F334378

General Info

Members Datasets Scaffolds Average Seq Length
222 154 178 76

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_11252386|Ga0105240_112523862
Length 86
Sequence MEAEMAKLKLNPIADDKPVKVTLELPASLHRDLSRYAEILGGEAGQSPPDPVRLIVPMLERFIATDRGFAKARHERKAQIAGAKAG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2512875024 Mesorhizobium loti R88b Isolate Nodule
3 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
4 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
5 2643221674 Devosia sp. Root436 Isolate Unclassified
6 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
7 2773857925 Microvirga vignae BR3299 Isolate Unclassified
8 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
9 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
10 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
11 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
12 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
13 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
14 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
15 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
16 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
17 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
18 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
19 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
20 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
21 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
22 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
23 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
24 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
25 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
26 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
27 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
28 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
29 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
30 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
31 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
32 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
33 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
34 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
35 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
36 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
37 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
38 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
39 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
40 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
41 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
42 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
105 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
134 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
135 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
150 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
154 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.18
Metatranscriptomes 0
Isolates 19.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.22
Nodule 15.77
Rhizoplane 2.7
Rhizosphere 57.66
Stem 0
Stem Tuber 0
Unclassified 7.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC89082_b1 2010549000 Bacteria 819
2 JGI24740J21852_10026651 3300001979 Bacteria 1934
