F333961

General Info

Members Datasets Scaffolds Average Seq Length
221 172 442 489

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954759201|2954763865
Length 539
Sequence PAWEPPHRQSRLVPRKPARPTKGTDTWNGVRSSGAGAAAIAAVATAACDSGGSADAAQSTVGQSLSSRTPAAAAANWSALARDLDGPLLRPGDANWPTARQLYNTRFDSLKPAAVAYVAHPDDIRTALAYARAHGVRVAIRNGGHSYAGWSSGNNRLIVDVSKLNRVRASGGTAVVGAGAKLIDVYRALTAKGVTIPAGSCPTVGVSGLVLGGGHGVASRAYGLTCDSLTQATLITADGKQLTADASTHPDLFWALRGAGNGNFGVVTELHFRTHPAPQGVTAYATWPWSKAAAVVRAWQEWGPSQPDEIWSSCHLENAGSPSVAVAAFSLGTYGELQNALDRLADKVGSPARSVTLRRHSYESAMEAYAGCSSFSTDAKCHLPGSTPNRDPRGALGRETYAAHSDFFDRSIPAAGVQTLLRQISAVRGGSGSIALTALGGAVNRVSPTATAFVHRRSRMLAQYIGSWRAGTTGTAARSWLTGAHDAMQPYASGAAYQNYTDPTLRDWRKAYYGDAATKLAKVKKQYDPQGFFTFPQAL

