F334542

General Info

Members Datasets Scaffolds Average Seq Length
222 158 444 238

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10188110|Ga0207649_101881102
Length 232
Sequence VRLRLTIEYDGTPFRGWAAQPGLPTVEASLRAALAATFASVDRLAVAGRTDTGVHALGNVVSVDVDGGPALNTRLPDEISVVAVEPADPGFHARHSARSRSYRYRILTRSTPSPFERRRSWWISRRLDLEQLEAAAALLPGEHDFRAFTPTETQHRVFVRTVQSAEWIRRGDHVDFEITADSYLRHMVRTLVGTMLDGIDLAPLLAGAARADAGQTAPPWGLYLVAVAYSGG

Samples

Sample ID Description Type Environment
1 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 7.21
Rhizosphere 90.99
Stem 0
Stem Tuber 0
Unclassified 6.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207649_10188110 3300025920 Bacteria 1450
2 Ga0070682_100092964 3300005337 Bacteria 1977
3 Ga0070689_100302531 3300005340 Bacteria 1332
4 Ga0070674_100109038 3300005356 Bacteria 2030
5 Ga0070709_10202297 3300005434 Bacteria 1407
6 Ga0070714_100172718 3300005435 Bacteria 1962
7 Ga0070714_100476994 3300005435 Bacteria 1187
8 Ga0070714_100770287 3300005435 Bacteria 931
9 Ga0070713_100127135 3300005436 Bacteria 2243
10 Ga0070713_100645241 3300005436 Bacteria 1008
11 Ga0070708_100111458 3300005445 Bacteria 2515
12 Ga0070708_100412528 3300005445 Bacteria 1274
13 Ga0070678_100521212 3300005456 Bacteria 1051
14 Ga0070706_100179484 3300005467 Bacteria 1976
15 Ga0070707_100109868 3300005468 Bacteria 2674
16 Ga0070698_100140288 3300005471 Bacteria 2368
17 Ga0070698_100191949 3300005471 Bacteria 1980
18 Ga0070698_100228262 3300005471 Bacteria 1795
19 Ga0068857_100033943 3300005577 Bacteria 4513
20 Ga0070702_100359197 3300005615 Bacteria 1029
21 Ga0068863_100357238 3300005841 Bacteria 1424
22 Ga0081455_10004083 3300005937 Bacteria 16529
23 Ga0081538_10000214 3300005981 Bacteria 64766
24 Ga0081540_1016605 3300005983 Bacteria 4597
25 Ga0081539_10000068 3300005985 Bacteria 240998
26 Ga0070717_10190803 3300006028 Bacteria 1790
27 Ga0075365_10009834 3300006038 Bacteria 5531
28 Ga0075432_10042893 3300006058 Unclassified 1584
29 Ga0075362_10011948 3300006177 Bacteria 3433
30 Ga0075428_100239321 3300006844 Bacteria 1958
31 Ga0075430_100027639 3300006846 Bacteria 4819
32 Ga0075434_100110909 3300006871 Bacteria 2754
33 Ga0075435_100495633 3300007076 Bacteria 1056
34 Ga0105240_10341335 3300009093 Bacteria 1701
35 Ga0105240_11115619 3300009093 Unclassified 839
36 Ga0111539_10016885 3300009094 Bacteria 9039
37 Ga0111539_10045647 3300009094 Bacteria 5245
38 Ga0105245_10105533 3300009098 Bacteria 2613
39 Ga0105245_10171557 3300009098 Bacteria 2066
40 Ga0114129_10360004 3300009147 Bacteria 1925
41 Ga0114129_10507172 3300009147 Bacteria 1575
42 Ga0114129_10573589 3300009147 Bacteria 1465
43 Ga0114129_10640082 3300009147 Bacteria 1373
44 Ga0105239_10304945 3300010375 Bacteria 1794
45 Ga0105246_10057834 3300011119 Bacteria 2685
46 Ga0157378_10093241 3300013297 Bacteria 2741
47 Ga0163162_10178024 3300013306 Bacteria 2252
48 Ga0157375_10384830 3300013308 Bacteria 1569
49 Ga0163163_10288967 3300014325 Bacteria 1692