3 JGI24740J21852_10082947 3300001979 Bacteria 837
4 JGI24739J22299_10103671 3300001989 Bacteria 857
5 Ga0070658_11211686 3300005327 Bacteria 656
6 Ga0070660_100214554 3300005339 Bacteria 1563
7 Ga0070660_100766808 3300005339 Bacteria 810
8 Ga0070661_100527206 3300005344 Bacteria 948
9 Ga0070663_100271261 3300005455 Bacteria 1349
10 Ga0070665_101854063 3300005548 Bacteria 609
11 Ga0068855_100921470 3300005563 Bacteria 922
12 Ga0068856_100492735 3300005614 Bacteria 1246
13 Ga0068856_100555738 3300005614 Bacteria 1169
14 Ga0068852_100161594 3300005616 Bacteria 2092
15 Ga0068852_101475485 3300005616 Unclassified 702
16 Ga0068852_101530411 3300005616 Bacteria 689
17 Ga0075365_10051282 3300006038 Bacteria 2724
18 Ga0075365_10100064 3300006038 Bacteria 1984
19 Ga0075363_100099269 3300006048 Bacteria 1610
20 Ga0075363_100210806 3300006048 Bacteria 1112
21 Ga0075364_10017921 3300006051 Bacteria 4428
22 Ga0075364_10054130 3300006051 Bacteria 2624
23 Ga0075364_10616296 3300006051 Bacteria 741
24 Ga0075362_10006126 3300006177 Bacteria 4458
25 Ga0075367_10247120 3300006178 Bacteria 1118
26 Ga0075369_10017125 3300006186 Bacteria 2932
27 Ga0075366_10169723 3300006195 Bacteria 1324
28 Ga0075370_10021332 3300006353 Bacteria 3549
29 Ga0105240_10000024 3300009093 Bacteria 375919
30 Ga0105240_11252386 3300009093 Bacteria 784
31 Ga0105245_10209175 3300009098 Bacteria 1877
32 Ga0105241_10972853 3300009174 Bacteria 792
33 Ga0105241_11925555 3300009174 Bacteria 580
34 Ga0105237_10006265 3300009545 Bacteria 13236
35 Ga0105237_10016350 3300009545 Bacteria 7712
36 Ga0105237_10028882 3300009545 Bacteria 5644
37 Ga0105237_10530403 3300009545 Bacteria 1184
38 Ga0105237_11550211 3300009545 Bacteria 669
39 Ga0105238_10797636 3300009551 Bacteria 960
40 Ga0105238_12748732 3300009551 Bacteria 529
41 Ga0105249_11716569 3300009553 Bacteria 700
42 Ga0105239_10009253 3300010375 Bacteria 11138
43 Ga0105239_10104320 3300010375 Bacteria 3139
44 Ga0105239_11898503 3300010375 Bacteria 691
45 Ga0105246_10530290 3300011119 Bacteria 1005
46 Ga0157373_10984468 3300013100 Bacteria 629
47 Ga0157370_10000180 3300013104 Bacteria 79428
48 Ga0157370_10008843 3300013104 Bacteria 10825
49 Ga0157369_10359949 3300013105 Bacteria 1511
50 Ga0157369_11085619 3300013105 Bacteria 818
51 Ga0157374_10087430 3300013296 Bacteria 2967
52 Ga0163162_11981935 3300013306 Bacteria 667
53 Ga0182008_10336731 3300014497 Bacteria 797
54 Ga0183365_10002 3300015684 Bacteria 545891
55 Ga0209147_100397 3300025229 Bacteria 29730
56 Ga0207425_1047523 3300025245 Bacteria 795
57 Ga0209026_1015827 3300025250 Bacteria 1231
58 Ga0209233_1008595 3300025261 Bacteria 3147
59 Ga0209758_1007968 3300025297 Bacteria 7018
60 Ga0207647_10149110 3300025904 Bacteria 1368
61 Ga0207705_10597175 3300025909 Bacteria 858
62 Ga0207654_10893174 3300025911 Bacteria 644
63 Ga0207695_10000036 3300025913 Bacteria 477897
64 Ga0207695_11033336 3300025913 Bacteria 701
65 Ga0207671_10004536 3300025914 Bacteria 13193
66 Ga0207671_10036755 3300025914 Bacteria 3632
67 Ga0207657_10088083 3300025919 Bacteria 2596
68 Ga0207649_10238280 3300025920 Bacteria 1305
69 Ga0207694_10433967 3300025924 Bacteria 1095
70 Ga0207679_10296981 3300025945 Bacteria 1391
71 Ga0207640_10095463 3300025981 Bacteria 2070
