F334101

General Info

Members Datasets Scaffolds Average Seq Length
222 138 444 257

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100738258|Ga0070683_1007382581
Length 266
Sequence MSLTPASCPRHTAELDELGYTSLPNWAPADLLAELRATVARLYAIEGNNAGSEFRQEPGCLRLANLVDKGAVFLRVIAAPAMLELVRHVIGPDFKLSSLNCRTALPGSTPQPLHADMGGVADERGNWVCNIIWMLDDYTPDNGPLRVVPGSHRWRRLPQSELPELRATHPAERTVTAPAGSVVVMNSHLWHGGLDNHTLGNRTSLHAFYCRRDKPQQQYQKQLLRPEVQASLSADLRHLLALDDPLNDELAKSSAPRSGFLPERAR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
88 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
89 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
90 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
91 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
92 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
111 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
112 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
113 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
137 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0
Rhizoplane 8.11
Rhizosphere 86.49
Stem 0
Stem Tuber 0
Unclassified 19.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100738258 3300005329 Unclassified 943
2 Ga0065712_10069874 3300005290 Bacteria 6587
3 Ga0065712_10088089 3300005290 Bacteria 2539
4 Ga0065715_10003009 3300005293 Bacteria 6593
5 Ga0065715_10112332 3300005293 Bacteria 2534
6 Ga0065715_10316598 3300005293 Bacteria 1010
7 Ga0070683_100003321 3300005329 Bacteria 13007
8 Ga0070683_100103675 3300005329 Bacteria 2681
9 Ga0070670_100000682 3300005331 Bacteria 26393
10 Ga0070670_100037120 3300005331 Bacteria 4192
11 Ga0070670_100102791 3300005331 Bacteria 2461
12 Ga0070666_10023631 3300005335 Bacteria 4002
13 Ga0070680_100297919 3300005336 Unclassified 1367
14 Ga0070675_100083597 3300005354 Bacteria 2665
15 Ga0070675_100304034 3300005354 Bacteria 1406
16 Ga0070675_100460021 3300005354 Bacteria 1142
17 Ga0070671_100377754 3300005355 Bacteria 1211
18 Ga0070674_100188666 3300005356 Bacteria 1584
19 Ga0070659_100033614 3300005366 Bacteria 3984
20 Ga0070659_100500873 3300005366 Bacteria 1035
21 Ga0070667_100065846 3300005367 Bacteria 3077
22 Ga0070700_100073238 3300005441 Bacteria 2192
23 Ga0070694_100188441 3300005444 Bacteria 1530
24 Ga0070663_100016739 3300005455 Bacteria 4771
25 Ga0070663_100097466 3300005455 Unclassified 2189
26 Ga0070707_100647655 3300005468 Bacteria 1019
27 Ga0070698_100405677 3300005471 Bacteria 1296
28 Ga0070679_100881851 3300005530 Unclassified 838
29 Ga0070684_100000584 3300005535 Bacteria 25309
30 Ga0070684_100067485 3300005535 Bacteria 3142
31 Ga0070684_100134384 3300005535 Bacteria 2233
32 Ga0068853_100008455 3300005539 Bacteria 8269
33 Ga0070672_100320604 3300005543 Unclassified 1317
34 Ga0070686_100303524 3300005544 Bacteria 1185
35 Ga0070665_100067173 3300005548 Bacteria 3596
36 Ga0070665_100071761 3300005548 Bacteria 3469
37 Ga0070704_100425557 3300005549 Bacteria 1138
38 Ga0070664_100014637 3300005564 Bacteria 6402
39 Ga0070664_100031265 3300005564 Bacteria 4447
40 Ga0068857_100676438 3300005577 Bacteria 979
41 Ga0068861_100458454 3300005719 Unclassified 1144
