F334162

General Info

Members Datasets Scaffolds Average Seq Length
222 130 444 180

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100673001|Ga0070673_1006730012
Length 204
Sequence VSVDGEQRTEGRPSGPAAPKDWAHDVLDFWFSHGPMPGADPDSADWWQRSDAFDHEIKERFGILWARQARRPVDAFSGDPETALAAVILFDQFPRNMFRGHADQFSTDHMALTIAKSAIDRGYDDGMSRDQRTFLYMPFEHSEDLKDQIQSLLLFSALGDPYLLKYARKHHEVIERFGRFPHRNVVLGRKPTAMEQAAGDVVPW

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.76
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100673001 3300005364 Bacteria 949
2 JGI24752J21851_1002399 3300001976 Bacteria 2492
3 JGI24735J21928_10016800 3300002067 Bacteria 2265
4 Ga0070658_10003256 3300005327 Bacteria 13406
5 Ga0070658_10017917 3300005327 Bacteria 5664
6 Ga0070658_10353444 3300005327 Bacteria 1258
7 Ga0070683_100253160 3300005329 Bacteria 1675
8 Ga0070690_100265911 3300005330 Bacteria 1218
9 Ga0070690_100363345 3300005330 Bacteria 1054
10 Ga0070690_100683282 3300005330 Bacteria 787
11 Ga0070670_100008911 3300005331 Bacteria 8566
12 Ga0070670_100042900 3300005331 Bacteria 3889
13 Ga0070666_10001711 3300005335 Bacteria 13383
14 Ga0070680_100105083 3300005336 Bacteria 2347
15 Ga0070682_100092978 3300005337 Bacteria 1977
16 Ga0070660_100004418 3300005339 Bacteria 9716
17 Ga0070660_100126014 3300005339 Bacteria 2046
18 Ga0070689_100631976 3300005340 Bacteria 930
19 Ga0070661_100004957 3300005344 Bacteria 9168
20 Ga0070661_100200946 3300005344 Bacteria 1523
21 Ga0070661_100957612 3300005344 Bacteria 708
22 Ga0070692_10033654 3300005345 Bacteria 2583
23 Ga0070668_100291607 3300005347 Bacteria 1366
24 Ga0070668_100868019 3300005347 Bacteria 805
25 Ga0070675_100047720 3300005354 Bacteria 3510
26 Ga0070671_100332856 3300005355 Bacteria 1294
27 Ga0070671_100575336 3300005355 Bacteria 972
28 Ga0070673_100090983 3300005364 Bacteria 2493
29 Ga0070667_100008602 3300005367 Bacteria 8460
30 Ga0070667_100336501 3300005367 Bacteria 1364
31 Ga0070694_100000922 3300005444 Bacteria 16634
32 Ga0070678_100003096 3300005456 Bacteria 9220
33 Ga0070662_100010236 3300005457 Bacteria 6149
34 Ga0070662_100509510 3300005457 Unclassified 1004
35 Ga0070681_10199606 3300005458 Bacteria 1919
36 Ga0070679_100828399 3300005530 Bacteria 868
37 Ga0070679_101328539 3300005530 Bacteria 665
38 Ga0070684_100397712 3300005535 Bacteria 1270
39 Ga0070672_100007115 3300005543 Bacteria 7568
40 Ga0070665_100000993 3300005548 Bacteria 35947
41 Ga0070665_100230869 3300005548 Bacteria 1850
42 Ga0070704_100293044 3300005549 Bacteria 1353
43 Ga0068855_100025803 3300005563 Bacteria 7028
44 Ga0070664_100006485 3300005564 Bacteria 9431
45 Ga0070664_100677556 3300005564 Bacteria 959
46 Ga0068852_100155573 3300005616 Bacteria 2129
47 Ga0068852_101172794 3300005616 Bacteria 789
48 Ga0068859_100018294 3300005617 Bacteria 7044
49 Ga0068859_100245779 3300005617 Bacteria 1879
50 Ga0068864_100618475 3300005618 Bacteria 1052
51 Ga0068861_100009844 3300005719 Bacteria 6611
52 Ga0068851_10082008 3300005834 Bacteria 1686