72 Ga0207678_10094766 3300026067 Bacteria 2551
73 Ga0207702_10030777 3300026078 Bacteria 4471
74 Ga0207702_10528683 3300026078 Bacteria 1152
75 Ga0207702_10549153 3300026078 Bacteria 1130
76 Ga0207698_10527558 3300026142 Bacteria 1153
77 Ga0307408_100019958 3300031548 Bacteria 4516
78 Ga0307405_10002349 3300031731 Bacteria 8319
79 Ga0307410_10001586 3300031852 Bacteria 10422
80 Ga0307412_10000242 3300031911 Bacteria 35451
81 Ga0316582_0758137 3300036647 Bacteria 666
82 Ga0395900_1598671 3300037418 Bacteria 563
83 Ga0395901_0990461 3300038443 Bacteria 817
84 Ga0451798_0689753 3300041458 Bacteria 573
85 Ga0451807_0458939 3300041486 Bacteria 701
86 Ga0451833_0786665 3300041491 Bacteria 619
87 Ga0439455_0003498 3300042012 Bacteria 3008
88 Ga0439458_0011056 3300042157 Bacteria 2015
89 Ga0495643_0079364 3300046522 Bacteria 1711
90 Ga0495597_0271394 3300046542 Bacteria 662
91 Ga0495633_0000102 3300046558 Bacteria 115655
92 Ga0495633_0396258 3300046558 Bacteria 624
93 Ga0496104_0000035 3300048907 Bacteria 181792
94 Ga0496105_0000029 3300048908 Bacteria 139338
95 Ga0496108_0002093 3300048911 Bacteria 15967
96 Ga0496115_1080775 3300048918 Bacteria 609
97 Ga0496116_0041653 3300048919 Bacteria 3149
98 Ga0496116_0049224 3300048919 Bacteria 2821
99 Ga0496119_0226015 3300048922 Bacteria 955
100 Ga0496122_0214656 3300048925 Bacteria 1110
101 Ga0496123_0313822 3300048926 Bacteria 743
102 Ga0496124_0001965 3300048927 Bacteria 28078
103 Ga0496126_0315535 3300048929 Bacteria 1286
104 Ga0496126_0467191 3300048929 Bacteria 1013
105 Ga0501031_0245536 3300049568 Bacteria 1164
106 Ga0501032_0031965 3300049569 Bacteria 3608
107 Ga0501032_0186130 3300049569 Bacteria 1358
108 Ga0501032_0213431 3300049569 Bacteria 1258
109 Ga0501032_0586135 3300049569 Bacteria 710
110 Ga0501033_0000118 3300049570 Bacteria 75690
111 Ga0501033_0000437 3300049570 Bacteria 39928
112 Ga0501033_0015173 3300049570 Bacteria 5847
113 Ga0501033_0058685 3300049570 Bacteria 2842
114 Ga0501033_0646614 3300049570 Bacteria 723
115 Ga0501033_1056315 3300049570 Bacteria 541
116 Ga0501034_0005140 3300049571 Bacteria 14356
117 Ga0501034_0027352 3300049571 Bacteria 5800
118 Ga0501034_0350441 3300049571 Bacteria 1405
119 Ga0501034_0709746 3300049571 Bacteria 904
120 Ga0501034_0776458 3300049571 Bacteria 852
121 Ga0501034_0935078 3300049571 Bacteria 753
122 Ga0501034_1631951 3300049571 Bacteria 517
123 Ga0501036_0474192 3300049572 Bacteria 1042
124 Ga0501036_0696510 3300049572 Bacteria 840
125 Ga0501036_1095176 3300049572 Bacteria 651
126 Ga0501036_1484565 3300049572 Bacteria 549
127 Ga0501037_0520992 3300049573 Bacteria 805
128 Ga0501038_0182904 3300049574 Bacteria 1690
129 Ga0501038_0927322 3300049574 Bacteria 642
130 Ga0501038_1138203 3300049574 Bacteria 569
131 Ga0501039_0125208 3300049575 Bacteria 2016
132 Ga0501039_1333504 3300049575 Bacteria 553
133 Ga0501040_0713753 3300049576 Bacteria 725
134 Ga0501043_0308622 3300049579 Bacteria 1208
135 Ga0501046_0202671 3300049580 Bacteria 1476
136 Ga0501047_0851119 3300049581 Bacteria 726
137 Ga0501047_0887166 3300049581 Bacteria 705
138 Ga0501047_1102040 3300049581 Bacteria 607
139 Ga0501047_1279676 3300049581 Bacteria 547
140 Ga0501070_1220931 3300049586 Bacteria 576
141 Ga0501223_020916 3300049663 Bacteria 1281