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
4 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
5 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
6 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
7 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
8 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
9 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
10 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
11 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
12 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
13 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
16 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
17 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
18 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
19 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
20 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
21 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
22 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
23 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
24 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
25 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
26 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
27 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
28 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
29 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
30 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
31 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
32 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
33 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
34 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
35 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
36 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
37 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
38 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
39 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
43 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
44 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
45 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
46 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
47 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
48 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
49 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
52 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
53 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
54 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
55 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
56 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
57 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
58 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
59 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
60 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
61 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
62 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
63 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
64 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
68 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
69 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
72 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
75 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
76 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
81 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
89 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
98 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
99 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
102 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
121 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
122 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
125 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
126 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
127 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
128 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
129 2643221647 Streptomyces sp. Root369 Isolate Unclassified
130 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
131 2643221714 Streptomyces sp. Root264 Isolate Unclassified
132 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
133 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
134 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
135 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
136 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
137 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
138 2808606448 Streptomyces sp. 193411 Isolate Unclassified
139 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
140 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
141 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
142 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
143 2862574272 Streptomyces sp. AcE210 Isolate Nodule
144 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
145 2867428634 Streptomyces sp. RP5T Isolate Unclassified
146 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
147 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
148 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
149 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
150 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
151 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
152 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
153 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
154 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
155 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
156 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
157 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
158 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
159 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
160 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
161 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
162 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
163 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
164 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
165 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
166 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
167 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
168 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
169 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
170 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
171 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
172 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.92
Metatranscriptomes 0.9
Isolates 22.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0.9
Rhizoplane 0.9
Rhizosphere 78.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001992 3300003316 Bacteria 12746
2 Ga0006562J51391_1173827 3300003578 Bacteria 4757
3 Ga0006562J51391_1173828 3300003578 Bacteria 4570
4 Ga0068853_100042458 3300005539 Bacteria 3888
5 Ga0075367_10001803 3300006178 Bacteria 9425
6 Ga0105245_10125496 3300009098 Bacteria 2402
7 Ga0105243_10150506 3300009148 Bacteria 1996
8 Ga0105243_10182211 3300009148 Bacteria 1827
9 Ga0105246_10002694 3300011119 Bacteria 10754
10 Ga0157372_10052411 3300013307 Bacteria 4543
11 Ga0182008_10004774 3300014497 Bacteria 7843
12 Ga0182007_10001086 3300015262 Bacteria 14774
13 Ga0183367_1005 3300015688 Bacteria 652063
14 Ga0209758_1007892 3300025297 Bacteria 7069
15 Ga0207665_10117571 3300025939 Bacteria 1875
16 Ga0207639_10044920 3300026041 Bacteria 3325
17 Ga0307517_10015393 3300028786 Bacteria 10169
18 Ga0307515_10001120 3300028794 Bacteria 61255
19 Ga0307515_10009061 3300028794 Bacteria 19309
20 Ga0307511_10014003 3300030521 Bacteria 7813
21 Ga0307512_10051702 3300030522 Bacteria 3284
22 Ga0307513_10017473 3300031456 Bacteria 8601
23 Ga0307509_10017785 3300031507 Bacteria 8168
24 Ga0307508_10019545 3300031616 Bacteria 6156
25 Ga0307508_10062398 3300031616 Bacteria 3290
26 Ga0307514_10005625 3300031649 Bacteria 11105
27 Ga0307514_10038217 3300031649 Bacteria 3796
28 Ga0307516_10014301 3300031730 Bacteria 8404
29 Ga0307516_10030486 3300031730 Bacteria 5441
30 Ga0307518_10050599 3300031838 Bacteria 3020
31 Ga0307518_10103611 3300031838 Bacteria 2034
32 Ga0307507_10014910 3300033179 Bacteria 9207
33 Ga0307510_10022725 3300033180 Bacteria 7275
34 Ga0307510_10047038 3300033180 Bacteria 4628
35 Ga0395898_0003308 3300037466 Bacteria 18088
36 Ga0395898_0010868 3300037466 Bacteria 9504
37 Ga0395898_0081631 3300037466 Bacteria 3117
38 Ga0395901_0089531 3300038443 Bacteria 3221
39 Ga0439436_0000270 3300041404 Bacteria 12490
40 Ga0439436_0005618 3300041404 Bacteria 3845
41 Ga0439439_0003099 3300041406 Bacteria 3626
42 Ga0439448_0000636 3300042005 Bacteria 8285
43 Ga0439449_0000534 3300042007 Bacteria 14173
44 Ga0439449_0006786 3300042007 Bacteria 4367
45 Ga0439457_000115 3300042014 Bacteria 19277
46 Ga0439462_0017884 3300042015 Bacteria 1838
47 Ga0450903_000181 3300042138 Bacteria 13881
48 Ga0450906_002128 3300042145 Bacteria 4330
49 Ga0466969_0012454 3300044656 Bacteria 4484
50 Ga0466969_0047838 3300044656 Bacteria 2116
51 Ga0466972_0015259 3300044658 Bacteria 3841
52 Ga0466972_0022282 3300044658 Bacteria 3155
53 Ga0466965_0000210 3300044683 Bacteria 18354
54 Ga0466965_0033579 3300044683 Bacteria 2508
55 Ga0466966_0033219 3300044684 Bacteria 3340
56 Ga0466961_0007867 3300044693 Bacteria 6789
57 Ga0466963_0000721 3300044694 Bacteria 16182
58 Ga0466964_0004318 3300044706 Bacteria 5238
59 Ga0466971_0000749 3300044719 Bacteria 13021
60 Ga0466971_0016833 3300044719 Bacteria 3230
61 Ga0466968_0033023 3300044735 Bacteria 2155
62 Ga0466970_0001935 3300044765 Bacteria 10014
63 Ga0466970_0002870 3300044765 Bacteria 8336
64 Ga0466957_0000446 3300044842 Bacteria 20383
65 Ga0466959_0001307 3300045049 Bacteria 15104
66 Ga0466958_0000691 3300045836 Bacteria 14682
67 Ga0466967_0067785 3300045976 Bacteria 3184
68 Ga0466967_0107640 3300045976 Bacteria 2557
69 Ga0495617_006424 3300046452 Bacteria 4119
70 Ga0495627_025239 3300046453 Bacteria 1929
71 Ga0495592_0013280 3300046454 Bacteria 6270
72 Ga0495592_0019668 3300046454 Bacteria 5136
73 Ga0495603_0003302 3300046455 Bacteria 9601
74 Ga0495603_0003630 3300046455 Bacteria 9178
75 Ga0495629_0012638 3300046459 Bacteria 6115
76 Ga0495629_0018766 3300046459 Bacteria 4944
77 Ga0495629_0019047 3300046459 Bacteria 4908
78 Ga0495629_0095770 3300046459 Bacteria 2071
79 Ga0495638_0073244 3300046460 Bacteria 2091
80 Ga0495651_0018204 3300046462 Bacteria 5439
81 Ga0495580_0117655 3300046472 Bacteria 1845
82 Ga0495605_0014443 3300046474 Bacteria 4326
83 Ga0495639_0002908 3300046475 Bacteria 7461
84 Ga0495662_0001947 3300046476 Bacteria 10369
85 Ga0495662_0046518 3300046476 Bacteria 2096
86 Ga0495594_0042679 3300046499 Bacteria 2484