50 Ga0157377_10022765 3300014745 Bacteria 3313
51 Ga0157376_10262786 3300014969 Bacteria 1618
52 Ga0207656_10129870 3300025321 Bacteria 1180
53 Ga0207699_10041105 3300025906 Bacteria 2668
54 Ga0207684_10051078 3300025910 Bacteria 3507
55 Ga0207662_10332284 3300025918 Bacteria 1017
56 Ga0207646_10018767 3300025922 Bacteria 6445
57 Ga0207687_10146351 3300025927 Bacteria 1798
58 Ga0207644_10725962 3300025931 Bacteria 829
59 Ga0207690_10472585 3300025932 Bacteria 1011
60 Ga0207706_10021838 3300025933 Bacteria 5745
61 Ga0207706_10037879 3300025933 Bacteria 4279
62 Ga0207669_10399729 3300025937 Bacteria 1076
63 Ga0207691_10068999 3300025940 Bacteria 3194
64 Ga0207711_10221583 3300025941 Bacteria 1730
65 Ga0207667_10345634 3300025949 Bacteria 1517
66 Ga0207708_10024562 3300026075 Bacteria 4559
67 Ga0207674_10008618 3300026116 Bacteria 11757
68 Ga0207428_10004795 3300027907 Bacteria 12776
69 Ga0207428_10109064 3300027907 Bacteria 2132
70 Ga0265326_10011425 3300028558 Bacteria 2617
71 Ga0265319_1002691 3300028563 Bacteria 9529
72 Ga0265334_10003179 3300028573 Bacteria 7495
73 Ga0265318_10001869 3300028577 Bacteria 11847
74 Ga0265338_10005459 3300028800 Bacteria 16591
75 Ga0265338_10059664 3300028800 Bacteria 3359
76 Ga0265324_10009303 3300029957 Bacteria 3844
77 Ga0265330_10000419 3300031235 Bacteria 28979
78 Ga0265332_10001895 3300031238 Bacteria 11088
79 Ga0265328_10000420 3300031239 Bacteria 19879
80 Ga0265325_10002849 3300031241 Bacteria 11534
81 Ga0265325_10077622 3300031241 Bacteria 1655
82 Ga0265329_10013746 3300031242 Bacteria 2877
83 Ga0265340_10004259 3300031247 Bacteria 8022
84 Ga0265339_10023899 3300031249 Bacteria 3527
85 Ga0265331_10036603 3300031250 Bacteria 2408
86 Ga0265331_10058402 3300031250 Bacteria 1827
87 Ga0265327_10003261 3300031251 Bacteria 15722
88 Ga0265327_10008758 3300031251 Bacteria 7471
89 Ga0265316_10003535 3300031344 Bacteria 15772
90 Ga0265316_10499281 3300031344 Bacteria 869
91 Ga0265313_10006718 3300031595 Bacteria 8051
92 Ga0265313_10010258 3300031595 Bacteria 5957
93 Ga0265314_10003213 3300031711 Bacteria 15987
94 Ga0265342_10004040 3300031712 Bacteria 11711
95 Ga0307416_100209980 3300032002 Bacteria 1856
96 Ga0373956_0115587 3300035119 Bacteria 1251
97 Ga0373943_0038909 3300035170 Bacteria 2289
98 Ga0373935_0259085 3300035692 Bacteria 1219
99 Ga0373933_0055382 3300035724 Bacteria 2379
100 Ga0395899_0033344 3300037312 Bacteria 3867
101 Ga0395899_0034328 3300037312 Bacteria 3808
102 Ga0395899_0086301 3300037312 Bacteria 2280
103 Ga0395899_0109082 3300037312 Bacteria 1992
104 Ga0395900_0022532 3300037418 Bacteria 6444
105 Ga0395900_0031077 3300037418 Bacteria 5486
106 Ga0395900_0087065 3300037418 Bacteria 3211
107 Ga0395898_0031286 3300037466 Bacteria 5319
108 Ga0395898_0061494 3300037466 Bacteria 3648
109 Ga0395898_0768628 3300037466 Bacteria 904
110 Ga0395905_0031836 3300037471 Bacteria 4963
111 Ga0395905_0304855 3300037471 Bacteria 1480