142 Ga0501224_014895 3300049664 Bacteria 1151
143 Ga0501227_027877 3300049665 Bacteria 1339
144 Ga0501249_000553 3300049679 Bacteria 8991
145 Ga0501080_0770528 3300049742 Bacteria 845
146 Ga0501080_0792342 3300049742 Bacteria 832
147 Ga0501083_0159241 3300049744 Bacteria 1477
148 Ga0501035_0001360 3300049822 Bacteria 25163
149 Ga0501035_0061959 3300049822 Bacteria 3328
150 Ga0501035_0093585 3300049822 Bacteria 2644
151 Ga0501035_0122684 3300049822 Bacteria 2270
152 Ga0501035_0160115 3300049822 Bacteria 1949
153 Ga0501035_0249071 3300049822 Bacteria 1509
154 Ga0501035_1072845 3300049822 Bacteria 630
155 Ga0501044_0007018 3300049823 Bacteria 12398
156 Ga0501044_0166105 3300049823 Bacteria 2181
157 Ga0501044_0286638 3300049823 Bacteria 1579
158 Ga0501044_0323170 3300049823 Bacteria 1467
159 nmdc:mga03683_139902_c1 3300050489 Bacteria 1088
160 nmdc:mga03n38_156624_c1 3300050490 Bacteria 1150
161 nmdc:mga03n38_20308_c1 3300050490 Bacteria 2656
162 nmdc:mga00v17_22808_c1 3300050491 Bacteria 3616
163 nmdc:mga00v17_344614_c1 3300050491 Bacteria 969
164 nmdc:mga00v17_3465_c1 3300050491 Bacteria 8168
165 nmdc:mga00v17_874735_c1 3300050491 Bacteria 570
166 nmdc:mga0yw44_234419_c1 3300050492 Bacteria 1219
167 nmdc:mga0yw44_419893_c1 3300050492 Bacteria 905
168 nmdc:mga0yw44_63175_c2 3300050492 Bacteria 1730
169 nmdc:mga0yw44_6579_c1 3300050492 Bacteria 5628
170 nmdc:mga0k408_690485_c1 3300050493 Bacteria 598
171 nmdc:mga06z11_35491_c1 3300050494 Bacteria 2455
172 nmdc:mga07m45_11303_c2 3300050496 Bacteria 3564
173 Ga0500610_0019403 3300053079 Bacteria 3304
174 Ga0500651_0505475 3300053093 Bacteria 666
175 Ga0500642_0136808 3300053130 Bacteria 1148
176 Ga0500559_0002511 3300053136 Bacteria 9429
177 Ga0500616_0000170 3300053153 Bacteria 108126
178 Ga0501084_0249117 3300054114 Bacteria 1500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2512875024 2512963718 70
2 iso_pu_bacteria 2856320880 2856322016 70
3 iso_pu_bacteria 2856356410 2856362031 70
4 iso_pu_bacteria 2871488783 2871491802 70
5 iso_pu_bacteria 2874139085 2874139688 70
6 iso_pu_bacteria 2874168670 2874171275 70
7 iso_pu_bacteria 2878738818 2878739521 70
8 iso_pu_bacteria 2878753008 2878755964 70
9 iso_pu_bacteria 2881161766 2881163647 70
10 iso_pu_bacteria 2882912400 2882912792 70
11 iso_pu_bacteria 2885305155 2885311911 70
12 iso_pu_bacteria 2885334103 2885337628 70
13 iso_pu_bacteria 2888337043 2888341667 70
14 iso_pu_bacteria 2903492973 2903501432 70
15 iso_pu_bacteria 2924776078 2924777045 70
16 iso_pu_bacteria 2937877337 2937880349 70
17 iso_pu_bacteria 2937972304 2937976447 70
18 iso_pu_bacteria 2958034702 2958038611 70
19 iso_pu_bacteria 2958084443 2958087485 70
20 iso_pu_bacteria 2958092219 2958096624 70
21 iso_pu_bacteria 2958144490 2958145282 70
22 iso_pu_bacteria 2961170736 2961174013 70
23 iso_pu_bacteria 2968003550 2968005579 70
24 iso_pu_bacteria 2968016561 2968023788 70
25 iso_pu_bacteria 2968117919 2968120029 70
26 iso_pu_bacteria 2970469710 2970469829 70
27 iso_pu_bacteria 2970503327 2970506603 70
28 iso_pu_bacteria 2977821940 2977825187 70
29 iso_pu_bacteria 2977828996 2977833825 70
30 iso_pu_bacteria 2979808191 2979811249 70
31 iso_pu_bacteria 2996348954 2996355103 70
32 iso_pu_bacteria 3004275668 3004281637 70
33 iso_pu_bacteria 8004374579 8004377554 70