87 Ga0495610_0012210 3300046512 Bacteria 5187
88 Ga0495620_0003824 3300046515 Bacteria 8583
89 Ga0495628_0030131 3300046516 Bacteria 4394
90 Ga0495628_0072631 3300046516 Bacteria 2681
91 Ga0495630_0126467 3300046517 Bacteria 1940
92 Ga0495631_0012577 3300046518 Bacteria 4129
93 Ga0495632_0038958 3300046519 Bacteria 2403
94 Ga0495637_0045204 3300046520 Bacteria 1870
95 Ga0495643_0008906 3300046522 Bacteria 6306
96 Ga0495648_0061648 3300046524 Bacteria 2226
97 Ga0495652_0007364 3300046529 Bacteria 10146
98 Ga0495652_0057857 3300046529 Bacteria 3285
99 Ga0495652_0263299 3300046529 Bacteria 1271
100 Ga0495640_0017486 3300046533 Bacteria 5343
101 Ga0495640_0021378 3300046533 Bacteria 4750
102 Ga0495597_0092611 3300046542 Bacteria 1281
103 Ga0495622_0009930 3300046557 Bacteria 4403
104 Ga0495622_0010549 3300046557 Bacteria 4266
105 Ga0495633_0058238 3300046558 Bacteria 1813
106 Ga0495668_0006036 3300046616 Bacteria 8029
107 Ga0495634_0008267 3300046642 Bacteria 7759
108 Ga0495625_0109218 3300046660 Bacteria 1892
109 Ga0495635_0000703 3300046663 Bacteria 21566
110 Ga0495588_0002146 3300046674 Bacteria 8442
111 Ga0495657_0003831 3300046675 Bacteria 12151
112 Ga0495657_0018100 3300046675 Bacteria 5105
113 Ga0495657_0051692 3300046675 Bacteria 2758
114 Ga0495599_0051756 3300046678 Bacteria 2573
115 Ga0495646_0003020 3300046680 Bacteria 10427
116 Ga0495658_0056225 3300046683 Bacteria 2243
117 Ga0495613_0000749 3300046689 Bacteria 25488
118 Ga0495613_0004284 3300046689 Bacteria 10689
119 Ga0495613_0018933 3300046689 Bacteria 5128
120 Ga0495613_0067700 3300046689 Bacteria 2606
121 Ga0495671_0067261 3300046692 Bacteria 1762
122 Ga0495649_0128226 3300046694 Bacteria 1339
123 Ga0495589_0004729 3300046794 Bacteria 7226
124 Ga0495581_0022731 3300047315 Bacteria 3631
125 Ga0495604_0010587 3300047317 Bacteria 7312
126 Ga0495604_0061774 3300047317 Bacteria 2864
127 Ga0495604_0137354 3300047317 Bacteria 1750
128 Ga0495636_0022422 3300047318 Bacteria 2552
129 Ga0495674_0057271 3300047319 Bacteria 3411
130 Ga0495676_0008157 3300047321 Bacteria 9605
131 Ga0495676_0024278 3300047321 Bacteria 5252
132 Ga0495687_002006 3300047443 Bacteria 17255
133 Ga0495687_026305 3300047443 Bacteria 2741
134 Ga0495675_0026417 3300047444 Bacteria 3702
135 Ga0495685_004425 3300047447 Bacteria 4540
136 Ga0495681_0002469 3300047470 Bacteria 13196
137 Ga0495593_0026734 3300047673 Bacteria 3182
138 Ga0495602_0021639 3300048088 Bacteria 6323
139 Ga0495614_0002572 3300048089 Bacteria 8068
140 Ga0495614_0008154 3300048089 Bacteria 4657
141 Ga0495614_0013863 3300048089 Bacteria 3533
142 Ga0495626_0015198 3300048091 Bacteria 3945
143 Ga0496108_0042769 3300048911 Bacteria 3783
144 Ga0496109_0019690 3300048912 Bacteria 5953
145 Ga0495678_007519 3300049459 Bacteria 5631
146 Ga0495682_0034126 3300049460 Bacteria 1877
147 Ga0501032_0075118 3300049569 Bacteria 2251
148 Ga0501032_0102369 3300049569 Bacteria 1898
149 Ga0501033_0008312 3300049570 Bacteria 8039
150 Ga0501034_0002624 3300049571 Bacteria 21326
151 Ga0501034_0070251 3300049571 Bacteria 3513
152 Ga0501036_0001551 3300049572 Bacteria 17764
153 Ga0501036_0008787 3300049572 Bacteria 8294
154 Ga0501038_0001356 3300049574 Bacteria 22325
155 Ga0501038_0031417 3300049574 Bacteria 4693
156 Ga0501043_0027786 3300049579 Bacteria 4441
157 Ga0501047_0040224 3300049581 Bacteria 4522
158 Ga0501047_0053052 3300049581 Bacteria 3919
159 Ga0501047_0084092 3300049581 Bacteria 3058
160 Ga0501048_0111558 3300049582 Bacteria 1931
161 Ga0501070_0002721 3300049586 Bacteria 15423
162 Ga0501074_0004852 3300049590 Bacteria 9644
163 Ga0501035_0000268 3300049822 Bacteria 61655
164 Ga0501044_0010519 3300049823 Bacteria 10039
165 Ga0501044_0016779 3300049823 Bacteria 7860
166 Ga0501044_0028205 3300049823 Bacteria 5926
167 nmdc:mga06z11_1352_c1 3300050494 Bacteria 9078
168 Ga0495655_0000154 3300053083 Bacteria 12924
169 Ga0500628_000880 3300053129 Bacteria 5299
170 Ga0500600_0083922 3300053149 Bacteria 1716
171 Ga0466962_0008044 3300061719 Bacteria 5054
172 Ga0466962_0030496 3300061719 Bacteria 2583
173 2954763865 2954759201 Bacteria 9358192
174 2554260185 2554235005 Bacteria 6457341
175 2585310146 2582581313 Bacteria 10042643
176 2585313711 2582581314 Bacteria 11452267
177 2616694843 2616644814 Bacteria 11555299
178 2644262565 2643221647 Bacteria 10741251
179 2644437349 2643221678 Bacteria 9540101
180 2644629085 2643221714 Bacteria 9015452
181 2784588810 2784132148 Bacteria 8627943
182 2785343078 2784746763 Bacteria 9783172
183 2785369752 2784746768 Bacteria 10036182
184 2786670829 2786546132 Bacteria 10419719
185 2808842253 2808606359 Bacteria 9866990
186 2808920785 2808606375 Bacteria 9466072
187 2809232424 2808606448 Bacteria 8656184
188 2811849252 2808606982 Bacteria 7791042
189 2812357863 2811994879 Bacteria 9313447
190 2852636440 2852635781 Bacteria 8251373
191 2862285873 2862281513 Bacteria 9621493
192 2862579034 2862574272 Bacteria 10567477
193 2863404370 2863404153 Bacteria 9672205
194 2867432335 2867428634 Bacteria 9590268
195 2873155525 2873151551 Bacteria 8625867
196 2912719730 2912715099 Bacteria 9460473
197 2912731239 2912723979 Bacteria 8557534
198 2919469330 2919468124 Bacteria 9133025
199 2946068002 2946064051 Bacteria 8957905
200 2946076107 2946072368 Bacteria 8999607
201 2947228952 2947224130 Bacteria 9938529
202 2954006494 2954002825 Bacteria 9173742
203 2954385997 2954380949 Bacteria 10050426
