300021388 Bacteria 6167
90 Ga0213875_10114627 3300021388 Unclassified 1259
91 Ga0207699_10233230 3300025906 Bacteria 1261
92 Ga0207705_10077189 3300025909 Bacteria 2423
93 Ga0207654_10172698 3300025911 Bacteria 1405
94 Ga0207707_10011300 3300025912 Bacteria 7771
95 Ga0207695_10006827 3300025913 Bacteria 14699
96 Ga0207660_10018133 3300025917 Bacteria 4687
97 Ga0207657_10052358 3300025919 Bacteria 3543
98 Ga0207657_10390730 3300025919 Bacteria 1095
99 Ga0207652_10005925 3300025921 Bacteria 9886
100 Ga0207652_10115901 3300025921 Unclassified 2380
101 Ga0207652_10215604 3300025921 Bacteria 1729
102 Ga0207646_10001243 3300025922 Bacteria 31922
103 Ga0207646_10723367 3300025922 Bacteria 889
104 Ga0207694_10008510 3300025924 Bacteria 7748
105 Ga0207687_10299717 3300025927 Bacteria 1294
106 Ga0207690_10017527 3300025932 Unclassified 4374
107 Ga0207706_10484455 3300025933 Bacteria 1068
108 Ga0207706_10543219 3300025933 Bacteria 1001
109 Ga0207711_10075348 3300025941 Bacteria 2937
110 Ga0207711_10371773 3300025941 Bacteria 1326
111 Ga0207661_10007646 3300025944 Bacteria 7686
112 Ga0207679_10060126 3300025945 Bacteria 2822
113 Ga0207679_10171001 3300025945 Bacteria 1789
114 Ga0207667_10012787 3300025949 Bacteria 9641
115 Ga0207667_10174233 3300025949 Unclassified 2211
116 Ga0207639_10032187 3300026041 Bacteria 3859
117 Ga0207639_10696093 3300026041 Bacteria 943
118 Ga0207702_10009063 3300026078 Bacteria 8375
119 Ga0207702_10043123 3300026078 Bacteria 3787
120 Ga0207676_10165809 3300026095 Bacteria 1919
121 Ga0207674_10007292 3300026116 Bacteria 12891
122 Ga0207674_10011636 3300026116 Bacteria 9882
123 Ga0207698_10022693 3300026142 Bacteria 4369
124 Ga0265316_10022616 3300031344 Bacteria 5295
125 Ga0307509_10149566 3300031507 Unclassified 2254
126 Ga0307412_10162581 3300031911 Bacteria 1661
127 Ga0316593_10004373 3300032168 Bacteria 3621
128 Ga0373935_0151453 3300035692 Bacteria 1574
129 Ga0373927_0003137 3300035695 Bacteria 11939
130 Ga0373927_0027949 3300035695 Bacteria 3681
131 Ga0373933_0489589 3300035724 Bacteria 805
132 Ga0373925_0141396 3300037068 Bacteria 1884
133 Ga0373925_0197107 3300037068 Bacteria 1600
134 Ga0395899_0047775 3300037312 Unclassified 3186
135 Ga0395900_0267854 3300037418 Unclassified 1704
136 Ga0395898_0001330 3300037466 Bacteria 35820
137 Ga0395905_0353878 3300037471 Bacteria 1361
138 Ga0395905_0496041 3300037471 Bacteria 1121
139 Ga0436364_0398794 3300037853 Bacteria 4560
140 Ga0436364_0678311 3300037853 Bacteria 11209
141 Ga0436364_0802646 3300037853 Bacteria 1764
142 Ga0436364_0924337 3300037853 Bacteria 54634
143 Ga0436364_0997161 3300037853 Bacteria 3204
144 Ga0436364_1060243 3300037853 Bacteria 14979
145 Ga0436364_1099922 3300037853 Bacteria 4555
146 Ga0436364_1298937 3300037853 Bacteria 123533
147 Ga0436364_1307326 3300037853 Bacteria 5636
148 Ga0436364_1530676 3300037853 Bacteria 1267
149 Ga0436365_0244256 3300039437 Bacteria 13856
150 Ga0436365_0938525 3300039437 Unclassified 1819
151 Ga0436365_1306190 3300039437 Bacteria 5374
152 Ga0436365_1598040 3300039437 Unclassified 884
153 Ga0436361_1020706 3300039447 Bacteria 66534
154 Ga0436363_0285464 3300039450 Bacteria 979
155 Ga0436363_1270133 3300039450 Bacteria 2146
156 Ga0436362_0789678 3300039453 Unclassified 1134
157 Ga0436362_0981967 3300039453 Bacteria 6085