34 iso_pu_bacteria 8004395343 8004396872 70
35 3300009174 Ga0105241_11925555 Ga0105241_119255552 71
36 3300025911 Ga0207654_10893174 Ga0207654_108931742 71
37 iso_pu_bacteria 2582581308 2585281074 71
38 iso_pu_bacteria 2643221623 2644129047 71
39 iso_pu_bacteria 2643221674 2644413969 71
40 iso_pu_bacteria 2738543031 2739352144 71
41 iso_pu_bacteria 2773857925 2774872009 71
42 iso_pu_bacteria 2856342000 2856346064 71
43 iso_pu_bacteria 2882456835 2882460966 71
44 iso_pu_bacteria 2915650412 2915652099 71
45 iso_pu_bacteria 8004395343 8004400524 71
46 3300005614 Ga0068856_100492735 Ga0068856_1004927352 72
47 3300009545 Ga0105237_10028882 Ga0105237_100288829 72
48 3300025245 Ga0207425_1047523 Ga0207425_10475232 72
49 3300025297 Ga0209758_1007968 Ga0209758_10079688 72
50 3300025914 Ga0207671_10036755 Ga0207671_100367557 72
51 3300026078 Ga0207702_10549153 Ga0207702_105491532 72
52 3300048919 Ga0496116_0041653 Ga0496116_0041653_492_710 72
53 3300049822 Ga0501035_0093585 Ga0501035_0093585_158_379 73
54 3300049823 Ga0501044_0166105 Ga0501044_0166105_1944_2165 73
55 iso_pu_bacteria 2937843397 2937847531 73
56 3300001979 JGI24740J21852_10026651 JGI24740J21852_100266513 74
57 3300001979 JGI24740J21852_10082947 JGI24740J21852_100829472 74
58 3300005327 Ga0070658_11211686 Ga0070658_112116862 74
59 3300005339 Ga0070660_100214554 Ga0070660_1002145541 74
60 3300005455 Ga0070663_100271261 Ga0070663_1002712611 74
61 3300005563 Ga0068855_100921470 Ga0068855_1009214701 74
62 3300005614 Ga0068856_100555738 Ga0068856_1005557382 74
63 3300005616 Ga0068852_100161594 Ga0068852_1001615943 74
64 3300006038 Ga0075365_10051282 Ga0075365_100512824 74
65 3300006038 Ga0075365_10100064 Ga0075365_101000644 74
66 3300006048 Ga0075363_100099269 Ga0075363_1000992692 74
67 3300006048 Ga0075363_100210806 Ga0075363_1002108062 74
68 3300006051 Ga0075364_10054130 Ga0075364_100541304 74
69 3300006051 Ga0075364_10616296 Ga0075364_106162962 74
70 3300006177 Ga0075362_10006126 Ga0075362_100061262 74
71 3300006178 Ga0075367_10247120 Ga0075367_102471201 74
72 3300006186 Ga0075369_10017125 Ga0075369_100171254 74
73 3300006195 Ga0075366_10169723 Ga0075366_101697232 74
74 3300006353 Ga0075370_10021332 Ga0075370_100213322 74
75 3300009174 Ga0105241_10972853 Ga0105241_109728532 74
76 3300009545 Ga0105237_10530403 Ga0105237_105304032 74
77 3300009545 Ga0105237_11550211 Ga0105237_115502111 74
78 3300009551 Ga0105238_12748732 Ga0105238_127487322 74
79 3300010375 Ga0105239_11898503 Ga0105239_118985031 74
80 3300014497 Ga0182008_10336731 Ga0182008_103367311 74
81 3300025261 Ga0209233_1008595 Ga0209233_10085952 74
82 3300025904 Ga0207647_10149110 Ga0207647_101491102 74
83 3300025909 Ga0207705_10597175 Ga0207705_105971751 74
84 3300025919 Ga0207657_10088083 Ga0207657_100880833 74
85 3300025920 Ga0207649_10238280 Ga0207649_102382802 74
86 3300025924 Ga0207694_10433967 Ga0207694_104339672 74
87 3300025945 Ga0207679_10296981 Ga0207679_102969813 74
88 3300025981 Ga0207640_10095463 Ga0207640_100954632 74
89 3300026067 Ga0207678_10094766 Ga0207678_100947662 74
90 3300026078 Ga0207702_10528683 Ga0207702_105286831 74
91 3300026142 Ga0207698_10527558 Ga0207698_105275581 74
92 3300037418 Ga0395900_1598671 Ga0395900_1598671_304_528 74