204 2954677155 2954673503 Bacteria 9685905
205 2954687001 2954682443 Bacteria 9862841
206 2954696648 2954691527 Bacteria 10720516
207 2954705514 2954701450 Bacteria 10834262
208 2954715997 2954711539 Bacteria 10867210
209 2954725939 2954721474 Bacteria 10456478
210 2954735859 2954731030 Bacteria 10243860
211 2954744875 2954740390 Bacteria 10229294
212 2954754725 2954749733 Bacteria 10366972
213 2990060002 2990059506 Bacteria 9321252
214 3006397877 3006393351 Bacteria 6615579
215 3006497915 3006493962 Bacteria 8825450
216 8008567036 8008558824 Bacteria 10610750
217 8008578698 8008574985 Bacteria 7815457
218 8023624306 8023623736 Bacteria 8593882
219 8048407117 8048406513 Bacteria 8936924
220 8056671756 8056667051 Bacteria 6953971
221 8056835244 8056829672 Bacteria 9045328
222 rootH1_10001992
223 Ga0006562J51391_1173827
224 Ga0006562J51391_1173828
225 Ga0068853_100042458
226 Ga0075367_10001803
227 Ga0105245_10125496
228 Ga0105243_10150506
229 Ga0105243_10182211
230 Ga0105246_10002694
231 Ga0157372_10052411
232 Ga0182008_10004774
233 Ga0182007_10001086
234 Ga0183367_1005
235 Ga0209758_1007892
236 Ga0207665_10117571
237 Ga0207639_10044920
238 Ga0307517_10015393
239 Ga0307515_10001120
240 Ga0307515_10009061
241 Ga0307511_10014003
242 Ga0307512_10051702
243 Ga0307513_10017473
244 Ga0307509_10017785
245 Ga0307508_10019545
246 Ga0307508_10062398
247 Ga0307514_10005625
248 Ga0307514_10038217
249 Ga0307516_10014301
250 Ga0307516_10030486
251 Ga0307518_10050599
252 Ga0307518_10103611
253 Ga0307507_10014910
254 Ga0307510_10022725
255 Ga0307510_10047038
256 Ga0395898_0003308
257 Ga0395898_0010868
258 Ga0395898_0081631
259 Ga0395901_0089531
260 Ga0439436_0000270
261 Ga0439436_0005618
262 Ga0439439_0003099
263 Ga0439448_0000636
264 Ga0439449_0000534
265 Ga0439449_0006786
266 Ga0439457_000115
267 Ga0439462_0017884
268 Ga0450903_000181
269 Ga0450906_002128
270 Ga0466969_0012454
271 Ga0466969_0047838
272 Ga0466972_0015259
273 Ga0466972_0022282
274 Ga0466965_0000210
275 Ga0466965_0033579
276 Ga0466966_0033219
277 Ga0466961_0007867
278 Ga0466963_0000721
279 Ga0466964_0004318
280 Ga0466971_0000749
281 Ga0466971_0016833
282 Ga0466968_0033023
283 Ga0466970_0001935
284 Ga0466970_0002870
285 Ga0466957_0000446
286 Ga0466959_0001307
287 Ga0466958_0000691
288 Ga0466967_0067785
289 Ga0466967_0107640
290 Ga0495617_006424
291 Ga0495627_025239
292 Ga0495592_0013280
293 Ga0495592_0019668
294 Ga0495603_0003302
295 Ga0495603_0003630
296 Ga0495629_0012638
297 Ga0495629_0018766
298 Ga0495629_0019047
299 Ga0495629_0095770
300 Ga0495638_0073244
301 Ga0495651_0018204
302 Ga0495580_0117655
303 Ga0495605_0014443
304 Ga0495639_0002908
305 Ga0495662_0001947
306 Ga0495662_0046518
307 Ga0495594_0042679
308 Ga0495610_0012210
309 Ga0495620_0003824
310 Ga0495628_0030131
311 Ga0495628_0072631
312 Ga0495630_0126467
313 Ga0495631_0012577
314 Ga0495632_0038958
315 Ga0495637_0045204
316 Ga0495643_0008906
317 Ga0495648_0061648
318 Ga0495652_0007364
319 Ga0495652_0057857
320 Ga0495652_0263299
321 Ga0495640_0017486
322 Ga0495640_0021378
323 Ga0495597_0092611
324 Ga0495622_0009930
325 Ga0495622_0010549
326 Ga0495633_0058238
327 Ga0495668_0006036
328 Ga0495634_0008267
329 Ga0495625_0109218
330 Ga0495635_0000703
331 Ga0495588_0002146
332 Ga0495657_0003831
333 Ga0495657_0018100
334 Ga0495657_0051692
335 Ga0495599_0051756
336 Ga0495646_0003020
337 Ga0495658_0056225
338 Ga0495613_0000749
339 Ga0495613_0004284
340 Ga0495613_0018933
341 Ga0495613_0067700
342 Ga0495671_0067261
343 Ga0495649_0128226
344 Ga0495589_0004729
345 Ga0495581_0022731
346 Ga0495604_0010587
347 Ga0495604_0061774
348 Ga0495604_0137354
349 Ga0495636_0022422
350 Ga0495674_0057271
351 Ga0495676_0008157
352 Ga0495676_0024278
353 Ga0495687_002006
354 Ga0495687_026305
355 Ga0495675_0026417
356 Ga0495685_004425
357 Ga0495681_0002469
358 Ga0495593_0026734
359 Ga0495602_0021639
360 Ga0495614_0002572
361 Ga0495614_0008154
362 Ga0495614_0013863
363 Ga0495626_0015198
364 Ga0496108_0042769
365 Ga0496109_0019690
366 Ga0495678_007519
367 Ga0495682_0034126
368 Ga0501032_0075118
369 Ga0501032_0102369
370 Ga0501033_0008312
371 Ga0501034_0002624
372 Ga0501034_0070251
373 Ga0501036_0001551
374 Ga0501036_0008787
375 Ga0501038_0001356
376 Ga0501038_0031417
377 Ga0501043_0027786
378 Ga0501047_0040224
379 Ga0501047_0053052
380 Ga0501047_0084092
381 Ga0501048_0111558
382 Ga0501070_0002721
383 Ga0501074_0004852
384 Ga0501035_0000268
385 Ga0501044_0010519
386 Ga0501044_0016779
387 Ga0501044_0028205
388 nmdc:mga06z11_1352_c1
389 Ga0495655_0000154
390 Ga0500628_000880
391 Ga0500600_0083922
392 Ga0466962_0008044
393 Ga0466962_0030496
394 2954763865
395 2554260185
396 2585310146
397 2585313711
398 2616694843
399 2644262565
400 2644437349
401 2644629085
402 2784588810
403 2785343078
404 2785369752
405 2786670829
406 2808842253
407 2808920785
408 2809232424
409 2811849252
410 2812357863
411 2852636440
412 2862285873
413 2862579034
414 2863404370
415 2867432335
416 2873155525
417 2912719730
418 2912731239
419 2919469330
420 2946068002
421 2946076107
422 2947228952
423 2954006494
424 2954385997
425 2954677155
426 2954687001
427 2954696648
428 2954705514
429 2954715997
430 2954725939
431 2954735859
432 2954744875
433 2954754725
434 2990060002
435 3006397877
436 3006497915
437 8008567036
438 8008578698
439 8023624306
440 8048407117
441 8056671756
442 8056835244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08031