158 Ga0436362_1056036 3300039453 Bacteria 1335
159 Ga0451797_1536272 3300041453 Bacteria 2005
160 Ga0451837_0110603 3300041494 Bacteria 1102
161 Ga0451843_1132984 3300041509 Bacteria 1511
162 Ga0466958_0036957 3300045836 Unclassified 2925
163 Ga0495592_0018534 3300046454 Bacteria 5295
164 Ga0495651_0177197 3300046462 Bacteria 1512
165 Ga0495580_0020585 3300046472 Bacteria 4880
166 Ga0495582_0015465 3300046473 Bacteria 4192
167 Ga0495662_0010918 3300046476 Bacteria 4443
168 Ga0495664_0015449 3300046477 Bacteria 4340
169 Ga0495628_0037493 3300046516 Bacteria 3886
170 Ga0495630_0051567 3300046517 Unclassified 3079
171 Ga0495652_0007478 3300046529 Bacteria 10070
172 Ga0495652_0028994 3300046529 Bacteria 4862
173 Ga0495665_0123177 3300046531 Bacteria 1358
174 Ga0495665_0255317 3300046531 Unclassified 902
175 Ga0495640_0012842 3300046533 Bacteria 6390
176 Ga0495586_0142647 3300046535 Bacteria 1345
177 Ga0495587_0003268 3300046536 Bacteria 10824
178 Ga0495587_0090625 3300046536 Bacteria 1766
179 Ga0495645_0008210 3300046543 Bacteria 7281
180 Ga0495667_0036893 3300046559 Bacteria 3259
181 Ga0495634_0053618 3300046642 Bacteria 2701
182 Ga0495599_0005158 3300046678 Bacteria 7788
183 Ga0495599_0009654 3300046678 Bacteria 5908
184 Ga0495623_0066489 3300046679 Bacteria 2252
185 Ga0495646_0049956 3300046680 Bacteria 2537
186 Ga0495613_0027314 3300046689 Unclassified 4247
187 Ga0495600_0046713 3300046809 Bacteria 2824
188 Ga0495604_0310550 3300047317 Bacteria 1056
189 Ga0495636_0022121 3300047318 Bacteria 2569
190 Ga0495674_0102974 3300047319 Bacteria 2427
191 Ga0495684_0132472 3300047471 Unclassified 1871
192 Ga0495684_0240460 3300047471 Bacteria 1321
193 Ga0496104_0212778 3300048907 Bacteria 1845
194 Ga0496112_0019409 3300048915 Bacteria 6417
195 Ga0496115_0016059 3300048918 Bacteria 5694
196 Ga0496115_0468699 3300048918 Bacteria 1015
197 Ga0496121_0116551 3300048924 Bacteria 2026
198 Ga0501031_0213318 3300049568 Bacteria 1258
199 Ga0501032_0003391 3300049569 Bacteria 12207
200 Ga0501034_0000814 3300049571 Bacteria 46426
201 Ga0501034_0029844 3300049571 Bacteria 5542
202 Ga0501034_0039643 3300049571 Bacteria 4771
203 Ga0501034_0114591 3300049571 Bacteria 2684
204 Ga0501038_0021947 3300049574 Bacteria 5726
205 Ga0501046_0317829 3300049580 Bacteria 1135
206 Ga0501070_0043311 3300049586 Bacteria 3746
207 Ga0501070_0535454 3300049586 Bacteria 939
208 Ga0501071_0110731 3300049587 Bacteria 2029
209 Ga0501071_0192263 3300049587 Bacteria 1531
210 Ga0501072_0374759 3300049588 Bacteria 1129
211 Ga0501074_0139900 3300049590 Bacteria 1732
212 Ga0501074_0151172 3300049590 Bacteria 1660
213 Ga0501075_0237771 3300049591 Bacteria 1388
214 Ga0501079_0064444 3300049741 Bacteria 2827
215 Ga0501080_0368139 3300049742 Bacteria 1296
216 Ga0501035_0115347 3300049822 Bacteria 2351
217 Ga0501045_0253201 3300049824 Bacteria 1311
218 nmdc:mga06r32_22685_c1 3300050510 Bacteria 5805
219 nmdc:mga08x19_5067_c1 3300050514 Bacteria 7793
220 Ga0500559_0022287 3300053136 Bacteria 2686
221 Ga0501084_0110061 3300054114 Bacteria 2315
222 Ga0530510_0031540 3300061734 Bacteria 3810
223 Ga0453684_0421062
224 JGI24744J21845_10001163
225 JGI24033J26618_1002698
226 Ga0058862_12679783
227 Ga0070658_10069712
228 Ga0070683_100011214
229 Ga0070683_100089415
230 Ga0070680_100006714
231 Ga0070682_100540228
232 Ga0070660_100041023
233 Ga0070660_100431590