93 3300041486 Ga0451807_0458939 Ga0451807_0458939_387_611 74
94 3300041491 Ga0451833_0786665 Ga0451833_0786665_205_429 74
95 3300046558 Ga0495633_0396258 Ga0495633_0396258_364_588 74
96 3300049571 Ga0501034_0935078 Ga0501034_0935078_344_568 74
97 3300049581 Ga0501047_1279676 Ga0501047_1279676_312_536 74
98 3300050492 nmdc:mga0yw44_63175_c2 nmdc:mga0yw44_63175_c2_1426_1650 74
99 3300053079 Ga0500610_0019403 Ga0500610_0019403_457_681 74
100 3300005339 Ga0070660_100766808 Ga0070660_1007668081 75
101 3300005548 Ga0070665_101854063 Ga0070665_1018540632 75
102 3300005616 Ga0068852_101475485 Ga0068852_1014754852 75
103 3300005616 Ga0068852_101530411 Ga0068852_1015304111 75
104 3300006051 Ga0075364_10017921 Ga0075364_100179216 75
105 3300009093 Ga0105240_10000024 Ga0105240_10000024267 75
106 3300013100 Ga0157373_10984468 Ga0157373_109844681 75
107 3300013104 Ga0157370_10000180 Ga0157370_1000018021 75
108 3300013105 Ga0157369_10359949 Ga0157369_103599492 75
109 3300013306 Ga0163162_11981935 Ga0163162_119819352 75
110 3300015684 Ga0183365_10002 Ga0183365_10002110 75
111 3300025229 Ga0209147_100397 Ga0209147_10039725 75
112 3300025250 Ga0209026_1015827 Ga0209026_10158272 75
113 3300025913 Ga0207695_10000036 Ga0207695_10000036336 75
114 3300025913 Ga0207695_11033336 Ga0207695_110333362 75
115 3300025914 Ga0207671_10004536 Ga0207671_100045368 75
116 3300026078 Ga0207702_10030777 Ga0207702_100307772 75
117 3300031548 Ga0307408_100019958 Ga0307408_1000199585 75
118 3300031731 Ga0307405_10002349 Ga0307405_100023498 75
119 3300031852 Ga0307410_10001586 Ga0307410_100015868 75
120 3300031911 Ga0307412_10000242 Ga0307412_1000024213 75
121 3300036647 Ga0316582_0758137 Ga0316582_0758137_258_497 75
122 3300041458 Ga0451798_0689753 Ga0451798_0689753_38_277 75
123 3300046558 Ga0495633_0000102 Ga0495633_0000102_101499_101741 75
124 3300048911 Ga0496108_0002093 Ga0496108_0002093_2706_2948 75
125 3300048919 Ga0496116_0049224 Ga0496116_0049224_1511_1753 75
126 3300048922 Ga0496119_0226015 Ga0496119_0226015_258_500 75
127 3300048925 Ga0496122_0214656 Ga0496122_0214656_155_397 75
128 3300048926 Ga0496123_0313822 Ga0496123_0313822_425_667 75
129 3300048927 Ga0496124_0001965 Ga0496124_0001965_24986_25228 75
130 3300048929 Ga0496126_0315535 Ga0496126_0315535_227_454 75
131 3300049568 Ga0501031_0245536 Ga0501031_0245536_150_380 75
132 3300049569 Ga0501032_0031965 Ga0501032_0031965_1935_2174 75
133 3300049569 Ga0501032_0186130 Ga0501032_0186130_73_306 75
134 3300049569 Ga0501032_0213431 Ga0501032_0213431_460_699 75
135 3300049569 Ga0501032_0586135 Ga0501032_0586135_296_526 75
136 3300049570 Ga0501033_0000437 Ga0501033_0000437_12384_12623 75
137 3300049570 Ga0501033_0015173 Ga0501033_0015173_3249_3488 75
138 3300049570 Ga0501033_0058685 Ga0501033_0058685_101_340 75
139 3300049570 Ga0501033_0646614 Ga0501033_0646614_143_373 75
140 3300049570 Ga0501033_1056315 Ga0501033_1056315_100_336 75
141 3300049571 Ga0501034_0005140 Ga0501034_0005140_8390_8617 75
142 3300049571 Ga0501034_0027352 Ga0501034_0027352_1096_1326 75
143 3300049571 Ga0501034_0350441 Ga0501034_0350441_504_734 75
144 3300049571 Ga0501034_0709746 Ga0501034_0709746_108_347 75
145 3300049571 Ga0501034_0776458 Ga0501034_0776458_180_419 75
146 3300049571 Ga0501034_1631951 Ga0501034_1631951_212_451 75