53 Ga0068863_100006311 3300005841 Bacteria 11635
54 Ga0068863_100010267 3300005841 Bacteria 9103
55 Ga0068858_100000537 3300005842 Bacteria 39482
56 Ga0068860_100000674 3300005843 Bacteria 39467
57 Ga0068860_100011180 3300005843 Bacteria 8847
58 Ga0068860_100090204 3300005843 Bacteria 2919
59 Ga0068860_101144770 3300005843 Bacteria 798
60 Ga0068862_100000198 3300005844 Bacteria 66534
61 Ga0068862_100005438 3300005844 Bacteria 10643
62 Ga0068862_100134898 3300005844 Bacteria 2187
63 Ga0068862_100940038 3300005844 Bacteria 852
64 Ga0068862_101222194 3300005844 Bacteria 750
65 Ga0081539_10009603 3300005985 Bacteria 8037
66 Ga0081539_10044268 3300005985 Bacteria 2571
67 Ga0097621_100322354 3300006237 Bacteria 1369
68 Ga0068871_100144201 3300006358 Bacteria 2026
69 Ga0075434_100101186 3300006871 Bacteria 2888
70 Ga0097620_100018294 3300006931 Bacteria 7044
71 Ga0097620_100245789 3300006931 Bacteria 1879
72 Ga0105247_10029277 3300009101 Bacteria 3336
73 Ga0105243_10015308 3300009148 Bacteria 5802
74 Ga0105242_10319070 3300009176 Bacteria 1424
75 Ga0105248_10027362 3300009177 Bacteria 6347
76 Ga0105249_10000015 3300009553 Bacteria 282138
77 Ga0105239_10574449 3300010375 Bacteria 1285
78 Ga0157371_10054903 3300013102 Bacteria 2828
79 Ga0157369_10247187 3300013105 Bacteria 1862
80 Ga0157374_10001881 3300013296 Bacteria 17636
81 Ga0157378_10445906 3300013297 Bacteria 1284
82 Ga0157378_10533068 3300013297 Bacteria 1177
83 Ga0157378_11583549 3300013297 Bacteria 701
84 Ga0163162_10000299 3300013306 Bacteria 45521
85 Ga0157375_10002179 3300013308 Bacteria 16935
86 Ga0163163_10033237 3300014325 Bacteria 4989
87 Ga0157377_10577883 3300014745 Bacteria 798
88 Ga0206356_11760932 3300020070 Bacteria 4114
89 Ga0207710_10017344 3300025900 Bacteria 3053
90 Ga0207680_10001898 3300025903 Bacteria 9803
91 Ga0207705_10006793 3300025909 Bacteria 8452
92 Ga0207705_10021870 3300025909 Bacteria 4563
93 Ga0207705_10043093 3300025909 Bacteria 3241
94 Ga0207705_10284101 3300025909 Bacteria 1267
95 Ga0207707_11065361 3300025912 Bacteria 660
96 Ga0207660_10001233 3300025917 Bacteria 17134
97 Ga0207660_10192546 3300025917 Bacteria 1589
98 Ga0207660_10345635 3300025917 Bacteria 1191
99 Ga0207657_10001607 3300025919 Bacteria 24285
100 Ga0207657_10003527 3300025919 Bacteria 16711
101 Ga0207657_10008025 3300025919 Bacteria 10765
102 Ga0207657_10010740 3300025919 Bacteria 9118
103 Ga0207649_10023961 3300025920 Bacteria 3541
104 Ga0207649_10180753 3300025920 Bacteria 1476
105 Ga0207681_10516634 3300025923 Bacteria 980
106 Ga0207650_10002596 3300025925 Bacteria 12498
107 Ga0207659_10455725 3300025926 Bacteria 1078
108 Ga0207644_10060976 3300025931 Bacteria 2730
109 Ga0207644_10150353 3300025931 Bacteria 1801
110 Ga0207690_10810145 3300025932 Bacteria 774
111 Ga0207706_10010364 3300025933 Bacteria 8513
112 Ga0207706_10140375 3300025933 Bacteria 2125
113 Ga0207709_10029925 3300025935 Bacteria 3164
114 Ga0207691_10001938 3300025940 Bacteria 20198
