F334317

General Info

Members Datasets Scaffolds Average Seq Length
222 173 189 175

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10351722|Ga0075364_103517222
Length 199
Sequence MARLPRPRRSRRWTGNPAVENCNMAKIVFGMNQSLDGYVDHQEFAPGPVLFRHWIEQVRGVTGSVYGSRMYEIMRYFDEDHPEWPPELREFAVAWRSQPKWVVSRSLKSVGPNATLVADDAEAVIRGLKAERAGEIHVSGPKLAGSLTELGLIDEYRLYFHPVVLGRGTPFFAGPRPPLRLVASDRIGEDAVRLTYVPA

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
3 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
4 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
5 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
6 2643221718 Rhizobium sp. Root268 Isolate Unclassified
7 2643221733 Bosea sp. Root381 Isolate Unclassified
8 2718217927 Rhizobium sp. N324 Isolate Nodule
9 2721755809 Rhizobium sp. N541 Isolate Nodule
10 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
11 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
12 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
13 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
14 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
15 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
16 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
17 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
18 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
19 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
20 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
21 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
22 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
23 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
24 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
25 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
26 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
27 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
169 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
170 8005275841 Rhizobium sp. N4311 Isolate Nodule
171 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
172 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
173 8018176218 Rhizobium sp. N122 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.14
Metatranscriptomes 0
Isolates 14.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.37
Nodule 9.46
Rhizoplane 1.35
Rhizosphere 62.16
Stem 0
Stem Tuber 0
Unclassified 7.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10676307 3300005328 Bacteria 752
2 Ga0070683_100215955 3300005329 Bacteria 1822
3 Ga0070670_100678210 3300005331 Bacteria 926
4 Ga0068869_100241035 3300005334 Bacteria 1441
5 Ga0070666_10283094 3300005335 Bacteria 1179
6 Ga0070680_100070632 3300005336 Bacteria 2868
7 Ga0070660_100687126 3300005339 Bacteria 858
8 Ga0070689_100619565 3300005340 Bacteria 939
9 Ga0070691_10001445 3300005341 Bacteria 10164
10 Ga0070668_100643885 3300005347 Bacteria 931
11 Ga0070674_100315190 3300005356 Bacteria 1252
12 Ga0070673_100438990 3300005364 Bacteria 1173
13 Ga0070713_100625962 3300005436 Bacteria 1024
14 Ga0070678_100028957 3300005456 Bacteria 3786
15 Ga0070681_10222317 3300005458 Bacteria 1803
16 Ga0070679_100882915 3300005530 Bacteria 837
17 Ga0070684_100294461 3300005535 Bacteria 1488
18 Ga0068853_100413105 3300005539 Bacteria 1265