112 Ga0395905_0503291 3300037471 Bacteria 1112
113 Ga0395905_0618293 3300037471 Bacteria 985
114 Ga0395901_0002345 3300038443 Bacteria 19270
115 Ga0395901_0036449 3300038443 Bacteria 5084
116 Ga0395901_0098774 3300038443 Bacteria 3061
117 Ga0395901_0099661 3300038443 Unclassified 3047
118 Ga0395901_0134841 3300038443 Bacteria 2595
119 Ga0395901_0316143 3300038443 Bacteria 1616
120 Ga0395901_0322828 3300038443 Bacteria 1597
121 Ga0395901_0384559 3300038443 Bacteria 1444
122 Ga0395901_0763770 3300038443 Bacteria 959
123 Ga0436360_0520811 3300039438 Bacteria 11295
124 Ga0451853_1693471 3300041512 Bacteria 2572
125 Ga0439448_0003174 3300042005 Bacteria 4533
126 Ga0439448_0083224 3300042005 Bacteria 1076
127 Ga0466966_0063874 3300044684 Bacteria 2319
128 Ga0466966_0286687 3300044684 Bacteria 990
129 Ga0466961_0104052 3300044693 Bacteria 1788
130 Ga0466963_0008353 3300044694 Bacteria 6202
131 Ga0466963_0008872 3300044694 Bacteria 6033
132 Ga0466963_0397335 3300044694 Unclassified 972
133 Ga0466971_0022225 3300044719 Bacteria 2825
134 Ga0466968_0302856 3300044735 Bacteria 769
135 Ga0466957_0014041 3300044842 Bacteria 4659
136 Ga0466959_0027662 3300045049 Bacteria 4205
137 Ga0451576_0032709 3300045051 Bacteria 5533
138 Ga0451576_0255934 3300045051 Bacteria 1830
139 Ga0466958_0013256 3300045836 Bacteria 4691
140 Ga0466967_0004375 3300045976 Bacteria 9512
141 Ga0466967_0020902 3300045976 Bacteria 5303
142 Ga0466967_0029932 3300045976 Bacteria 4563
143 Ga0466967_0240100 3300045976 Bacteria 1728
144 Ga0466967_0781707 3300045976 Bacteria 948
145 Ga0495590_0130067 3300046457 Bacteria 905
146 Ga0495629_0403972 3300046459 Bacteria 928
147 Ga0495653_0026322 3300046463 Bacteria 4666
148 Ga0495584_0030171 3300046491 Bacteria 2747
149 Ga0495583_0077591 3300046506 Unclassified 1449
150 Ga0495608_0040218 3300046511 Bacteria 3133
151 Ga0495630_0003816 3300046517 Bacteria 10514
152 Ga0495631_0047495 3300046518 Unclassified 1885
153 Ga0495632_0127705 3300046519 Unclassified 1185
154 Ga0495637_0020249 3300046520 Bacteria 3063
155 Ga0495609_0074960 3300046538 Bacteria 1483
156 Ga0495621_0107448 3300046539 Unclassified 1067
157 Ga0495667_0038099 3300046559 Bacteria 3202
158 Ga0495668_0162415 3300046616 Unclassified 1224
159 Ga0495635_0404600 3300046663 Bacteria 906
160 Ga0495613_0090439 3300046689 Bacteria 2217
161 Ga0495613_0178652 3300046689 Bacteria 1504
162 Ga0495613_0213870 3300046689 Bacteria 1355
163 Ga0495671_0090821 3300046692 Unclassified 1495
164 Ga0495589_0105827 3300046794 Unclassified 1359
165 Ga0495660_0088716 3300046810 Bacteria 1611
166 Ga0495636_0027037 3300047318 Bacteria 2337
167 Ga0495680_0021203 3300047322 Bacteria 5444
168 Ga0495683_0051882 3300047323 Bacteria 2049
169 Ga0495677_0107011 3300047445 Unclassified 1061
170 Ga0495684_0030774 3300047471 Bacteria 4121
171 Ga0496100_0333771 3300048903 Bacteria 1142
172 Ga0496100_0420434 3300048903 Bacteria 1021
173 Ga0496101_0005743 3300048904 Bacteria 7927