115 Ga0207711_10002376 3300025941 Bacteria 16846
116 Ga0207661_11167775 3300025944 Bacteria 709
117 Ga0207679_10004299 3300025945 Bacteria 8859
118 Ga0207667_10056858 3300025949 Bacteria 4107
119 Ga0207667_10083844 3300025949 Bacteria 3300
120 Ga0207651_10001758 3300025960 Bacteria 10045
121 Ga0207712_10000023 3300025961 Bacteria 282081
122 Ga0207668_11113785 3300025972 Bacteria 708
123 Ga0207668_11335949 3300025972 Bacteria 646
124 Ga0207640_10398371 3300025981 Bacteria 1120
125 Ga0207640_10552768 3300025981 Bacteria 967
126 Ga0207658_10005951 3300025986 Bacteria 8329
127 Ga0207658_11465197 3300025986 Bacteria 624
128 Ga0207677_10325546 3300026023 Bacteria 1279
129 Ga0207703_10006703 3300026035 Bacteria 9188
130 Ga0207678_10199763 3300026067 Bacteria 1709
131 Ga0207641_10004733 3300026088 Bacteria 11734
132 Ga0207641_10022996 3300026088 Bacteria 5134
133 Ga0207676_10002744 3300026095 Bacteria 12538
134 Ga0207676_10227794 3300026095 Bacteria 1664
135 Ga0207674_10009227 3300026116 Bacteria 11305
136 Ga0207675_100049343 3300026118 Bacteria 3929
137 Ga0207683_10003383 3300026121 Bacteria 13909
138 Ga0207683_10760553 3300026121 Bacteria 899
139 Ga0207698_10122355 3300026142 Bacteria 2205
140 Ga0207698_11152465 3300026142 Bacteria 789
141 Ga0268266_10000151 3300028379 Bacteria 132529
142 Ga0268266_10044215 3300028379 Bacteria 3807
143 Ga0268266_10149387 3300028379 Bacteria 2104
144 Ga0268265_10000021 3300028380 Bacteria 272292
145 Ga0268265_10004530 3300028380 Bacteria 9615
146 Ga0268265_10044005 3300028380 Bacteria 3322
147 Ga0268265_11821054 3300028380 Bacteria 615
148 Ga0268264_10000268 3300028381 Bacteria 91477
149 Ga0268264_10000990 3300028381 Bacteria 28980
150 Ga0268264_10154092 3300028381 Bacteria 2063
151 Ga0307515_10260374 3300028794 Bacteria 1472
152 Ga0307513_10030657 3300031456 Bacteria 6107
153 Ga0307408_100031369 3300031548 Bacteria 3701
154 Ga0307408_100209898 3300031548 Bacteria 1582
155 Ga0307413_10013680 3300031824 Bacteria 4090
156 Ga0307413_10138161 3300031824 Bacteria 1679
157 Ga0307413_10681310 3300031824 Bacteria 852
158 Ga0307413_11232229 3300031824 Bacteria 652
159 Ga0307410_10029442 3300031852 Bacteria 3496
160 Ga0307410_10865893 3300031852 Bacteria 772
161 Ga0307406_10280444 3300031901 Bacteria 1271
162 Ga0307406_10376686 3300031901 Bacteria 1117
163 Ga0307412_10656292 3300031911 Bacteria 895
164 Ga0307412_10865038 3300031911 Bacteria 790
165 Ga0307409_100073761 3300031995 Bacteria 2723
166 Ga0307409_100136857 3300031995 Bacteria 2103
167 Ga0307409_100174916 3300031995 Bacteria 1893
168 Ga0307409_100320495 3300031995 Bacteria 1450
169 Ga0307409_100999814 3300031995 Bacteria 854
170 Ga0307416_100457997 3300032002 Bacteria 1330
171 Ga0307416_100583438 3300032002 Bacteria 1195
172 Ga0307416_100724027 3300032002 Bacteria 1086
173 Ga0307414_10054474 3300032004 Bacteria 2796
174 Ga0307414_10077366 3300032004 Bacteria 2421
175 Ga0307414_10094973 3300032004 Bacteria 2227
176 Ga0307414_10566802 3300032004 Bacteria 1014