19 Ga0068853_101042859 3300005539 Bacteria 788
20 Ga0070693_100470683 3300005547 Bacteria 886
21 Ga0070665_100065215 3300005548 Bacteria 3653
22 Ga0070665_100990672 3300005548 Bacteria 853
23 Ga0068855_100057442 3300005563 Bacteria 4561
24 Ga0070664_100223369 3300005564 Bacteria 1686
25 Ga0068857_100067530 3300005577 Bacteria 3182
26 Ga0068857_100118388 3300005577 Bacteria 2384
27 Ga0070702_101078001 3300005615 Bacteria 641
28 Ga0068861_100254670 3300005719 Bacteria 1500
29 Ga0068863_100134963 3300005841 Bacteria 2357
30 Ga0068863_100179958 3300005841 Bacteria 2029
31 Ga0068858_100613698 3300005842 Bacteria 1056
32 Ga0068860_100013284 3300005843 Bacteria 8079
33 Ga0068862_100314534 3300005844 Bacteria 1444
34 Ga0081538_10102789 3300005981 Bacteria 1432
35 Ga0081539_10007423 3300005985 Bacteria 10002
36 Ga0075365_10041930 3300006038 Bacteria 2990
37 Ga0075365_10052437 3300006038 Bacteria 2698
38 Ga0075365_10277329 3300006038 Bacteria 1179
39 Ga0075368_10040811 3300006042 Bacteria 1822
40 Ga0075363_100030807 3300006048 Bacteria 2779
41 Ga0075363_100039975 3300006048 Bacteria 2471
42 Ga0075363_100096705 3300006048 Bacteria 1631
43 Ga0075363_100155238 3300006048 Bacteria 1294
44 Ga0075363_100299612 3300006048 Bacteria 933
45 Ga0075364_10351722 3300006051 Bacteria 1004
46 Ga0075364_10479226 3300006051 Bacteria 850
47 Ga0075362_10063999 3300006177 Bacteria 1668
48 Ga0075362_10103400 3300006177 Bacteria 1334
49 Ga0075367_10021127 3300006178 Bacteria 3634
50 Ga0075367_10047283 3300006178 Bacteria 2531
51 Ga0075367_10095269 3300006178 Bacteria 1815
52 Ga0075366_10137915 3300006195 Bacteria 1474
53 Ga0075366_10327711 3300006195 Bacteria 938
54 Ga0075370_10011076 3300006353 Bacteria 4730
55 Ga0075428_100010423 3300006844 Bacteria 10321
56 Ga0075428_100289657 3300006844 Bacteria 1761
57 Ga0075430_100317139 3300006846 Bacteria 1289
58 Ga0105240_10069441 3300009093 Bacteria 4360
59 Ga0105240_10098330 3300009093 Bacteria 3564
60 Ga0105240_10423108 3300009093 Bacteria 1496
61 Ga0111539_12285386 3300009094 Bacteria 627
62 Ga0105245_10045427 3300009098 Bacteria 3923
63 Ga0105247_10046604 3300009101 Bacteria 2661
64 Ga0105243_10769323 3300009148 Bacteria 946
65 Ga0105241_10090031 3300009174 Bacteria 2419
66 Ga0105241_10190038 3300009174 Unclassified 1709
67 Ga0105248_10028228 3300009177 Bacteria 6250
68 Ga0105237_10633304 3300009545 Bacteria 1076
69 Ga0105238_10040230 3300009551 Bacteria 4738
70 Ga0105238_10061462 3300009551 Bacteria 3759
71 Ga0105238_10468115 3300009551 Bacteria 1259
72 Ga0105249_10033055 3300009553 Bacteria 4683
73 Ga0105249_12040029 3300009553 Bacteria 646
74 Ga0123341_1002156 3300009765 Bacteria 15903
75 Ga0105239_12105291 3300010375 Bacteria 656
76 Ga0105246_10140524 3300011119 Bacteria 1815
77 Ga0171462_1019 3300013250 Bacteria 146628
78 Ga0157380_10233118 3300014326 Bacteria 1655
79 Ga0157379_10391660 3300014968 Bacteria 1276
80 Ga0213872_10172481 3300021361 Bacteria 937
81 Ga0207710_10017332 3300025900 Bacteria 3055
82 Ga0207680_10379837 3300025903 Bacteria 996
83 Ga0207654_10051887 3300025911 Bacteria 2362
84 Ga0207654_10060246 3300025911 Bacteria 2217
85 Ga0207695_10000712 3300025913 Bacteria 64832
86 Ga0207695_10010642 3300025913 Bacteria 11237