42 Ga0068870_10125469 3300005840 Unclassified 1484
43 Ga0068862_100324467 3300005844 Unclassified 1422
44 Ga0075367_10038421 3300006178 Unclassified 2786
45 Ga0075366_10329712 3300006195 Bacteria 935
46 Ga0075370_10094135 3300006353 Unclassified 1729
47 Ga0075428_100000516 3300006844 Bacteria 39215
48 Ga0075428_100002345 3300006844 Bacteria 20548
49 Ga0075428_100169501 3300006844 Unclassified 2367
50 Ga0075428_100557237 3300006844 Unclassified 1225
51 Ga0075430_100002150 3300006846 Bacteria 16313
52 Ga0075430_100023694 3300006846 Bacteria 5227
53 Ga0075431_100018705 3300006847 Bacteria 7059
54 Ga0075431_100023392 3300006847 Bacteria 6321
55 Ga0075431_100087903 3300006847 Unclassified 3207
56 Ga0075431_100275013 3300006847 Bacteria 1706
57 Ga0075431_100328421 3300006847 Bacteria 1541
58 Ga0075433_10004663 3300006852 Bacteria 10689
59 Ga0075433_10053011 3300006852 Bacteria 3535
60 Ga0075434_100014085 3300006871 Bacteria 7637
61 Ga0075434_100086549 3300006871 Unclassified 3134
62 Ga0075429_100008396 3300006880 Bacteria 8989
63 Ga0075429_100068555 3300006880 Unclassified 3087
64 Ga0075429_100192778 3300006880 Unclassified 1785
65 Ga0068865_100291594 3300006881 Bacteria 1303
66 Ga0075435_100275417 3300007076 Unclassified 1436
67 Ga0075435_100315428 3300007076 Bacteria 1338
68 Ga0105240_10001077 3300009093 Bacteria 48224
69 Ga0105240_10345736 3300009093 Unclassified 1688
70 Ga0111539_10008029 3300009094 Bacteria 13459
71 Ga0111539_10009433 3300009094 Bacteria 12315
72 Ga0111539_10033895 3300009094 Bacteria 6196
73 Ga0111539_10079574 3300009094 Bacteria 3855
74 Ga0111539_10082384 3300009094 Bacteria 3784
75 Ga0111539_10119030 3300009094 Bacteria 3095
76 Ga0111539_10209822 3300009094 Bacteria 2270
77 Ga0114129_10000558 3300009147 Bacteria 45754
78 Ga0114129_10007820 3300009147 Bacteria 15210
79 Ga0114129_10010446 3300009147 Bacteria 13241
80 Ga0114129_10019698 3300009147 Bacteria 9604
81 Ga0114129_10241428 3300009147 Bacteria 2429
82 Ga0105248_10014123 3300009177 Bacteria 8790
83 Ga0105248_10475542 3300009177 Bacteria 1408
84 Ga0105237_10001337 3300009545 Bacteria 32686
85 Ga0105237_10105312 3300009545 Bacteria 2812
86 Ga0105249_10084234 3300009553 Bacteria 2961
87 Ga0157369_10281238 3300013105 Bacteria 1733
88 Ga0157374_10186018 3300013296 Unclassified 2031
89 Ga0163162_10589885 3300013306 Unclassified 1238
90 Ga0163163_10004015 3300014325 Bacteria 12551
91 Ga0163163_10361814 3300014325 Bacteria 1507
92 Ga0157380_10051499 3300014326 Bacteria 3256
93 Ga0213873_10003551 3300021358 Bacteria 2818
94 Ga0213874_10046701 3300021377 Bacteria 1315
95 Ga0213876_10001062 3300021384 Bacteria 17721
96 Ga0207697_10003106 3300025315 Bacteria 8305
97 Ga0207688_10054223 3300025901 Unclassified 2249
98 Ga0207695_10010981 3300025913 Bacteria 11006
99 Ga0207671_10006084 3300025914 Bacteria 10864
100 Ga0207650_10010830 3300025925 Bacteria 6266
101 Ga0207650_10032789 3300025925 Bacteria 3759
102 Ga0207659_10538645 3300025926 Bacteria 991
103 Ga0207644_10463609 3300025931 Unclassified 1042
104 Ga0207669_10117062 3300025937 Bacteria 1800
105 Ga0207669_10252117 3300025937 Bacteria 1315
106 Ga0207691_10241363 3300025940 Unclassified 1562