177 Ga0307414_10571104 3300032004 Bacteria 1010
178 Ga0307414_10614203 3300032004 Bacteria 976
179 Ga0307414_10747079 3300032004 Bacteria 889
180 Ga0307414_10973490 3300032004 Bacteria 780
181 Ga0307411_10005367 3300032005 Bacteria 6286
182 Ga0307411_10147521 3300032005 Bacteria 1743
183 Ga0307411_10514682 3300032005 Bacteria 1014
184 Ga0307411_10660822 3300032005 Bacteria 906
185 Ga0307411_11437192 3300032005 Bacteria 632
186 Ga0307415_100285937 3300032126 Bacteria 1358
187 Ga0307415_100291199 3300032126 Bacteria 1348
188 Ga0395899_0261388 3300037312 Bacteria 1184
189 Ga0395899_0273958 3300037312 Bacteria 1150
190 Ga0395899_0622837 3300037312 Bacteria 685
191 Ga0395900_0003608 3300037418 Bacteria 16633
192 Ga0395900_0662822 3300037418 Bacteria 979
193 Ga0395898_0245424 3300037466 Bacteria 1708
194 Ga0395905_0285085 3300037471 Bacteria 1538
195 Ga0395901_0000086 3300038443 Bacteria 125359
196 Ga0395901_0465642 3300038443 Bacteria 1291
197 Ga0395901_0557305 3300038443 Bacteria 1161
198 Ga0436365_0669308 3300039437 Bacteria 1645
199 Ga0439464_0000958 3300042439 Bacteria 6532
200 Ga0466965_0247078 3300044683 Bacteria 956
201 Ga0466967_0207321 3300045976 Bacteria 1858
202 Ga0495642_0022743 3300046528 Bacteria 2471
203 Ga0495669_0003634 3300046684 Bacteria 6352
204 Ga0495669_0024914 3300046684 Bacteria 2606
205 Ga0495669_0254422 3300046684 Bacteria 843
206 Ga0496101_0017535 3300048904 Bacteria 4857
207 Ga0496101_0057451 3300048904 Bacteria 2814
208 Ga0496102_0844454 3300048905 Bacteria 838
209 Ga0496102_0959664 3300048905 Bacteria 776
210 Ga0496107_0057144 3300048910 Bacteria 2820
211 Ga0496108_0030953 3300048911 Bacteria 4435
212 Ga0496109_0003663 3300048912 Bacteria 12843
213 Ga0496110_0003659 3300048913 Bacteria 11829
214 Ga0496110_0051556 3300048913 Bacteria 3616
215 Ga0496111_0003208 3300048914 Bacteria 10095
216 Ga0496111_0057573 3300048914 Bacteria 2814
217 Ga0496112_0001853 3300048915 Bacteria 16628
218 Ga0496113_0007569 3300048916 Bacteria 7004
219 Ga0496114_0452358 3300048917 Bacteria 1137
220 Ga0496115_0452111 3300048918 Bacteria 1037
221 Ga0501298_070793 3300049521 Bacteria 752
222 nmdc:mga0n895_102397_c1 3300050512 Bacteria 2874
223 Ga0070673_100673001
224 JGI24752J21851_1002399
225 JGI24735J21928_10016800
226 Ga0070658_10003256
227 Ga0070658_10017917
228 Ga0070658_10353444
229 Ga0070683_100253160
230 Ga0070690_100265911
231 Ga0070690_100363345
232 Ga0070690_100683282
233 Ga0070670_100008911
234 Ga0070670_100042900
235 Ga0070666_10001711
236 Ga0070680_100105083
237 Ga0070682_100092978
238 Ga0070660_100004418
239 Ga0070660_100126014
240 Ga0070689_100631976
241 Ga0070661_100004957
242 Ga0070661_100200946
243 Ga0070661_100957612
244 Ga0070692_10033654
245 Ga0070668_100291607
246 Ga0070668_100868019
247 Ga0070675_100047720
248 Ga0070671_100332856
249 Ga0070671_100575336
250 Ga0070673_100090983
251 Ga0070667_100008602
252 Ga0070667_100336501
253 Ga0070694_100000922
254 Ga0070678_100003096