87 Ga0207671_10034070 3300025914 Bacteria 3786
88 Ga0207671_10499145 3300025914 Bacteria 970
89 Ga0207694_10158549 3300025924 Bacteria 1827
90 Ga0207694_10192635 3300025924 Bacteria 1657
91 Ga0207650_10282837 3300025925 Bacteria 1351
92 Ga0207711_10307477 3300025941 Bacteria 1463
93 Ga0207711_10950207 3300025941 Bacteria 798
94 Ga0207711_11349287 3300025941 Bacteria 655
95 Ga0207689_10059340 3300025942 Bacteria 3147
96 Ga0207689_10201138 3300025942 Bacteria 1644
97 Ga0207661_10272936 3300025944 Bacteria 1509
98 Ga0207679_10075151 3300025945 Bacteria 2562
99 Ga0207651_10907290 3300025960 Bacteria 785
100 Ga0207712_10026191 3300025961 Bacteria 3882
101 Ga0207678_10414206 3300026067 Bacteria 1168
102 Ga0207702_10931923 3300026078 Bacteria 861
103 Ga0207641_10191246 3300026088 Bacteria 1881
104 Ga0207641_10308286 3300026088 Bacteria 1497
105 Ga0207675_100188454 3300026118 Bacteria 1978
106 Ga0207675_101050793 3300026118 Bacteria 834
107 Ga0207683_10123969 3300026121 Bacteria 2321
108 Ga0207698_10967168 3300026142 Bacteria 861
109 Ga0209813_10011657 3300027866 Bacteria 2303
110 Ga0209813_10035365 3300027866 Bacteria 1496
111 Ga0209813_10147106 3300027866 Bacteria 841
112 Ga0268266_10008917 3300028379 Bacteria 8876
113 Ga0268266_10310488 3300028379 Bacteria 1473
114 Ga0268265_11263827 3300028380 Bacteria 737
115 Ga0268264_10019964 3300028381 Bacteria 5475
116 Ga0307517_10276480 3300028786 Bacteria 961
117 Ga0265338_10051596 3300028800 Bacteria 3701
118 Ga0265338_10523611 3300028800 Bacteria 833
119 Ga0265325_10216741 3300031241 Bacteria 877
120 Ga0265340_10302580 3300031247 Bacteria 709
121 Ga0265331_10203095 3300031250 Bacteria 892
122 Ga0307513_10000586 3300031456 Bacteria 52190
123 Ga0307513_10607188 3300031456 Bacteria 803
124 Ga0307408_100162528 3300031548 Bacteria 1775
125 Ga0265313_10201271 3300031595 Bacteria 828
126 Ga0265314_10304650 3300031711 Bacteria 892
127 Ga0265342_10310511 3300031712 Bacteria 828
128 Ga0307516_10026118 3300031730 Bacteria 5937
129 Ga0307413_10347090 3300031824 Bacteria 1144
130 Ga0307406_10055348 3300031901 Bacteria 2536
131 Ga0307412_10207629 3300031911 Bacteria 1492
132 Ga0307409_100217352 3300031995 Bacteria 1723
133 Ga0307415_100368380 3300032126 Bacteria 1216
134 Ga0307415_100817711 3300032126 Bacteria 852
135 Ga0373944_0000508 3300035089 Bacteria 9065
136 Ga0373937_1464391 3300036401 Bacteria 630
137 Ga0373925_0000022 3300037068 Bacteria 160046
138 Ga0395905_0056234 3300037471 Bacteria 3681
139 Ga0395905_0284104 3300037471 Bacteria 1541
140 Ga0395905_1254592 3300037471 Bacteria 645
141 Ga0395901_0333830 3300038443 Bacteria 1567
142 Ga0436361_0506543 3300039447 Bacteria 4243
143 Ga0451839_1269793 3300041496 Bacteria 3238
144 Ga0451853_0914005 3300041512 Bacteria 1520
145 Ga0439443_014368 3300042003 Bacteria 1192
146 Ga0439460_0024641 3300042461 Bacteria 1669
147 Ga0495650_0000068 3300046471 Bacteria 266671
148 Ga0495620_0015404 3300046515 Bacteria 3862
149 Ga0495644_0100634 3300046523 Bacteria 1093
150 Ga0495648_0088778 3300046524 Bacteria 1737
151 Ga0495642_0035817 3300046528 Bacteria 2004
152 Ga0495654_0000051 3300046530 Bacteria 145932
153 Ga0495625_0188296 3300046660 Bacteria 1368
154 Ga0495669_0000020 3300046684 Bacteria 122868