174 Ga0496102_0053897 3300048905 Bacteria 3666
175 Ga0496104_0515822 3300048907 Bacteria 1106
176 Ga0496105_0001009 3300048908 Bacteria 19456
177 Ga0496105_0059383 3300048908 Bacteria 3156
178 Ga0496106_0002147 3300048909 Bacteria 14732
179 Ga0496107_0238463 3300048910 Bacteria 1353
180 Ga0496108_0629831 3300048911 Bacteria 933
181 Ga0496109_0001990 3300048912 Bacteria 16940
182 Ga0496110_0055427 3300048913 Bacteria 3488
183 Ga0496111_0061817 3300048914 Bacteria 2715
184 Ga0496112_0130994 3300048915 Bacteria 2479
185 Ga0496112_0262093 3300048915 Bacteria 1678
186 Ga0496115_0180289 3300048918 Bacteria 1746
187 Ga0501031_0303087 3300049568 Bacteria 1035
188 Ga0501036_0286914 3300049572 Bacteria 1377
189 Ga0501039_0140610 3300049575 Bacteria 1896
190 Ga0501040_0100453 3300049576 Bacteria 2017
191 Ga0501040_0201819 3300049576 Bacteria 1412
192 Ga0501041_0101484 3300049577 Bacteria 1781
193 Ga0501042_0060167 3300049578 Bacteria 2713
194 Ga0501042_0257189 3300049578 Bacteria 1260
195 Ga0501046_0327818 3300049580 Bacteria 1115
196 Ga0501067_0155886 3300049583 Bacteria 1272
197 Ga0501071_0078733 3300049587 Bacteria 2409
198 Ga0501071_0215247 3300049587 Bacteria 1445
199 Ga0501072_0056431 3300049588 Bacteria 3095
200 Ga0501075_0117987 3300049591 Bacteria 2018
201 Ga0501075_0267084 3300049591 Bacteria 1304
202 Ga0501076_0096905 3300049592 Bacteria 2376
203 Ga0501076_0142197 3300049592 Bacteria 1950
204 Ga0501076_0479028 3300049592 Bacteria 1025
205 Ga0501079_0569024 3300049741 Bacteria 891
206 Ga0501081_0281297 3300049743 Unclassified 1218
207 Ga0501081_0289494 3300049743 Bacteria 1200
208 nmdc:mga0yw44_8364_c1 3300050492 Bacteria 5150
209 nmdc:mga05p37_1115756_c1 3300050507 Unclassified 824
210 nmdc:mga05p37_189678_c1 3300050507 Bacteria 2497
211 nmdc:mga05p37_56852_c1 3300050507 Bacteria 4817
212 nmdc:mga09592_6943_c1 3300050508 Bacteria 9206
213 nmdc:mga08y16_989693_c1 3300050511 Bacteria 822
214 nmdc:mga0n895_147591_c1 3300050512 Bacteria 2381
215 nmdc:mga0n895_193950_c1 3300050512 Bacteria 2062
216 nmdc:mga0n895_779233_c1 3300050512 Bacteria 948
217 Ga0495655_0034018 3300053083 Unclassified 1258
218 Ga0495619_0134191 3300053085 Bacteria 1702
219 Ga0501084_0084222 3300054114 Bacteria 2669
220 Ga0466962_0029398 3300061719 Bacteria 2631
221 Ga0530510_0075841 3300061734 Bacteria 2442
222 Ga0530510_0197269 3300061734 Bacteria 1495
223 Ga0207649_10188110
224 Ga0070682_100092964
225 Ga0070689_100302531
226 Ga0070674_100109038
227 Ga0070709_10202297
228 Ga0070714_100172718
229 Ga0070714_100476994
230 Ga0070714_100770287
231 Ga0070713_100127135
232 Ga0070713_100645241
233 Ga0070708_100111458
234 Ga0070708_100412528
235 Ga0070678_100521212
236 Ga0070706_100179484
237 Ga0070707_100109868
238 Ga0070698_100140288
239 Ga0070698_100191949
240 Ga0070698_100228262
241 Ga0068857_100033943
242 Ga0070702_100359197
243 Ga0068863_100357238
244 Ga0081455_10004083
245 Ga0081538_10000214
246 Ga0081540_1016605
247 Ga0081539_10000068
248 Ga0070717_10190803