255 Ga0070662_100010236
256 Ga0070662_100509510
257 Ga0070681_10199606
258 Ga0070679_100828399
259 Ga0070679_101328539
260 Ga0070684_100397712
261 Ga0070672_100007115
262 Ga0070665_100000993
263 Ga0070665_100230869
264 Ga0070704_100293044
265 Ga0068855_100025803
266 Ga0070664_100006485
267 Ga0070664_100677556
268 Ga0068852_100155573
269 Ga0068852_101172794
270 Ga0068859_100018294
271 Ga0068859_100245779
272 Ga0068864_100618475
273 Ga0068861_100009844
274 Ga0068851_10082008
275 Ga0068863_100006311
276 Ga0068863_100010267
277 Ga0068858_100000537
278 Ga0068860_100000674
279 Ga0068860_100011180
280 Ga0068860_100090204
281 Ga0068860_101144770
282 Ga0068862_100000198
283 Ga0068862_100005438
284 Ga0068862_100134898
285 Ga0068862_100940038
286 Ga0068862_101222194
287 Ga0081539_10009603
288 Ga0081539_10044268
289 Ga0097621_100322354
290 Ga0068871_100144201
291 Ga0075434_100101186
292 Ga0097620_100018294
293 Ga0097620_100245789
294 Ga0105247_10029277
295 Ga0105243_10015308
296 Ga0105242_10319070
297 Ga0105248_10027362
298 Ga0105249_10000015
299 Ga0105239_10574449
300 Ga0157371_10054903
301 Ga0157369_10247187
302 Ga0157374_10001881
303 Ga0157378_10445906
304 Ga0157378_10533068
305 Ga0157378_11583549
306 Ga0163162_10000299
307 Ga0157375_10002179
308 Ga0163163_10033237
309 Ga0157377_10577883
310 Ga0206356_11760932
311 Ga0207710_10017344
312 Ga0207680_10001898
313 Ga0207705_10006793
314 Ga0207705_10021870
315 Ga0207705_10043093
316 Ga0207705_10284101
317 Ga0207707_11065361
318 Ga0207660_10001233
319 Ga0207660_10192546
320 Ga0207660_10345635
321 Ga0207657_10001607
322 Ga0207657_10003527
323 Ga0207657_10008025
324 Ga0207657_10010740
325 Ga0207649_10023961
326 Ga0207649_10180753
327 Ga0207681_10516634
328 Ga0207650_10002596
329 Ga0207659_10455725
330 Ga0207644_10060976
331 Ga0207644_10150353
332 Ga0207690_10810145
333 Ga0207706_10010364
334 Ga0207706_10140375
335 Ga0207709_10029925
336 Ga0207691_10001938
337 Ga0207711_10002376
338 Ga0207661_11167775
339 Ga0207679_10004299
340 Ga0207667_10056858
341 Ga0207667_10083844
342 Ga0207651_10001758
343 Ga0207712_10000023
344 Ga0207668_11113785
345 Ga0207668_11335949
346 Ga0207640_10398371
347 Ga0207640_10552768
348 Ga0207658_10005951
349 Ga0207658_11465197
350 Ga0207677_10325546
351 Ga0207703_10006703
352 Ga0207678_10199763
353 Ga0207641_10004733
354 Ga0207641_10022996
355 Ga0207676_10002744
356 Ga0207676_10227794
357 Ga0207674_10009227
358 Ga0207675_100049343
359 Ga0207683_10003383
360 Ga0207683_10760553
361 Ga0207698_10122355
362 Ga0207698_11152465
363 Ga0268266_10000151
364 Ga0268266_10044215
365 Ga0268266_10149387
366 Ga0268265_10000021
367 Ga0268265_10004530
368 Ga0268265_10044005
369 Ga0268265_11821054
370 Ga0268264_10000268
371 Ga0268264_10000990
372 Ga0268264_10154092
373 Ga0307515_10260374
374 Ga0307513_10030657
375 Ga0307408_100031369
376 Ga0307408_100209898
377 Ga0307413_10013680
378 Ga0307413_10138161
379 Ga0307413_10681310
380 Ga0307413_11232229
381 Ga0307410_10029442