107 Ga0207711_10782563 3300025941 Unclassified 889
108 Ga0207661_10011149 3300025944 Bacteria 6500
109 Ga0207661_10094707 3300025944 Bacteria 2495
110 Ga0207679_10013327 3300025945 Bacteria 5385
111 Ga0207679_10014915 3300025945 Bacteria 5120
112 Ga0207712_10023671 3300025961 Unclassified 4057
113 Ga0207712_10049560 3300025961 Bacteria 2927
114 Ga0207658_10082488 3300025986 Unclassified 2469
115 Ga0207639_10018763 3300026041 Bacteria 4919
116 Ga0207678_10029596 3300026067 Bacteria 4781
117 Ga0207708_10110100 3300026075 Bacteria 2137
118 Ga0207708_10182095 3300026075 Bacteria 1668
119 Ga0207675_100059826 3300026118 Bacteria 3556
120 Ga0207675_100086082 3300026118 Bacteria 2950
121 Ga0209971_1036548 3300027682 Bacteria 1182
122 Ga0207428_10007354 3300027907 Bacteria 10054
123 Ga0207428_10007482 3300027907 Bacteria 9954
124 Ga0207428_10345030 3300027907 Unclassified 1096
125 Ga0307408_100022462 3300031548 Bacteria 4287
126 Ga0307408_100022769 3300031548 Bacteria 4261
127 Ga0307408_100178888 3300031548 Unclassified 1699
128 Ga0307405_10041157 3300031731 Bacteria 2803
129 Ga0307412_10072486 3300031911 Unclassified 2354
130 Ga0307412_10239148 3300031911 Bacteria 1403
131 Ga0307412_10662235 3300031911 Unclassified 892
132 Ga0307409_100268632 3300031995 Bacteria 1569
133 Ga0307416_100152552 3300032002 Bacteria 2121
134 Ga0307411_10074836 3300032005 Unclassified 2310
135 Ga0307411_10267497 3300032005 Unclassified 1354
136 Ga0307415_100041033 3300032126 Bacteria 3070
137 Ga0307415_100063293 3300032126 Bacteria 2570
138 Ga0373946_0077849 3300035171 Unclassified 1446
139 Ga0373947_0154311 3300035725 Bacteria 1481
140 Ga0436364_0086934 3300037853 Bacteria 4451
141 Ga0436364_0421285 3300037853 Bacteria 1889
142 Ga0436365_0562191 3300039437 Bacteria 1286
143 Ga0436365_0586608 3300039437 Bacteria 17582
144 Ga0436363_1052525 3300039450 Bacteria 2318
145 Ga0436362_0014873 3300039453 Bacteria 7006
146 Ga0439461_0002747 3300041410 Bacteria 2844
147 Ga0451807_1954112 3300041486 Bacteria 1111
148 Ga0439450_002674 3300042008 Bacteria 2838
149 Ga0439454_002538 3300042011 Bacteria 1939
150 Ga0450923_018944 3300042125 Unclassified 1322
151 Ga0450896_001907 3300042133 Bacteria 2642
152 Ga0451577_0040349 3300042876 Bacteria 4191
153 Ga0466966_0250120 3300044684 Unclassified 1068
154 Ga0453684_0517951 3300044712 Bacteria 1318
155 Ga0451576_0350349 3300045051 Bacteria 1546
156 Ga0495629_0232126 3300046459 Bacteria 1272
157 Ga0495580_0273765 3300046472 Unclassified 1152
158 Ga0496102_0029440 3300048905 Bacteria 4913
159 Ga0496104_0032723 3300048907 Unclassified 4840
160 Ga0496107_0134082 3300048910 Bacteria 1830
161 Ga0496107_0626252 3300048910 Unclassified 794
162 Ga0496108_0134526 3300048911 Bacteria 2126
163 Ga0496108_0178881 3300048911 Unclassified 1836
164 Ga0496108_0289652 3300048911 Bacteria 1426
165 Ga0496109_0008154 3300048912 Bacteria 8884
166 Ga0496110_0044151 3300048913 Bacteria 3892
167 Ga0496110_0135279 3300048913 Bacteria 2227
168 Ga0496110_0464310 3300048913 Bacteria 1154
169 Ga0496111_0004288 3300048914 Bacteria 8987
170 Ga0496112_0009202 3300048915 Bacteria 8878