155 Ga0495672_0003346 3300047320 Bacteria 13811
156 Ga0495686_0009697 3300047472 Bacteria 6913
157 Ga0495686_0152137 3300047472 Bacteria 1358
158 Ga0496100_0464167 3300048903 Bacteria 972
159 Ga0496105_1020953 3300048908 Bacteria 618
160 Ga0496115_0973547 3300048918 Bacteria 650
161 Ga0501034_0506776 3300049571 Bacteria 1120
162 Ga0501068_0693517 3300049584 Bacteria 666
163 Ga0501045_0465316 3300049824 Bacteria 940
164 nmdc:mga03683_6811_c1 3300050489 Bacteria 3640
165 nmdc:mga03n38_365533_c1 3300050490 Bacteria 788
166 nmdc:mga00v17_40169_c1 3300050491 Bacteria 2806
167 nmdc:mga0yw44_615453_c1 3300050492 Bacteria 738
168 nmdc:mga0k408_39634_c1 3300050493 Bacteria 2708
169 nmdc:mga0k408_83902_c1 3300050493 Bacteria 1868
170 nmdc:mga06z11_137548_c1 3300050494 Bacteria 1378
171 nmdc:mga06z11_248465_c1 3300050494 Bacteria 1047
172 nmdc:mga04h51_116671_c1 3300050495 Bacteria 990
173 nmdc:mga04h51_18739_c1 3300050495 Bacteria 2043
174 nmdc:mga04h51_53512_c1 3300050495 Bacteria 1362
175 nmdc:mga07m45_174332_c1 3300050496 Bacteria 1250
176 nmdc:mga07m45_33258_c1 3300050496 Bacteria 2863
177 nmdc:mga07m45_472600_c1 3300050496 Bacteria 727
178 nmdc:mga05p37_901_c1 3300050507 Bacteria 33493
179 nmdc:mga06r32_26006_c1 3300050510 Bacteria 5453
180 nmdc:mga0a205_548790_c1 3300050515 Bacteria 1011
181 Ga0500592_000034 3300053116 Bacteria 43892
182 Ga0500616_0003367 3300053153 Bacteria 12283
183 Ga0500616_0025651 3300053153 Bacteria 3268
184 Ga0500616_0048281 3300053153 Bacteria 2257
185 Ga0500627_0000040 3300053158 Bacteria 68950
186 Ga0500627_0039340 3300053158 Bacteria 2024
187 Ga0500645_033562 3300053730 Bacteria 1535
188 Ga0501084_0203874 3300054114 Bacteria 1669
189 Ga0501082_0244189 3300060353 Bacteria 1563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0284104 Ga0395905_0284104_462_992 162
2 3300053116 Ga0500592_000034 Ga0500592_000034_33662_34150 162
3 3300053158 Ga0500627_0000040 Ga0500627_0000040_35356_35844 162
4 3300010375 Ga0105239_12105291 Ga0105239_121052911 169
5 3300013250 Ga0171462_1019 Ga0171462_1019124 169
6 3300042461 Ga0439460_0024641 Ga0439460_0024641_1141_1650 169
7 iso_pu_bacteria 2643221598 2644000751 170
8 iso_pu_bacteria 2509276033 2509443652 172
9 iso_pu_bacteria 2643221574 2643884764 172
10 iso_pu_bacteria 2643221637 2644207184 172
11 iso_pu_bacteria 2643221699 2644551076 172
12 iso_pu_bacteria 2643221718 2644650832 172
13 iso_pu_bacteria 2643221733 2644728336 172
14 iso_pu_bacteria 2718217927 2719384521 172
15 iso_pu_bacteria 2721755809 2724037043 172
16 iso_pu_bacteria 2791355092 2792627112 172
17 iso_pu_bacteria 2791355259 2793318794 172
18 iso_pu_bacteria 2838074704 2838080023 172
19 iso_pu_bacteria 2842395702 2842401199 172
20 iso_pu_bacteria 2883577096 2883581571 172
21 iso_pu_bacteria 2906328253 2906332292 172
22 iso_pu_bacteria 2919450847 2919453125 172
23 iso_pu_bacteria 2922158528 2922164537 172
24 iso_pu_bacteria 2924726620 2924730294 172
25 iso_pu_bacteria 2937891427 2937892501 172
26 iso_pu_bacteria 2958115193 2958117321 172
27 iso_pu_bacteria 2965062239 2965066645 172
28 iso_pu_bacteria 2968091066 2968092634 172
29 iso_pu_bacteria 2968097103 2968102073 172
30 iso_pu_bacteria 2968128360 2968130135 172
31 iso_pu_bacteria 2977858184 2977861984 172