147 3300049572 Ga0501036_0474192 Ga0501036_0474192_520_759 75
148 3300049572 Ga0501036_0696510 Ga0501036_0696510_349_579 75
149 3300049572 Ga0501036_1095176 Ga0501036_1095176_189_428 75
150 3300049572 Ga0501036_1484565 Ga0501036_1484565_310_537 75
151 3300049573 Ga0501037_0520992 Ga0501037_0520992_240_470 75
152 3300049574 Ga0501038_0182904 Ga0501038_0182904_368_607 75
153 3300049574 Ga0501038_0927322 Ga0501038_0927322_23_253 75
154 3300049574 Ga0501038_1138203 Ga0501038_1138203_73_312 75
155 3300049575 Ga0501039_0125208 Ga0501039_0125208_874_1113 75
156 3300049575 Ga0501039_1333504 Ga0501039_1333504_94_339 75
157 3300049576 Ga0501040_0713753 Ga0501040_0713753_20_259 75
158 3300049579 Ga0501043_0308622 Ga0501043_0308622_89_328 75
159 3300049580 Ga0501046_0202671 Ga0501046_0202671_426_665 75
160 3300049581 Ga0501047_0851119 Ga0501047_0851119_452_691 75
161 3300049581 Ga0501047_0887166 Ga0501047_0887166_193_432 75
162 3300049581 Ga0501047_1102040 Ga0501047_1102040_10_249 75
163 3300049586 Ga0501070_1220931 Ga0501070_1220931_271_501 75
164 3300049663 Ga0501223_020916 Ga0501223_020916_1029_1271 75
165 3300049664 Ga0501224_014895 Ga0501224_014895_625_867 75
166 3300049665 Ga0501227_027877 Ga0501227_027877_437_679 75
167 3300049679 Ga0501249_000553 Ga0501249_000553_3192_3434 75
168 3300049742 Ga0501080_0770528 Ga0501080_0770528_422_661 75
169 3300049742 Ga0501080_0792342 Ga0501080_0792342_246_485 75
170 3300049744 Ga0501083_0159241 Ga0501083_0159241_890_1129 75
171 3300049822 Ga0501035_0061959 Ga0501035_0061959_2985_3224 75
172 3300049822 Ga0501035_0122684 Ga0501035_0122684_623_862 75
173 3300049822 Ga0501035_0160115 Ga0501035_0160115_400_627 75
174 3300049822 Ga0501035_0249071 Ga0501035_0249071_223_453 75
175 3300049822 Ga0501035_1072845 Ga0501035_1072845_235_474 75
176 3300049823 Ga0501044_0007018 Ga0501044_0007018_10474_10713 75
177 3300049823 Ga0501044_0286638 Ga0501044_0286638_984_1223 75
178 3300049823 Ga0501044_0323170 Ga0501044_0323170_941_1168 75
179 3300050491 nmdc:mga00v17_3465_c1 nmdc:mga00v17_3465_c1_7257_7487 75
180 3300050491 nmdc:mga00v17_874735_c1 nmdc:mga00v17_874735_c1_120_374 75
181 3300053093 Ga0500651_0505475 Ga0500651_0505475_390_617 75
182 3300053130 Ga0500642_0136808 Ga0500642_0136808_674_901 75
183 3300053136 Ga0500559_0002511 Ga0500559_0002511_2597_2839 75
184 3300053153 Ga0500616_0000170 Ga0500616_0000170_74926_75153 75
185 3300054114 Ga0501084_0249117 Ga0501084_0249117_665_904 75
186 3300048907 Ga0496104_0000035 Ga0496104_0000035_75566_75799 77
187 3300048908 Ga0496105_0000029 Ga0496105_0000029_48357_48590 77
188 3300001989 JGI24739J22299_10103671 JGI24739J22299_101036711 78
189 3300005344 Ga0070661_100527206 Ga0070661_1005272061 78
190 3300009098 Ga0105245_10209175 Ga0105245_102091752 78
191 3300009545 Ga0105237_10016350 Ga0105237_1001635011 78
192 3300009553 Ga0105249_11716569 Ga0105249_117165692 78
193 3300010375 Ga0105239_10104320 Ga0105239_101043201 78
194 3300011119 Ga0105246_10530290 Ga0105246_105302901 78
195 3300013104 Ga0157370_10008843 Ga0157370_100088432 78
196 3300013105 Ga0157369_11085619 Ga0157369_110856192 78
197 3300013296 Ga0157374_10087430 Ga0157374_100874302 78
198 3300038443 Ga0395901_0990461 Ga0395901_0990461_561_797 78