171 Ga0496113_0097088 3300048916 Bacteria 2279
172 Ga0496113_0392492 3300048916 Bacteria 1114
173 Ga0496114_0309258 3300048917 Bacteria 1396
174 Ga0496115_0124836 3300048918 Bacteria 2120
175 Ga0501295_045626 3300049518 Bacteria 924
176 Ga0501298_016933 3300049521 Bacteria 1326
177 Ga0501299_001418 3300049522 Bacteria 3079
178 Ga0501299_011903 3300049522 Bacteria 1476
179 Ga0501300_018402 3300049523 Bacteria 1020
180 Ga0501040_0031967 3300049576 Bacteria 3559
181 Ga0501071_0037386 3300049587 Bacteria 3467
182 Ga0501072_0301782 3300049588 Bacteria 1273
183 Ga0501073_0113707 3300049589 Bacteria 1877
184 Ga0501075_0013918 3300049591 Bacteria 5755
185 Ga0501076_0123193 3300049592 Bacteria 2100
186 Ga0501076_0586334 3300049592 Bacteria 920
187 Ga0501077_0359834 3300049593 Bacteria 929
188 Ga0501249_036830 3300049679 Bacteria 1103
189 Ga0501079_0048543 3300049741 Bacteria 3276
190 Ga0501079_0061493 3300049741 Bacteria 2897
191 Ga0501045_0399615 3300049824 Bacteria 1023
192 nmdc:mga0k408_54214_c1 3300050493 Unclassified 2324
193 nmdc:mga07m45_26427_c2 3300050496 Bacteria 2773
194 nmdc:mga05p37_120890_c1 3300050507 Bacteria 3217
195 nmdc:mga05p37_14758_c1 3300050507 Bacteria 9383
196 nmdc:mga05p37_1526_c1 3300050507 Bacteria 22128
197 nmdc:mga05p37_436_c1 3300050507 Bacteria 45285
198 nmdc:mga05p37_52726_c1 3300050507 Bacteria 5001
199 nmdc:mga09592_138004_c1 3300050508 Unclassified 2101
200 nmdc:mga09592_7365_c1 3300050508 Bacteria 8946
201 nmdc:mga0qj67_10648_c1 3300050509 Bacteria 6872
202 nmdc:mga0qj67_8777_c1 3300050509 Bacteria 7502
203 nmdc:mga06r32_104599_c2 3300050510 Bacteria 1616
204 nmdc:mga06r32_117527_c1 3300050510 Bacteria 2621
205 nmdc:mga06r32_18729_c1 3300050510 Bacteria 6344
206 nmdc:mga06r32_32306_c1 3300050510 Bacteria 4924
207 nmdc:mga08y16_14650_c1 3300050511 Bacteria 8246
208 nmdc:mga08y16_1779_c1 3300050511 Bacteria 21818
209 nmdc:mga08y16_190741_c1 3300050511 Unclassified 2126
210 nmdc:mga08y16_85997_c1 3300050511 Bacteria 3277
211 nmdc:mga08y16_88936_c1 3300050511 Bacteria 3218
212 nmdc:mga0n895_334257_c1 3300050512 Unclassified 1535
213 nmdc:mga0n895_41108_c1 3300050512 Bacteria 4494
214 nmdc:mga0rr50_294099_c1 3300050513 Unclassified 1357
215 nmdc:mga0a205_17870_c1 3300050515 Bacteria 6655
216 nmdc:mga0a205_4518_c2 3300050515 Bacteria 11310
217 Ga0590071_009655 3300059421 Bacteria 2265
218 Ga0590074_036913 3300059423 Bacteria 873
219 Ga0590075_000138 3300059424 Bacteria 19114
220 Ga0590075_012586 3300059424 Bacteria 2056
221 Ga0590077_000077 3300059426 Bacteria 24876
222 Ga0501082_0055860 3300060353 Bacteria 3401
223 Ga0070683_100738258
224 Ga0065712_10069874
225 Ga0065712_10088089
226 Ga0065715_10003009
227 Ga0065715_10112332
228 Ga0065715_10316598
229 Ga0070683_100003321
230 Ga0070683_100103675
231 Ga0070670_100000682
232 Ga0070670_100037120
233 Ga0070670_100102791
234 Ga0070666_10023631
235 Ga0070680_100297919
236 Ga0070675_100083597
237 Ga0070675_100304034
238 Ga0070675_100460021
239 Ga0070671_100377754
240 Ga0070674_100188666
241 Ga0070659_100033614
242 Ga0070659_100500873
243 Ga0070667_100065846
244 Ga0070700_100073238
245 Ga0070694_100188441
246 Ga0070663_100016739