249 Ga0075365_10009834
250 Ga0075432_10042893
251 Ga0075362_10011948
252 Ga0075428_100239321
253 Ga0075430_100027639
254 Ga0075434_100110909
255 Ga0075435_100495633
256 Ga0105240_10341335
257 Ga0105240_11115619
258 Ga0111539_10016885
259 Ga0111539_10045647
260 Ga0105245_10105533
261 Ga0105245_10171557
262 Ga0114129_10360004
263 Ga0114129_10507172
264 Ga0114129_10573589
265 Ga0114129_10640082
266 Ga0105239_10304945
267 Ga0105246_10057834
268 Ga0157378_10093241
269 Ga0163162_10178024
270 Ga0157375_10384830
271 Ga0163163_10288967
272 Ga0157377_10022765
273 Ga0157376_10262786
274 Ga0207656_10129870
275 Ga0207699_10041105
276 Ga0207684_10051078
277 Ga0207662_10332284
278 Ga0207646_10018767
279 Ga0207687_10146351
280 Ga0207644_10725962
281 Ga0207690_10472585
282 Ga0207706_10021838
283 Ga0207706_10037879
284 Ga0207669_10399729
285 Ga0207691_10068999
286 Ga0207711_10221583
287 Ga0207667_10345634
288 Ga0207708_10024562
289 Ga0207674_10008618
290 Ga0207428_10004795
291 Ga0207428_10109064
292 Ga0265326_10011425
293 Ga0265319_1002691
294 Ga0265334_10003179
295 Ga0265318_10001869
296 Ga0265338_10005459
297 Ga0265338_10059664
298 Ga0265324_10009303
299 Ga0265330_10000419
300 Ga0265332_10001895
301 Ga0265328_10000420
302 Ga0265325_10002849
303 Ga0265325_10077622
304 Ga0265329_10013746
305 Ga0265340_10004259
306 Ga0265339_10023899
307 Ga0265331_10036603
308 Ga0265331_10058402
309 Ga0265327_10003261
310 Ga0265327_10008758
311 Ga0265316_10003535
312 Ga0265316_10499281
313 Ga0265313_10006718
314 Ga0265313_10010258
315 Ga0265314_10003213
316 Ga0265342_10004040
317 Ga0307416_100209980
318 Ga0373956_0115587
319 Ga0373943_0038909
320 Ga0373935_0259085
321 Ga0373933_0055382
322 Ga0395899_0033344
323 Ga0395899_0034328
324 Ga0395899_0086301
325 Ga0395899_0109082
326 Ga0395900_0022532
327 Ga0395900_0031077
328 Ga0395900_0087065
329 Ga0395898_0031286
330 Ga0395898_0061494
331 Ga0395898_0768628
332 Ga0395905_0031836
333 Ga0395905_0304855
334 Ga0395905_0503291
335 Ga0395905_0618293
336 Ga0395901_0002345
337 Ga0395901_0036449
338 Ga0395901_0098774
339 Ga0395901_0099661
340 Ga0395901_0134841
341 Ga0395901_0316143
342 Ga0395901_0322828
343 Ga0395901_0384559
344 Ga0395901_0763770
345 Ga0436360_0520811
346 Ga0451853_1693471
347 Ga0439448_0003174
348 Ga0439448_0083224
349 Ga0466966_0063874
350 Ga0466966_0286687
351 Ga0466961_0104052
352 Ga0466963_0008353
353 Ga0466963_0008872
354 Ga0466963_0397335
355 Ga0466971_0022225
356 Ga0466968_0302856
357 Ga0466957_0014041
358 Ga0466959_0027662
359 Ga0451576_0032709
360 Ga0451576_0255934
361 Ga0466958_0013256
362 Ga0466967_0004375
363 Ga0466967_0020902
364 Ga0466967_0029932
365 Ga0466967_0240100
366 Ga0466967_0781707
367 Ga0495590_0130067
368 Ga0495629_0403972
369 Ga0495653_0026322
370 Ga0495584_0030171
371 Ga0495583_0077591
372 Ga0495608_0040218
373 Ga0495630_0003816
374 Ga0495631_0047495
375 Ga0495632_0127705
376 Ga0495637_0020249
377 Ga0495609_0074960
378 Ga0495621_0107448