382 Ga0307410_10865893
383 Ga0307406_10280444
384 Ga0307406_10376686
385 Ga0307412_10656292
386 Ga0307412_10865038
387 Ga0307409_100073761
388 Ga0307409_100136857
389 Ga0307409_100174916
390 Ga0307409_100320495
391 Ga0307409_100999814
392 Ga0307416_100457997
393 Ga0307416_100583438
394 Ga0307416_100724027
395 Ga0307414_10054474
396 Ga0307414_10077366
397 Ga0307414_10094973
398 Ga0307414_10566802
399 Ga0307414_10571104
400 Ga0307414_10614203
401 Ga0307414_10747079
402 Ga0307414_10973490
403 Ga0307411_10005367
404 Ga0307411_10147521
405 Ga0307411_10514682
406 Ga0307411_10660822
407 Ga0307411_11437192
408 Ga0307415_100285937
409 Ga0307415_100291199
410 Ga0395899_0261388
411 Ga0395899_0273958
412 Ga0395899_0622837
413 Ga0395900_0003608
414 Ga0395900_0662822
415 Ga0395898_0245424
416 Ga0395905_0285085
417 Ga0395901_0000086
418 Ga0395901_0465642
419 Ga0395901_0557305
420 Ga0436365_0669308
421 Ga0439464_0000958
422 Ga0466965_0247078
423 Ga0466967_0207321
424 Ga0495642_0022743
425 Ga0495669_0003634
426 Ga0495669_0024914
427 Ga0495669_0254422
428 Ga0496101_0017535
429 Ga0496101_0057451
430 Ga0496102_0844454
431 Ga0496102_0959664
432 Ga0496107_0057144
433 Ga0496108_0030953
434 Ga0496109_0003663
435 Ga0496110_0003659
436 Ga0496110_0051556
437 Ga0496111_0003208
438 Ga0496111_0057573
439 Ga0496112_0001853
440 Ga0496113_0007569
441 Ga0496114_0452358
442 Ga0496115_0452111
443 Ga0501298_070793
444 nmdc:mga0n895_102397_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06041

DUF924

Bacterial protein of unknown function (DUF924)

26

198

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.9322 1 173
2i6h-assembly1.cif.gz_B structure of protein of unknown function atu0120 from agrobacterium tumefaciens 0.907 1 173
3htm-assembly2.cif.gz_D structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: spopbtb/3-box 0.556 83 148
4epz-assembly1.cif.gz_A crystal structure of a transcription anti-terminator antagonist upxz (bacuni_04315) from bacteroides uniformis atcc 8492 at 1.68 a resolution 0.5109 1 152
1nzn-assembly1.cif.gz_A cytosolic domain of the human mitchondrial fission protein fis1 adopts a tpr fold 0.5055 29 150
ID Description Score Start End Superfamily
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9145 82 173 1.25.40.10
2i6hB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;TPR-like 0.8936 1 78 1.20.58.320
2i6hB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;TPR-like 0.8745 1 78 1.20.58.320
2i6hB02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8615 82 173 1.25.40.10
af_Q8IE63_5_138_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6123 83 163 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A6P1B4G9-F1-model_v4 deleted 0.9941 73 156
AF-A0A7H0G792-F1-model_v4 deleted 0.9896 3 179
AF-A0A3R9WQS9-F1-model_v4 DUF924 domain-containing protein 0.9884 11 179
AF-A0A2M7SRF1-F1-model_v4 DUF924 domain-containing protein 0.9851 5 84
AF-A0A4P6FN69-F1-model_v4 DUF924 domain-containing protein 0.9834 5 179

Map