247 Ga0070663_100097466
248 Ga0070707_100647655
249 Ga0070698_100405677
250 Ga0070679_100881851
251 Ga0070684_100000584
252 Ga0070684_100067485
253 Ga0070684_100134384
254 Ga0068853_100008455
255 Ga0070672_100320604
256 Ga0070686_100303524
257 Ga0070665_100067173
258 Ga0070665_100071761
259 Ga0070704_100425557
260 Ga0070664_100014637
261 Ga0070664_100031265
262 Ga0068857_100676438
263 Ga0068861_100458454
264 Ga0068870_10125469
265 Ga0068862_100324467
266 Ga0075367_10038421
267 Ga0075366_10329712
268 Ga0075370_10094135
269 Ga0075428_100000516
270 Ga0075428_100002345
271 Ga0075428_100169501
272 Ga0075428_100557237
273 Ga0075430_100002150
274 Ga0075430_100023694
275 Ga0075431_100018705
276 Ga0075431_100023392
277 Ga0075431_100087903
278 Ga0075431_100275013
279 Ga0075431_100328421
280 Ga0075433_10004663
281 Ga0075433_10053011
282 Ga0075434_100014085
283 Ga0075434_100086549
284 Ga0075429_100008396
285 Ga0075429_100068555
286 Ga0075429_100192778
287 Ga0068865_100291594
288 Ga0075435_100275417
289 Ga0075435_100315428
290 Ga0105240_10001077
291 Ga0105240_10345736
292 Ga0111539_10008029
293 Ga0111539_10009433
294 Ga0111539_10033895
295 Ga0111539_10079574
296 Ga0111539_10082384
297 Ga0111539_10119030
298 Ga0111539_10209822
299 Ga0114129_10000558
300 Ga0114129_10007820
301 Ga0114129_10010446
302 Ga0114129_10019698
303 Ga0114129_10241428
304 Ga0105248_10014123
305 Ga0105248_10475542
306 Ga0105237_10001337
307 Ga0105237_10105312
308 Ga0105249_10084234
309 Ga0157369_10281238
310 Ga0157374_10186018
311 Ga0163162_10589885
312 Ga0163163_10004015
313 Ga0163163_10361814
314 Ga0157380_10051499
315 Ga0213873_10003551
316 Ga0213874_10046701
317 Ga0213876_10001062
318 Ga0207697_10003106
319 Ga0207688_10054223
320 Ga0207695_10010981
321 Ga0207671_10006084
322 Ga0207650_10010830
323 Ga0207650_10032789
324 Ga0207659_10538645
325 Ga0207644_10463609
326 Ga0207669_10117062
327 Ga0207669_10252117
328 Ga0207691_10241363
329 Ga0207711_10782563
330 Ga0207661_10011149
331 Ga0207661_10094707
332 Ga0207679_10013327
333 Ga0207679_10014915
334 Ga0207712_10023671
335 Ga0207712_10049560
336 Ga0207658_10082488
337 Ga0207639_10018763
338 Ga0207678_10029596
339 Ga0207708_10110100
340 Ga0207708_10182095
341 Ga0207675_100059826
342 Ga0207675_100086082
343 Ga0209971_1036548
344 Ga0207428_10007354
345 Ga0207428_10007482
346 Ga0207428_10345030
347 Ga0307408_100022462
348 Ga0307408_100022769
349 Ga0307408_100178888
350 Ga0307405_10041157
351 Ga0307412_10072486
352 Ga0307412_10239148
353 Ga0307412_10662235
354 Ga0307409_100268632
355 Ga0307416_100152552
356 Ga0307411_10074836
357 Ga0307411_10267497
358 Ga0307415_100041033
359 Ga0307415_100063293
360 Ga0373946_0077849
361 Ga0373947_0154311
362 Ga0436364_0086934
363 Ga0436364_0421285
364 Ga0436365_0562191
365 Ga0436365_0586608
366 Ga0436363_1052525
367 Ga0436362_0014873
368 Ga0439461_0002747
369 Ga0451807_1954112
370 Ga0439450_002674
371 Ga0439454_002538
372 Ga0450923_018944
373 Ga0450896_001907
374 Ga0451577_0040349
375 Ga0466966_0250120
376 Ga0453684_0517951
377 Ga0451576_0350349
378 Ga0495629_0232126
379 Ga0495580_0273765
380 Ga0496102_0029440
381 Ga0496104_0032723