199 3300042012 Ga0439455_0003498 Ga0439455_0003498_2653_2889 78
200 3300042157 Ga0439458_0011056 Ga0439458_0011056_232_468 78
201 3300046522 Ga0495643_0079364 Ga0495643_0079364_146_382 78
202 3300046542 Ga0495597_0271394 Ga0495597_0271394_295_531 78
203 3300048929 Ga0496126_0467191 Ga0496126_0467191_215_451 78
204 3300050489 nmdc:mga03683_139902_c1 nmdc:mga03683_139902_c1_557_793 78
205 3300050490 nmdc:mga03n38_156624_c1 nmdc:mga03n38_156624_c1_418_654 78
206 3300050490 nmdc:mga03n38_20308_c1 nmdc:mga03n38_20308_c1_1319_1555 78
207 3300050491 nmdc:mga00v17_22808_c1 nmdc:mga00v17_22808_c1_2024_2260 78
208 3300050491 nmdc:mga00v17_344614_c1 nmdc:mga00v17_344614_c1_431_667 78
209 3300050492 nmdc:mga0yw44_234419_c1 nmdc:mga0yw44_234419_c1_690_926 78
210 3300050492 nmdc:mga0yw44_419893_c1 nmdc:mga0yw44_419893_c1_139_375 78
211 3300050492 nmdc:mga0yw44_6579_c1 nmdc:mga0yw44_6579_c1_5108_5344 78
212 3300050493 nmdc:mga0k408_690485_c1 nmdc:mga0k408_690485_c1_302_538 78
213 3300050494 nmdc:mga06z11_35491_c1 nmdc:mga06z11_35491_c1_1887_2123 78
214 3300050496 nmdc:mga07m45_11303_c2 nmdc:mga07m45_11303_c2_707_943 78
215 2010549000 RicEn_FSXC89082_b1 RicEn_630750 79
216 3300009093 Ga0105240_11252386 Ga0105240_112523862 79
217 3300009545 Ga0105237_10006265 Ga0105237_100062658 79
218 3300009551 Ga0105238_10797636 Ga0105238_107976362 79
219 3300010375 Ga0105239_10009253 Ga0105239_1000925312 79
220 3300048918 Ga0496115_1080775 Ga0496115_1080775_18_278 79
221 3300049570 Ga0501033_0000118 Ga0501033_0000118_56737_56988 79
222 3300049822 Ga0501035_0001360 Ga0501035_0001360_241_492 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10038

DUF2274

Protein of unknown function (DUF2274)

5

74

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gpe-assembly1.cif.gz_A structure of the dna-binding domain of e. coli proline utilization a (puta) 0.8495 17 67
2ay0-assembly1.cif.gz_B structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain. 0.8202 18 64
2gpe-assembly1.cif.gz_A structure of the dna-binding domain of e. coli proline utilization a (puta) 0.7889 17 67
2ay0-assembly1.cif.gz_B structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain. 0.7744 18 64
2ay0-assembly3.cif.gz_E structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain. 0.7484 17 64
ID Description Score Start End Superfamily
1ea4E00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.6884 17 67 1.10.1220.10
3omyB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;TraM protein, DNA-binding 0.6844 19 62 1.10.10.450
1mylF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.6831 18 61 1.10.1220.10
1ea4E00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.6762 17 67 1.10.1220.10
af_A0A0R4IER2_1_165_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.6716 13 47 3.40.140.10
ID Description Score Start End GO Terms
AF-E6VPX7-F1-model_v4 DUF2274 domain-containing protein 0.9796 19 78
AF-A0A3D9Y2G6-F1-model_v4 Uncharacterized protein DUF2274 0.9628 21 74
AF-A0A0V0Q3L6-F1-model_v4 DUF2274 domain-containing protein 0.9514 30 76
AF-A0A504KP88-F1-model_v4 DUF2274 domain-containing protein 0.9502 14 76
AF-A0A833GMP4-F1-model_v4 DUF2274 domain-containing protein 0.9392 14 75

Feature Viewer

pLDDT pTM Quality
81.96 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map