32 iso_pu_bacteria 2979779861 2979785179 172
33 iso_pu_bacteria 2996341866 2996345937 172
34 iso_pu_bacteria 8004445564 8004451541 172
35 iso_pu_bacteria 8004703790 8004711205 172
36 iso_pu_bacteria 8005275841 8005279235 172
37 iso_pu_bacteria 8005695170 8005697192 172
38 iso_pu_bacteria 8006984368 8006988041 172
39 iso_pu_bacteria 8018176218 8018181569 172
40 3300005539 Ga0068853_100413105 Ga0068853_1004131052 174
41 3300005547 Ga0070693_100470683 Ga0070693_1004706831 174
42 3300005563 Ga0068855_100057442 Ga0068855_1000574426 174
43 3300005577 Ga0068857_100118388 Ga0068857_1001183882 174
44 3300005615 Ga0070702_101078001 Ga0070702_1010780011 174
45 3300005844 Ga0068862_100314534 Ga0068862_1003145341 174
46 3300009093 Ga0105240_10069441 Ga0105240_100694412 174
47 3300009094 Ga0111539_12285386 Ga0111539_122853861 174
48 3300009174 Ga0105241_10090031 Ga0105241_100900313 174
49 3300009551 Ga0105238_10040230 Ga0105238_100402307 174
50 3300009551 Ga0105238_10468115 Ga0105238_104681151 174
51 3300025911 Ga0207654_10060246 Ga0207654_100602462 174
52 3300025914 Ga0207671_10034070 Ga0207671_100340701 174
53 3300025924 Ga0207694_10158549 Ga0207694_101585491 174
54 3300026067 Ga0207678_10414206 Ga0207678_104142063 174
55 3300028380 Ga0268265_11263827 Ga0268265_112638271 174
56 3300046660 Ga0495625_0188296 Ga0495625_0188296_430_954 174
57 3300048903 Ga0496100_0464167 Ga0496100_0464167_28_552 174
58 3300049584 Ga0501068_0693517 Ga0501068_0693517_58_582 174
59 3300053730 Ga0500645_033562 Ga0500645_033562_77_604 175
60 3300054114 Ga0501084_0203874 Ga0501084_0203874_512_1039 175
61 3300060353 Ga0501082_0244189 Ga0501082_0244189_556_1083 175
62 3300005328 Ga0070676_10676307 Ga0070676_106763072 176
63 3300005329 Ga0070683_100215955 Ga0070683_1002159552 176
64 3300005331 Ga0070670_100678210 Ga0070670_1006782101 176
65 3300005334 Ga0068869_100241035 Ga0068869_1002410352 176
66 3300005335 Ga0070666_10283094 Ga0070666_102830941 176
67 3300005336 Ga0070680_100070632 Ga0070680_1000706322 176
68 3300005339 Ga0070660_100687126 Ga0070660_1006871262 176
69 3300005340 Ga0070689_100619565 Ga0070689_1006195651 176
70 3300005341 Ga0070691_10001445 Ga0070691_1000144513 176
71 3300005347 Ga0070668_100643885 Ga0070668_1006438852 176
72 3300005356 Ga0070674_100315190 Ga0070674_1003151902 176
73 3300005364 Ga0070673_100438990 Ga0070673_1004389901 176
74 3300005436 Ga0070713_100625962 Ga0070713_1006259621 176
75 3300005456 Ga0070678_100028957 Ga0070678_1000289572 176
76 3300005458 Ga0070681_10222317 Ga0070681_102223173 176
77 3300005530 Ga0070679_100882915 Ga0070679_1008829151 176
78 3300005535 Ga0070684_100294461 Ga0070684_1002944612 176
79 3300005539 Ga0068853_101042859 Ga0068853_1010428592 176
80 3300005548 Ga0070665_100065215 Ga0070665_1000652153 176
81 3300005548 Ga0070665_100990672 Ga0070665_1009906722 176
82 3300005564 Ga0070664_100223369 Ga0070664_1002233692 176
83 3300005577 Ga0068857_100067530 Ga0068857_1000675303 176
84 3300005719 Ga0068861_100254670 Ga0068861_1002546703 176
85 3300005841 Ga0068863_100134963 Ga0068863_1001349633 176
86 3300005841 Ga0068863_100179958 Ga0068863_1001799582 176
87 3300005842 Ga0068858_100613698 Ga0068858_1006136982 176