234 Ga0070689_100463044
235 Ga0070691_10001535
236 Ga0070661_100087174
237 Ga0070692_10291176
238 Ga0070659_100132551
239 Ga0070709_10146382
240 Ga0070709_10578040
241 Ga0070714_100009180
242 Ga0070714_100101193
243 Ga0070714_100807316
244 Ga0070711_100052203
245 Ga0070711_100140726
246 Ga0070678_100270407
247 Ga0070662_100467661
248 Ga0070662_100549801
249 Ga0070681_10022454
250 Ga0070681_10186980
251 Ga0070681_10523938
252 Ga0070706_100085035
253 Ga0070707_100005705
254 Ga0070698_100004732
255 Ga0070698_100324688
256 Ga0070698_100945638
257 Ga0070679_100020513
258 Ga0070679_100111673
259 Ga0070684_100000533
260 Ga0070697_100142108
261 Ga0070697_100153189
262 Ga0068855_100062393
263 Ga0070664_100273225
264 Ga0068857_100011683
265 Ga0068857_100013077
266 Ga0068856_100008551
267 Ga0068856_100025189
268 Ga0068856_100063908
269 Ga0068862_100345891
270 Ga0070717_10002300
271 Ga0070717_10010038
272 Ga0070717_10016754
273 Ga0075362_10096654
274 Ga0097621_100093804
275 Ga0068871_100090668
276 Ga0075431_100005024
277 Ga0075436_100002381
278 Ga0075436_100482002
279 Ga0105240_10027809
280 Ga0105245_10196894
281 Ga0105241_10015997
282 Ga0105241_10057659
283 Ga0105248_10082592
284 Ga0105248_10533647
285 Ga0105237_10014554
286 Ga0105238_10016924
287 Ga0105239_10011644
288 Ga0105239_10725779
289 Ga0157373_10016270
290 Ga0157371_10286708
291 Ga0157370_10000243
292 Ga0157370_10039844
293 Ga0157370_10048944
294 Ga0157370_10070885
295 Ga0157369_10012437
296 Ga0157369_10019437
297 Ga0157369_10344978
298 Ga0157374_10016689
299 Ga0157374_10073937
300 Ga0157374_10118992
301 Ga0157374_10901213
302 Ga0157378_10773363
303 Ga0157372_10011034
304 Ga0157375_10313400
305 Ga0163163_10080054
306 Ga0157379_10009047
307 Ga0213876_10007510
308 Ga0213875_10000349
309 Ga0213875_10000770
310 Ga0213875_10001516
311 Ga0213875_10006432
312 Ga0213875_10114627
313 Ga0207699_10233230
314 Ga0207705_10077189
315 Ga0207654_10172698
316 Ga0207707_10011300
317 Ga0207695_10006827
318 Ga0207660_10018133
319 Ga0207657_10052358
320 Ga0207657_10390730
321 Ga0207652_10005925
322 Ga0207652_10115901
323 Ga0207652_10215604
324 Ga0207646_10001243
325 Ga0207646_10723367
326 Ga0207694_10008510
327 Ga0207687_10299717
328 Ga0207690_10017527
329 Ga0207706_10484455
330 Ga0207706_10543219
331 Ga0207711_10075348
332 Ga0207711_10371773
333 Ga0207661_10007646
334 Ga0207679_10060126
335 Ga0207679_10171001
336 Ga0207667_10012787
337 Ga0207667_10174233
338 Ga0207639_10032187
339 Ga0207639_10696093
340 Ga0207702_10009063
341 Ga0207702_10043123
342 Ga0207676_10165809
343 Ga0207674_10007292
344 Ga0207674_10011636
345 Ga0207698_10022693
346 Ga0265316_10022616
347 Ga0307509_10149566
348 Ga0307412_10162581
349 Ga0316593_10004373
350 Ga0373935_0151453
351 Ga0373927_0003137
352 Ga0373927_0027949
353 Ga0373933_0489589
354 Ga0373925_0141396
355 Ga0373925_0197107
356 Ga0395899_0047775
357 Ga0395900_0267854
358 Ga0395898_0001330
359 Ga0395905_0353878
360 Ga0395905_0496041
361 Ga0436364_0398794
362 Ga0436364_0678311
363 Ga0436364_0802646
364 Ga0436364_0924337
365 Ga0436364_0997161
366 Ga0436364_1060243
367 Ga0436364_1099922
368 Ga0436364_1298937
369 Ga0436364_1307326
370 Ga0436364_1530676
371 Ga0436365_0244256
372 Ga0436365_0938525
373 Ga0436365_1306190
374 Ga0436365_1598040
375 Ga0436361_1020706
376 Ga0436363_0285464
377 Ga0436363_1270133