379 Ga0495667_0038099
380 Ga0495668_0162415
381 Ga0495635_0404600
382 Ga0495613_0090439
383 Ga0495613_0178652
384 Ga0495613_0213870
385 Ga0495671_0090821
386 Ga0495589_0105827
387 Ga0495660_0088716
388 Ga0495636_0027037
389 Ga0495680_0021203
390 Ga0495683_0051882
391 Ga0495677_0107011
392 Ga0495684_0030774
393 Ga0496100_0333771
394 Ga0496100_0420434
395 Ga0496101_0005743
396 Ga0496102_0053897
397 Ga0496104_0515822
398 Ga0496105_0001009
399 Ga0496105_0059383
400 Ga0496106_0002147
401 Ga0496107_0238463
402 Ga0496108_0629831
403 Ga0496109_0001990
404 Ga0496110_0055427
405 Ga0496111_0061817
406 Ga0496112_0130994
407 Ga0496112_0262093
408 Ga0496115_0180289
409 Ga0501031_0303087
410 Ga0501036_0286914
411 Ga0501039_0140610
412 Ga0501040_0100453
413 Ga0501040_0201819
414 Ga0501041_0101484
415 Ga0501042_0060167
416 Ga0501042_0257189
417 Ga0501046_0327818
418 Ga0501067_0155886
419 Ga0501071_0078733
420 Ga0501071_0215247
421 Ga0501072_0056431
422 Ga0501075_0117987
423 Ga0501075_0267084
424 Ga0501076_0096905
425 Ga0501076_0142197
426 Ga0501076_0479028
427 Ga0501079_0569024
428 Ga0501081_0281297
429 Ga0501081_0289494
430 nmdc:mga0yw44_8364_c1
431 nmdc:mga05p37_1115756_c1
432 nmdc:mga05p37_189678_c1
433 nmdc:mga05p37_56852_c1
434 nmdc:mga09592_6943_c1
435 nmdc:mga08y16_989693_c1
436 nmdc:mga0n895_147591_c1
437 nmdc:mga0n895_193950_c1
438 nmdc:mga0n895_779233_c1
439 Ga0495655_0034018
440 Ga0495619_0134191
441 Ga0501084_0084222
442 Ga0466962_0029398
443 Ga0530510_0075841
444 Ga0530510_0197269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

135

230

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8397 2 231
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8331 2 231
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.8317 2 231
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8284 2 231
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.825 2 231
ID Description Score Start End Superfamily
af_Q2FW37_106_241_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9601 99 227 3.30.70.660
1vs3B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9302 98 231 3.30.70.660
af_A0A1D6HBJ9_162_299_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9272 97 224 3.30.70.660
af_P9WHP9_140_277_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9101 98 229 3.30.70.660
af_Q2FW37_106_241_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9056 99 227 3.30.70.660
ID Description Score Start End GO Terms
AF-A0A6J4STP9-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9535 68 230 GO:0003723
GO:0016829
GO:0031119
GO:0160147
AF-A0A1Q7P911-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9426 61 230 GO:0003723
GO:0031119
GO:0160147
AF-A0A4Q2WMS0-F1-model_v4 deleted 0.9382 61 230
AF-A0A349PWX9-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9352 56 231 GO:0003723
GO:0031119
GO:0160147
AF-A0A7Y4YIA7-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9315 61 231 GO:0003723
GO:0009982
GO:0031119
GO:0140098

Map