88 3300005843 Ga0068860_100013284 Ga0068860_1000132844 176
89 3300005981 Ga0081538_10102789 Ga0081538_101027891 176
90 3300005985 Ga0081539_10007423 Ga0081539_100074238 176
91 3300006038 Ga0075365_10041930 Ga0075365_100419301 176
92 3300006038 Ga0075365_10052437 Ga0075365_100524372 176
93 3300006038 Ga0075365_10277329 Ga0075365_102773292 176
94 3300006042 Ga0075368_10040811 Ga0075368_100408112 176
95 3300006048 Ga0075363_100030807 Ga0075363_1000308074 176
96 3300006048 Ga0075363_100039975 Ga0075363_1000399753 176
97 3300006048 Ga0075363_100096705 Ga0075363_1000967052 176
98 3300006048 Ga0075363_100155238 Ga0075363_1001552381 176
99 3300006048 Ga0075363_100299612 Ga0075363_1002996122 176
100 3300006051 Ga0075364_10351722 Ga0075364_103517222 176
101 3300006051 Ga0075364_10479226 Ga0075364_104792262 176
102 3300006177 Ga0075362_10063999 Ga0075362_100639992 176
103 3300006177 Ga0075362_10103400 Ga0075362_101034003 176
104 3300006178 Ga0075367_10021127 Ga0075367_100211271 176
105 3300006178 Ga0075367_10047283 Ga0075367_100472833 176
106 3300006178 Ga0075367_10095269 Ga0075367_100952692 176
107 3300006195 Ga0075366_10137915 Ga0075366_101379151 176
108 3300006195 Ga0075366_10327711 Ga0075366_103277112 176
109 3300006353 Ga0075370_10011076 Ga0075370_100110765 176
110 3300006844 Ga0075428_100010423 Ga0075428_10001042312 176
111 3300006844 Ga0075428_100289657 Ga0075428_1002896572 176
112 3300006846 Ga0075430_100317139 Ga0075430_1003171391 176
113 3300009093 Ga0105240_10098330 Ga0105240_100983303 176
114 3300009093 Ga0105240_10423108 Ga0105240_104231082 176
115 3300009098 Ga0105245_10045427 Ga0105245_100454274 176
116 3300009101 Ga0105247_10046604 Ga0105247_100466042 176
117 3300009148 Ga0105243_10769323 Ga0105243_107693231 176
118 3300009174 Ga0105241_10190038 Ga0105241_101900382 176
119 3300009177 Ga0105248_10028228 Ga0105248_100282284 176
120 3300009545 Ga0105237_10633304 Ga0105237_106333041 176
121 3300009551 Ga0105238_10061462 Ga0105238_100614624 176
122 3300009553 Ga0105249_10033055 Ga0105249_100330556 176
123 3300009553 Ga0105249_12040029 Ga0105249_120400291 176
124 3300009765 Ga0123341_1002156 Ga0123341_100215616 176
125 3300011119 Ga0105246_10140524 Ga0105246_101405241 176
126 3300014326 Ga0157380_10233118 Ga0157380_102331182 176
127 3300014968 Ga0157379_10391660 Ga0157379_103916602 176
128 3300021361 Ga0213872_10172481 Ga0213872_101724812 176
129 3300025900 Ga0207710_10017332 Ga0207710_100173322 176
130 3300025903 Ga0207680_10379837 Ga0207680_103798372 176
131 3300025911 Ga0207654_10051887 Ga0207654_100518873 176
132 3300025913 Ga0207695_10000712 Ga0207695_1000071211 176
133 3300025913 Ga0207695_10010642 Ga0207695_1001064212 176
134 3300025914 Ga0207671_10499145 Ga0207671_104991451 176
135 3300025924 Ga0207694_10192635 Ga0207694_101926352 176
136 3300025925 Ga0207650_10282837 Ga0207650_102828372 176
137 3300025941 Ga0207711_10307477 Ga0207711_103074772 176
138 3300025941 Ga0207711_10950207 Ga0207711_109502071 176
139 3300025941 Ga0207711_11349287 Ga0207711_113492871 176
140 3300025942 Ga0207689_10059340 Ga0207689_100593402 176
141 3300025942 Ga0207689_10201138 Ga0207689_102011382 176
142 3300025944 Ga0207661_10272936 Ga0207661_102729362 176
143 3300025945 Ga0207679_10075151 Ga0207679_100751512 176