378 Ga0436362_0789678
379 Ga0436362_0981967
380 Ga0436362_1056036
381 Ga0451797_1536272
382 Ga0451837_0110603
383 Ga0451843_1132984
384 Ga0466958_0036957
385 Ga0495592_0018534
386 Ga0495651_0177197
387 Ga0495580_0020585
388 Ga0495582_0015465
389 Ga0495662_0010918
390 Ga0495664_0015449
391 Ga0495628_0037493
392 Ga0495630_0051567
393 Ga0495652_0007478
394 Ga0495652_0028994
395 Ga0495665_0123177
396 Ga0495665_0255317
397 Ga0495640_0012842
398 Ga0495586_0142647
399 Ga0495587_0003268
400 Ga0495587_0090625
401 Ga0495645_0008210
402 Ga0495667_0036893
403 Ga0495634_0053618
404 Ga0495599_0005158
405 Ga0495599_0009654
406 Ga0495623_0066489
407 Ga0495646_0049956
408 Ga0495613_0027314
409 Ga0495600_0046713
410 Ga0495604_0310550
411 Ga0495636_0022121
412 Ga0495674_0102974
413 Ga0495684_0132472
414 Ga0495684_0240460
415 Ga0496104_0212778
416 Ga0496112_0019409
417 Ga0496115_0016059
418 Ga0496115_0468699
419 Ga0496121_0116551
420 Ga0501031_0213318
421 Ga0501032_0003391
422 Ga0501034_0000814
423 Ga0501034_0029844
424 Ga0501034_0039643
425 Ga0501034_0114591
426 Ga0501038_0021947
427 Ga0501046_0317829
428 Ga0501070_0043311
429 Ga0501070_0535454
430 Ga0501071_0110731
431 Ga0501071_0192263
432 Ga0501072_0374759
433 Ga0501074_0139900
434 Ga0501074_0151172
435 Ga0501075_0237771
436 Ga0501079_0064444
437 Ga0501080_0368139
438 Ga0501035_0115347
439 Ga0501045_0253201
440 nmdc:mga06r32_22685_c1
441 nmdc:mga08x19_5067_c1
442 Ga0500559_0022287
443 Ga0501084_0110061
444 Ga0530510_0031540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

22

247

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8byh-assembly1.cif.gz_B crystal structure of trmd domain from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9497 2 222
8b1n-assembly1.cif.gz_A crystal structure of trmd-tm1570 from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9457 2 222
4yvg-assembly1.cif.gz_A crystal structure of h. influenzae trmd in complex with adomet 0.9445 1 222
4h3y-assembly1.cif.gz_B crystal structure of an asymmetric dimer of a trna (guanine-(n(1)-)-methyltransferase from burkholderia phymatum bound to s-adenosyl homocystein in one half-site 0.942 1 222
4ypx-assembly1.cif.gz_A-2 crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds 0.9413 1 222
ID Description Score Start End Superfamily
3quvB02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9992 173 222 1.10.1270.20
4yq2A02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9894 173 222 1.10.1270.20
1uajA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9887 173 222 1.10.1270.20
5zhlA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.986 173 221 1.10.1270.20
5zhkA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9852 173 221 1.10.1270.20
ID Description Score Start End GO Terms
AF-A0A368B863-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9855 1 154 GO:0002939
GO:0005829
GO:0052906
AF-A6DH16-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9835 18 222 GO:0002939
GO:0005829
GO:0052906
AF-A0A3C1PWL9-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9821 48 223 GO:0002939
GO:0005829
GO:0052906
AF-A0A2G4I303-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9816 1 187 GO:0002939
GO:0005829
GO:0052906
AF-A0A1T4XJA3-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9811 1 221 GO:0002939
GO:0005829
GO:0052906

Map