382 Ga0496107_0134082
383 Ga0496107_0626252
384 Ga0496108_0134526
385 Ga0496108_0178881
386 Ga0496108_0289652
387 Ga0496109_0008154
388 Ga0496110_0044151
389 Ga0496110_0135279
390 Ga0496110_0464310
391 Ga0496111_0004288
392 Ga0496112_0009202
393 Ga0496113_0097088
394 Ga0496113_0392492
395 Ga0496114_0309258
396 Ga0496115_0124836
397 Ga0501295_045626
398 Ga0501298_016933
399 Ga0501299_001418
400 Ga0501299_011903
401 Ga0501300_018402
402 Ga0501040_0031967
403 Ga0501071_0037386
404 Ga0501072_0301782
405 Ga0501073_0113707
406 Ga0501075_0013918
407 Ga0501076_0123193
408 Ga0501076_0586334
409 Ga0501077_0359834
410 Ga0501249_036830
411 Ga0501079_0048543
412 Ga0501079_0061493
413 Ga0501045_0399615
414 nmdc:mga0k408_54214_c1
415 nmdc:mga07m45_26427_c2
416 nmdc:mga05p37_120890_c1
417 nmdc:mga05p37_14758_c1
418 nmdc:mga05p37_1526_c1
419 nmdc:mga05p37_436_c1
420 nmdc:mga05p37_52726_c1
421 nmdc:mga09592_138004_c1
422 nmdc:mga09592_7365_c1
423 nmdc:mga0qj67_10648_c1
424 nmdc:mga0qj67_8777_c1
425 nmdc:mga06r32_104599_c2
426 nmdc:mga06r32_117527_c1
427 nmdc:mga06r32_18729_c1
428 nmdc:mga06r32_32306_c1
429 nmdc:mga08y16_14650_c1
430 nmdc:mga08y16_1779_c1
431 nmdc:mga08y16_190741_c1
432 nmdc:mga08y16_85997_c1
433 nmdc:mga08y16_88936_c1
434 nmdc:mga0n895_334257_c1
435 nmdc:mga0n895_41108_c1
436 nmdc:mga0rr50_294099_c1
437 nmdc:mga0a205_17870_c1
438 nmdc:mga0a205_4518_c2
439 Ga0590071_009655
440 Ga0590074_036913
441 Ga0590075_000138
442 Ga0590075_012586
443 Ga0590077_000077
444 Ga0501082_0055860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05721

PhyH

Phytanoyl-CoA dioxygenase (PhyH)

15

204

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7de0-assembly1.cif.gz_C crystal structure of ftmox1 y224f mutation 0.8739 1 235
5ybl-assembly1.cif.gz_D fe(ii)/(alpha)ketoglutarate-dependent dioxygenase ause 0.8602 1 235
5zm2-assembly2.cif.gz_D-2 fe(ii)/(alpha)ketoglutarate-dependent dioxygenase anda 0.8591 1 235
7wsb-assembly3.cif.gz_E the ternary complex structure of ftmox1 with a-ketoglutarate and 13-oxo-fumitremorgin b 0.8538 1 235
7etl-assembly1.cif.gz_B the crystal structure of ftmox1-y68f 0.8533 1 235
ID Description Score Start End Superfamily
4zonA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.864 1 235 2.60.120.620
5zm2D00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8591 1 235 2.60.120.620
af_P9WI89_1_263_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8425 2 235 2.60.120.620
af_P47181_36_316_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8243 2 235 2.60.120.620
5ep9C00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.8131 2 208 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A7Y4UM09-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9797 3 199 GO:0005506
GO:0016706
AF-A0A2V9I700-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9779 1 193 GO:0005506
GO:0016706
AF-A0A3B8PPC6-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9719 3 257 GO:0005506
GO:0016706
AF-A0A2V9I700-F1-model_v4 Phytanoyl-CoA dioxygenase 0.968 1 193 GO:0005506
GO:0016706
AF-A0A6L7JEH4-F1-model_v4 Phytanoyl-CoA dioxygenase family protein 0.9641 4 237 GO:0005506
GO:0016706

Map