144 3300025960 Ga0207651_10907290 Ga0207651_109072901 176
145 3300025961 Ga0207712_10026191 Ga0207712_100261914 176
146 3300026078 Ga0207702_10931923 Ga0207702_109319231 176
147 3300026088 Ga0207641_10191246 Ga0207641_101912462 176
148 3300026088 Ga0207641_10308286 Ga0207641_103082861 176
149 3300026118 Ga0207675_100188454 Ga0207675_1001884542 176
150 3300026118 Ga0207675_101050793 Ga0207675_1010507932 176
151 3300026121 Ga0207683_10123969 Ga0207683_101239692 176
152 3300026142 Ga0207698_10967168 Ga0207698_109671682 176
153 3300027866 Ga0209813_10011657 Ga0209813_100116573 176
154 3300027866 Ga0209813_10035365 Ga0209813_100353652 176
155 3300027866 Ga0209813_10147106 Ga0209813_101471061 176
156 3300028379 Ga0268266_10008917 Ga0268266_100089173 176
157 3300028379 Ga0268266_10310488 Ga0268266_103104881 176
158 3300028381 Ga0268264_10019964 Ga0268264_100199647 176
159 3300028786 Ga0307517_10276480 Ga0307517_102764802 176
160 3300028800 Ga0265338_10051596 Ga0265338_100515963 176
161 3300028800 Ga0265338_10523611 Ga0265338_105236111 176
162 3300031241 Ga0265325_10216741 Ga0265325_102167411 176
163 3300031247 Ga0265340_10302580 Ga0265340_103025801 176
164 3300031250 Ga0265331_10203095 Ga0265331_102030951 176
165 3300031456 Ga0307513_10000586 Ga0307513_1000058643 176
166 3300031456 Ga0307513_10607188 Ga0307513_106071882 176
167 3300031548 Ga0307408_100162528 Ga0307408_1001625282 176
168 3300031595 Ga0265313_10201271 Ga0265313_102012711 176
169 3300031711 Ga0265314_10304650 Ga0265314_103046501 176
170 3300031712 Ga0265342_10310511 Ga0265342_103105111 176
171 3300031730 Ga0307516_10026118 Ga0307516_100261186 176
172 3300031824 Ga0307413_10347090 Ga0307413_103470902 176
173 3300031901 Ga0307406_10055348 Ga0307406_100553481 176
174 3300031911 Ga0307412_10207629 Ga0307412_102076292 176
175 3300031995 Ga0307409_100217352 Ga0307409_1002173523 176
176 3300032126 Ga0307415_100368380 Ga0307415_1003683802 176
177 3300032126 Ga0307415_100817711 Ga0307415_1008177111 176
178 3300035089 Ga0373944_0000508 Ga0373944_0000508_5732_6307 176
179 3300036401 Ga0373937_1464391 Ga0373937_1464391_40_570 176
180 3300037068 Ga0373925_0000022 Ga0373925_0000022_97668_98243 176
181 3300037471 Ga0395905_0056234 Ga0395905_0056234_519_1049 176
182 3300037471 Ga0395905_1254592 Ga0395905_1254592_52_597 176
183 3300038443 Ga0395901_0333830 Ga0395901_0333830_210_743 176
184 3300039447 Ga0436361_0506543 Ga0436361_0506543_507_1040 176
185 3300041496 Ga0451839_1269793 Ga0451839_1269793_81_638 176
186 3300041512 Ga0451853_0914005 Ga0451853_0914005_544_1074 176
187 3300042003 Ga0439443_014368 Ga0439443_014368_396_926 176
188 3300046471 Ga0495650_0000068 Ga0495650_0000068_224654_225184 176
189 3300046515 Ga0495620_0015404 Ga0495620_0015404_1616_2146 176
190 3300046523 Ga0495644_0100634 Ga0495644_0100634_504_1034 176
191 3300046524 Ga0495648_0088778 Ga0495648_0088778_916_1446 176
192 3300046528 Ga0495642_0035817 Ga0495642_0035817_207_740 176
193 3300046530 Ga0495654_0000051 Ga0495654_0000051_104093_104623 176
194 3300046684 Ga0495669_0000020 Ga0495669_0000020_42962_43495 176
195 3300047320 Ga0495672_0003346 Ga0495672_0003346_1966_2496 176
196 3300047472 Ga0495686_0009697 Ga0495686_0009697_5783_6313 176