BBE

Berberine and berberine like

496

539

0.98

PF01565

FAD_binding_4

FAD binding domain

112

245

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eo4-assembly2.cif.gz_B physcomitrella patens bbe-like 1 wild-type 0.9171 46 511
6eo5-assembly2.cif.gz_B physcomitrella patens bbe-like 1 variant d396n 0.912 49 511
6fyc-assembly1.cif.gz_B-2 the crystal structure of encm l144m mutant complex with dioxygen under 15 bars o2 pressure 0.9106 49 511
6eo4-assembly2.cif.gz_B physcomitrella patens bbe-like 1 wild-type 0.9056 46 511
6fyb-assembly1.cif.gz_A the crystal structure of encm l144m mutant 0.9021 49 511
ID Description Score Start End Superfamily
af_Q869M2_98_203_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9823 142 247 3.30.465.10
3w8xA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9764 137 246 3.30.465.10
2bvfB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9649 137 247 3.30.465.10
af_Q869M2_98_203_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9642 142 247 3.30.465.10
af_Q54U09_47_214_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9544 86 246 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A060BU92-F1-model_v4 CAZy families GT22 protein 0.964 128 247 GO:0016491
GO:0071949
AF-A0A7R9VP26-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9607 49 247 GO:0016491
GO:0071949
AF-A0A7C5RT92-F1-model_v4 FAD-binding oxidoreductase 0.9581 47 247 GO:0016491
GO:0071949
AF-A0A543FPB9-F1-model_v4 FAD/FMN-containing dehydrogenase 0.9541 55 511 GO:0016491
GO:0071949
AF-A0A819HSZ0-F1-model_v4 NAD(P)(+)--arginine ADP-ribosyltransferase (EC 2.4.2.31) (Mono(ADP-ribosyl)transferase) 0.9535 80 249 GO:0016491
GO:0016779
GO:0071949
GO:0106274

Map