197 3300047472 Ga0495686_0152137 Ga0495686_0152137_502_1050 176
198 3300048908 Ga0496105_1020953 Ga0496105_1020953_22_552 176
199 3300048918 Ga0496115_0973547 Ga0496115_0973547_53_586 176
200 3300049571 Ga0501034_0506776 Ga0501034_0506776_137_667 176
201 3300049824 Ga0501045_0465316 Ga0501045_0465316_247_777 176
202 3300050489 nmdc:mga03683_6811_c1 nmdc:mga03683_6811_c1_688_1218 176
203 3300050490 nmdc:mga03n38_365533_c1 nmdc:mga03n38_365533_c1_153_686 176
204 3300050491 nmdc:mga00v17_40169_c1 nmdc:mga00v17_40169_c1_1325_1855 176
205 3300050492 nmdc:mga0yw44_615453_c1 nmdc:mga0yw44_615453_c1_69_599 176
206 3300050493 nmdc:mga0k408_39634_c1 nmdc:mga0k408_39634_c1_1687_2217 176
207 3300050493 nmdc:mga0k408_83902_c1 nmdc:mga0k408_83902_c1_466_996 176
208 3300050494 nmdc:mga06z11_137548_c1 nmdc:mga06z11_137548_c1_54_584 176
209 3300050494 nmdc:mga06z11_248465_c1 nmdc:mga06z11_248465_c1_315_848 176
210 3300050495 nmdc:mga04h51_116671_c1 nmdc:mga04h51_116671_c1_368_901 176
211 3300050495 nmdc:mga04h51_18739_c1 nmdc:mga04h51_18739_c1_1333_1863 176
212 3300050495 nmdc:mga04h51_53512_c1 nmdc:mga04h51_53512_c1_581_1111 176
213 3300050496 nmdc:mga07m45_174332_c1 nmdc:mga07m45_174332_c1_651_1229 176
214 3300050496 nmdc:mga07m45_33258_c1 nmdc:mga07m45_33258_c1_1977_2507 176
215 3300050496 nmdc:mga07m45_472600_c1 nmdc:mga07m45_472600_c1_51_584 176
216 3300050507 nmdc:mga05p37_901_c1 nmdc:mga05p37_901_c1_2844_3374 176
217 3300050510 nmdc:mga06r32_26006_c1 nmdc:mga06r32_26006_c1_4245_4775 176
218 3300050515 nmdc:mga0a205_548790_c1 nmdc:mga0a205_548790_c1_143_676 176
219 3300053153 Ga0500616_0003367 Ga0500616_0003367_10479_11009 176
220 3300053153 Ga0500616_0025651 Ga0500616_0025651_890_1420 176
221 3300053153 Ga0500616_0048281 Ga0500616_0048281_200_730 176
222 3300053158 Ga0500627_0039340 Ga0500627_0039340_347_877 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

25

193

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7594 3 176
2ith-assembly1.cif.gz_A nmr structure of haloferax volcanii dhfr 0.7575 3 176
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7552 3 176
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7495 2 174
3tqb-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate 0.7491 3 174
ID Description Score Start End Superfamily
af_Q8ID31_1067_1217_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.815 156 176 3.30.980.10
af_Q58168_23_157_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.7881 156 173 3.30.1380.20
af_P40825_614_789_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.7797 156 176 3.30.980.10
af_Q9VRJ1_645_810_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.7635 156 174 3.30.980.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7594 3 176 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A435HEI2-F1-model_v4 Dihydrofolate reductase 0.993 1 130
AF-A0A435HEI2-F1-model_v4 Dihydrofolate reductase 0.9855 1 130
AF-A0A526YXE0-F1-model_v4 Dihydrofolate reductase 0.9811 1 143 GO:0008703
GO:0009231
AF-A0A249P3I0-F1-model_v4 Dihydrofolate reductase 0.9807 1 176 GO:0008703
GO:0009231
AF-A0A2A6I880-F1-model_v4 deleted 0.9805 1 176

Feature Viewer

pLDDT pTM Quality
93.98 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map